F426029

General Info

Members Datasets Scaffolds Average Seq Length
372 260 372 292

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10374899|Ga0111539_103748992
Length 302
Sequence MPRRSEQEFPMPQVTTNDGVRLYYEEVGSGYPVVFVHEFAGDYRSYETQLRFFARRYRCIAFNARGYPPSDVPEDWRLYSQERARDDIRDVLDGLNIAKAHVVGISMGGFAVLHFGFAYPERASSLVVAGCGYGAQPDKKEQFQEEVARVAAAIEGSGMAEVSKTYGAGPTRVQYQNKDPRGYAEFLGQLAEHSTPGAANTQRGVQGRRPSLWELTEQMKKLDVPTLIATGDEDDPCLEPGLLMKRLIPSAALVVFPNTGHALNIEEPDLFNRSLADFFHQVESGRWPRRDPRSVTGSILGM

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
87 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
134 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
135 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
136 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
138 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
140 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
141 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
142 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
143 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
144 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
149 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
150 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
161 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
162 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
163 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
174 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
175 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
194 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
234 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
235 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
236 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
249 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
251 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
252 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
253 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
254 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
255 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
256 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
257 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.57
Nodule 0
Rhizoplane 2.42
Rhizosphere 88.44
Stem 0
Stem Tuber 0
Unclassified 4.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10200199 3300003323 Bacteria 2520
2 Ga0070690_100000440 3300005330 Bacteria 21026
3 Ga0068869_100000806 3300005334 Bacteria 17893
4 Ga0070680_100000656 3300005336 Bacteria 23985
5 Ga0070682_100002698 3300005337 Bacteria 9824
6 Ga0068868_100001558 3300005338 Bacteria 15670
7 Ga0070660_100510823 3300005339 Unclassified 1000
8 Ga0070689_100000287 3300005340 Bacteria 29278
9 Ga0070687_100000294 3300005343 Bacteria 16865
10 Ga0070668_100008002 3300005347 Bacteria 7854
11 Ga0070669_100143111 3300005353 Bacteria 1845
12 Ga0070675_100171790 3300005354 Bacteria 1870
13 Ga0070673_100123697 3300005364 Bacteria 2162
14 Ga0070673_100227138 3300005364 Bacteria 1618
15 Ga0070703_10013121 3300005406 Bacteria 2349
16 Ga0070703_10014974 3300005406 Bacteria 2215
17 Ga0070714_100156792 3300005435 Unclassified 2056
18 Ga0070714_100334125 3300005435 Bacteria 1420
19 Ga0070713_100051887 3300005436 Bacteria 3394
20 Ga0070713_100081079 3300005436 Bacteria 2768
21 Ga0070713_100155565 3300005436 Bacteria 2037
22 Ga0070701_10000231 3300005438 Bacteria 17724
23 Ga0070705_100001497 3300005440 Bacteria 12319
24 Ga0070705_100038692 3300005440 Bacteria 2701
25 Ga0070700_100008623 3300005441 Bacteria 5556
26 Ga0070694_100000090 3300005444 Bacteria 43268
27 Ga0070708_100036915 3300005445 Bacteria 4262
28 Ga0070708_100181005 3300005445 Unclassified 1970
29 Ga0070678_100103049 3300005456 Bacteria 2216
30 Ga0070662_100007815 3300005457 Bacteria 6947
31 Ga0070681_10008872 3300005458 Bacteria 9880
32 Ga0070681_10086228 3300005458 Bacteria 3093
33 Ga0068867_100000595 3300005459 Bacteria 23912
34 Ga0070706_100282349 3300005467 Bacteria 1549
35 Ga0070706_100420108 3300005467 Bacteria 1244
36 Ga0070698_100061807 3300005471 Bacteria 3780
37 Ga0070699_100306733 3300005518 Bacteria 1425
38 Ga0070679_100415655 3300005530 Bacteria 1290
39 Ga0070697_100199353 3300005536 Bacteria 1701
40 Ga0068853_100014577 3300005539 Bacteria 6444
41 Ga0070686_100000815 3300005544 Bacteria 18064
42 Ga0070695_100000079 3300005545 Bacteria 39939
43 Ga0070696_100000170 3300005546 Bacteria 37218
44 Ga0070696_100000296 3300005546 Bacteria 30020
45 Ga0070693_100000321 3300005547 Bacteria 22045
46 Ga0070704_100000445 3300005549 Bacteria 19437
47 Ga0068855_100026854 3300005563 Bacteria 6889
48 Ga0068855_100299533 3300005563 Bacteria 1781
49 Ga0068855_100629209 3300005563 Bacteria 1155
50 Ga0068854_100004057 3300005578 Bacteria 9196
51 Ga0068854_100096474 3300005578 Bacteria 2209
52 Ga0068856_100005486 3300005614 Bacteria 12496
53 Ga0070702_100000068 3300005615 Bacteria 29170
54 Ga0070702_100047015 3300005615 Bacteria 2449
55 Ga0068859_100002721 3300005617 Bacteria 17925
56 Ga0068859_100062954 3300005617 Bacteria 3740
57 Ga0068864_100081964 3300005618 Bacteria 2830
58 Ga0068866_10000631 3300005718 Bacteria 15998
59 Ga0068861_100000070 3300005719 Bacteria 49394
60 Ga0068861_100012679 3300005719 Bacteria 5882
61 Ga0068870_10020337 3300005840 Bacteria 3231
62 Ga0068858_100003760 3300005842 Bacteria 15012
63 Ga0068860_100002032 3300005843 Bacteria 21330
64 Ga0068860_100225596 3300005843 Bacteria 1820
65 Ga0068862_100000975 3300005844 Bacteria 27450
66 Ga0068862_100051805 3300005844 Bacteria 3511
67 Ga0068862_100274852 3300005844 Bacteria 1542
68 Ga0081455_10251574 3300005937 Bacteria 1292
69 Ga0081538_10011974 3300005981 Bacteria 6991
70 Ga0081540_1009053 3300005983 Bacteria 6881
71 Ga0075369_10003098 3300006186 Bacteria 6017
72 Ga0075366_10037583 3300006195 Bacteria 2859
73 Ga0075366_10065994 3300006195 Bacteria 2153
74 Ga0097621_100000468 3300006237 Bacteria 28316
75 Ga0075370_10025086 3300006353 Bacteria 3296
76 Ga0068871_100000188 3300006358 Bacteria 42040
77 Ga0075428_100000109 3300006844 Bacteria 69948
78 Ga0075430_100016218 3300006846 Bacteria 6345
79 Ga0075431_100005187 3300006847 Bacteria 12829
80 Ga0075433_10001494 3300006852 Bacteria 17286
81 Ga0075433_10063982 3300006852 Bacteria 3224
82 Ga0075434_100000349 3300006871 Bacteria 33394
83 Ga0075434_100021299 3300006871 Bacteria 6302
84 Ga0075434_100271124 3300006871 Bacteria 1716
85 Ga0075429_100001875 3300006880 Bacteria 17419
86 Ga0075429_100028692 3300006880 Bacteria 4833
87 Ga0068865_100000774 3300006881 Bacteria 17943
88 Ga0075436_100000075 3300006914 Bacteria 59554
89 Ga0075436_100003254 3300006914 Bacteria 11122
90 Ga0075436_100008688 3300006914 Bacteria 6943
91 Ga0075436_100026092 3300006914 Bacteria 4023
92 Ga0097620_100002721 3300006931 Bacteria 17925
93 Ga0097620_100062952 3300006931 Bacteria 3740
94 Ga0075435_100000116 3300007076 Bacteria 44259
95 Ga0099795_10082321 3300007788 Bacteria 1234
96 Ga0099795_10092591 3300007788 Bacteria 1174
97 Ga0105240_10503021 3300009093 Bacteria 1347
98 Ga0111539_10001832 3300009094 Bacteria 28267
99 Ga0111539_10005738 3300009094 Bacteria 16054
100 Ga0111539_10006398 3300009094 Bacteria 15194
101 Ga0111539_10374899 3300009094 Bacteria 1656
102 Ga0105245_10001758 3300009098 Bacteria 19754
103 Ga0105245_10004295 3300009098 Bacteria 12622
104 Ga0114129_10001030 3300009147 Bacteria 36420
105 Ga0114129_10032825 3300009147 Bacteria 7335
106 Ga0105243_10004393 3300009148 Bacteria 11153
107 Ga0105241_10008485 3300009174 Bacteria 7554
108 Ga0105242_10000161 3300009176 Bacteria 50082
109 Ga0105248_10358285 3300009177 Bacteria 1642
110 Ga0105249_10003007 3300009553 Bacteria 14541
111 Ga0099796_10002945 3300010159 Bacteria 3852
112 Ga0099796_10076028 3300010159 Unclassified 1222
113 Ga0105239_10155643 3300010375 Bacteria 2552
114 Ga0105246_10183411 3300011119 Bacteria 1613
115 Ga0157378_10001854 3300013297 Bacteria 18981
116 Ga0163162_10130067 3300013306 Bacteria 2626
117 Ga0182008_10089618 3300014497 Bacteria 1516
118 Ga0157379_10156974 3300014968 Bacteria 2053
119 Ga0157376_10002507 3300014969 Bacteria 12440
120 Ga0163161_10091117 3300017792 Bacteria 2256
121 Ga0213872_10105364 3300021361 Bacteria 1255
122 Ga0213874_10014439 3300021377 Bacteria 2066
123 Ga0213876_10060071 3300021384 Bacteria 2006
124 Ga0213876_10231521 3300021384 Bacteria 982
125 Ga0213875_10000189 3300021388 Bacteria 63108
126 Ga0213875_10039457 3300021388 Bacteria 2224
127 Ga0207653_10005768 3300025885 Bacteria 3861
128 Ga0207692_10230648 3300025898 Unclassified 1102
129 Ga0207642_10000249 3300025899 Bacteria 16057
130 Ga0207688_10153428 3300025901 Unclassified 1362
131 Ga0207699_10156404 3300025906 Bacteria 1513
132 Ga0207643_10033718 3300025908 Bacteria 2865
133 Ga0207654_10018671 3300025911 Bacteria 3643
134 Ga0207707_10005043 3300025912 Bacteria 11589
135 Ga0207695_10086718 3300025913 Bacteria 3156
136 Ga0207693_10011477 3300025915 Bacteria 7166
137 Ga0207693_10033693 3300025915 Bacteria 4041
138 Ga0207663_10071113 3300025916 Bacteria 2244
139 Ga0207663_10203793 3300025916 Bacteria 1429
140 Ga0207660_10003897 3300025917 Bacteria 9726
141 Ga0207662_10000064 3300025918 Bacteria 46399
142 Ga0207646_10024927 3300025922 Bacteria 5473
143 Ga0207681_10081722 3300025923 Bacteria 2282
144 Ga0207681_10120707 3300025923 Bacteria 1922
145 Ga0207659_10157701 3300025926 Bacteria 1779
146 Ga0207687_10000267 3300025927 Bacteria 35541
147 Ga0207687_10027852 3300025927 Bacteria 3793
148 Ga0207700_10021530 3300025928 Bacteria 4404
149 Ga0207700_10055111 3300025928 Bacteria 2988
150 Ga0207700_10119234 3300025928 Bacteria 2136
151 Ga0207700_10279372 3300025928 Unclassified 1436
152 Ga0207706_10008368 3300025933 Bacteria 9544
153 Ga0207686_10065519 3300025934 Bacteria 2317
154 Ga0207709_10000473 3300025935 Bacteria 36885
155 Ga0207670_10003751 3300025936 Bacteria 8074
156 Ga0207670_10022528 3300025936 Bacteria 3906
157 Ga0207669_10528550 3300025937 Bacteria 948
158 Ga0207704_10000581 3300025938 Bacteria 16249
159 Ga0207689_10000200 3300025942 Bacteria 52703
160 Ga0207667_10006516 3300025949 Bacteria 14127
161 Ga0207667_10238610 3300025949 Bacteria 1861
162 Ga0207712_10001270 3300025961 Bacteria 17369
163 Ga0207712_10003450 3300025961 Bacteria 9989
164 Ga0207677_10010986 3300026023 Bacteria 5143
165 Ga0207703_10009109 3300026035 Bacteria 7816
166 Ga0207639_10008151 3300026041 Bacteria 7163
167 Ga0207708_10001866 3300026075 Bacteria 15534
168 Ga0207702_10009686 3300026078 Bacteria 8090
169 Ga0207648_10000309 3300026089 Bacteria 53487
170 Ga0207675_100000089 3300026118 Bacteria 71258
171 Ga0207675_100000839 3300026118 Bacteria 30616
172 Ga0207683_10390386 3300026121 Bacteria 1280
173 Ga0207428_10002692 3300027907 Bacteria 17705
174 Ga0207428_10005877 3300027907 Bacteria 11370
175 Ga0207428_10197292 3300027907 Bacteria 1515
176 Ga0268265_10002816 3300028380 Bacteria 12795
177 Ga0268264_10001651 3300028381 Bacteria 20603
178 Ga0307511_10000216 3300030521 Bacteria 58288
179 Ga0265325_10005278 3300031241 Bacteria 8010
180 Ga0307405_10078294 3300031731 Bacteria 2151
181 Ga0307409_100185646 3300031995 Bacteria 1845
182 Ga0307416_100006871 3300032002 Bacteria 7162
183 Ga0373929_0004446 3300035085 Bacteria 2513
184 Ga0373929_0021336 3300035085 Bacteria 1313
185 Ga0373934_0023273 3300035086 Bacteria 2393
186 Ga0373934_0085981 3300035086 Bacteria 1265
187 Ga0373949_0025099 3300035090 Bacteria 1389
188 Ga0373923_0009272 3300035111 Bacteria 3547
189 Ga0373932_0024275 3300035112 Bacteria 1630
190 Ga0373936_0001521 3300035113 Bacteria 8436
191 Ga0373936_0008198 3300035113 Bacteria 3926
192 Ga0373936_0010505 3300035113 Bacteria 3494
193 Ga0373939_0004879 3300035114 Bacteria 3182
194 Ga0373941_0011259 3300035115 Bacteria 2307
195 Ga0373941_0076963 3300035115 Bacteria 1119
196 Ga0373945_0000982 3300035116 Bacteria 8516
197 Ga0373945_0002868 3300035116 Bacteria 5417
198 Ga0373953_0022574 3300035117 Bacteria 2374
199 Ga0373954_0003405 3300035118 Bacteria 6734
200 Ga0373960_0048312 3300035121 Bacteria 1255
201 Ga0373943_0002679 3300035170 Bacteria 8093
202 Ga0373943_0020216 3300035170 Bacteria 3068
203 Ga0373943_0086697 3300035170 Bacteria 1615
204 Ga0373946_0004375 3300035171 Bacteria 5060
205 Ga0373955_0000218 3300035172 Bacteria 24095
206 Ga0373961_0090742 3300035241 Bacteria 975
207 Ga0373962_0018301 3300035242 Bacteria 1822
208 Ga0373924_0022303 3300035410 Bacteria 2475
209 Ga0373931_0002168 3300035691 Bacteria 8651
210 Ga0373931_0017523 3300035691 Bacteria 3546
211 Ga0373935_0000260 3300035692 Bacteria 26221
212 Ga0373935_0080847 3300035692 Bacteria 2112
213 Ga0373935_0084628 3300035692 Bacteria 2066
214 Ga0373935_0113975 3300035692 Bacteria 1798
215 Ga0373927_0003881 3300035695 Bacteria 10599
216 Ga0373927_0017047 3300035695 Bacteria 4786
217 Ga0373927_0040828 3300035695 Bacteria 3009
218 Ga0373933_0004564 3300035724 Bacteria 7590
219 Ga0373947_0007059 3300035725 Bacteria 6509
220 Ga0373947_0008661 3300035725 Bacteria 5854
221 Ga0373947_0012091 3300035725 Bacteria 4944
222 Ga0373937_0000697 3300036401 Bacteria 29311
223 Ga0373925_0000071 3300037068 Bacteria 106825
224 Ga0373925_0009958 3300037068 Bacteria 6903
225 Ga0373925_0111445 3300037068 Unclassified 2114
226 Ga0373925_0174812 3300037068 Bacteria 1697
227 Ga0373925_0179148 3300037068 Bacteria 1676
228 Ga0436364_0463644 3300037853 Unclassified 2235
229 Ga0436364_0648577 3300037853 Bacteria 1375
230 Ga0436364_1269605 3300037853 Bacteria 19715
231 Ga0436364_1378189 3300037853 Bacteria 2556
232 Ga0436364_1480641 3300037853 Bacteria 33054
233 Ga0436364_1514411 3300037853 Bacteria 3351
234 Ga0436365_0561561 3300039437 Bacteria 1644
235 Ga0436365_1663154 3300039437 Bacteria 5079
236 Ga0436365_1893197 3300039437 Bacteria 1246
237 Ga0436360_1131979 3300039438 Bacteria 1381
238 Ga0436361_0089185 3300039447 Bacteria 7542
239 Ga0436361_0094315 3300039447 Bacteria 6956
240 Ga0436363_1288856 3300039450 Bacteria 2117
241 Ga0436362_0134496 3300039453 Unclassified 2521
242 Ga0436362_0414841 3300039453 Bacteria 1819
243 Ga0451577_0197016 3300042876 Unclassified 1818
244 Ga0451576_0001678 3300045051 Bacteria 36726
245 Ga0451576_0021497 3300045051 Bacteria 7013
246 Ga0451576_0135309 3300045051 Bacteria 2569
247 Ga0451576_0244918 3300045051 Bacteria 1873
248 Ga0495592_0000117 3300046454 Bacteria 69975
249 Ga0495603_0035696 3300046455 Bacteria 2986
250 Ga0495629_0011403 3300046459 Bacteria 6456
251 Ga0495651_0000156 3300046462 Bacteria 50159
252 Ga0495653_0000047 3300046463 Bacteria 111093
253 Ga0495580_0008568 3300046472 Bacteria 8114
254 Ga0495582_0029711 3300046473 Bacteria 3000
255 Ga0495639_0061687 3300046475 Bacteria 1719
256 Ga0495639_0085046 3300046475 Bacteria 1478
257 Ga0495662_0052595 3300046476 Bacteria 1966
258 Ga0495664_0000024 3300046477 Bacteria 126593
259 Ga0495608_0000004 3300046511 Bacteria 355027
260 Ga0495618_0000036 3300046514 Bacteria 101535
261 Ga0495628_0000006 3300046516 Bacteria 306606
262 Ga0495628_0258287 3300046516 Bacteria 1299
263 Ga0495630_0000575 3300046517 Bacteria 26810
264 Ga0495666_0022986 3300046526 Bacteria 3085
265 Ga0495652_0000038 3300046529 Bacteria 129311
266 Ga0495640_0000001 3300046533 Bacteria 853827
267 Ga0495586_0002775 3300046535 Bacteria 9467
268 Ga0495586_0092020 3300046535 Bacteria 1676
269 Ga0495587_0000004 3300046536 Bacteria 358433
270 Ga0495598_0002102 3300046537 Bacteria 4063
271 Ga0495645_0000001 3300046543 Bacteria 657910
272 Ga0495667_0000093 3300046559 Bacteria 65066
273 Ga0495667_0158135 3300046559 Bacteria 1458
274 Ga0495634_0016330 3300046642 Bacteria 5310
275 Ga0495635_0000003 3300046663 Bacteria 390055
276 Ga0495588_0016001 3300046674 Bacteria 3620
277 Ga0495657_0003983 3300046675 Bacteria 11851
278 Ga0495599_0000012 3300046678 Bacteria 181156
279 Ga0495623_0000015 3300046679 Bacteria 117329
280 Ga0495646_0000005 3300046680 Bacteria 266899
281 Ga0495658_0046435 3300046683 Bacteria 2441
282 Ga0495669_0148682 3300046684 Bacteria 1108
283 Ga0495624_0060792 3300046690 Bacteria 2368
284 Ga0495600_0000051 3300046809 Bacteria 69572
285 Ga0495604_0000002 3300047317 Bacteria 530904
286 Ga0495674_0000004 3300047319 Bacteria 531855
287 Ga0495680_0006865 3300047322 Bacteria 10517
288 Ga0495680_0139710 3300047322 Bacteria 1773
289 Ga0495680_0158033 3300047322 Bacteria 1648
290 Ga0495675_0000465 3300047444 Bacteria 26712
291 Ga0495684_0000004 3300047471 Bacteria 307093
292 Ga0495684_0178241 3300047471 Bacteria 1577
293 Ga0495593_0005703 3300047673 Bacteria 7348
294 Ga0495602_0000001 3300048088 Bacteria 510904
295 Ga0496101_0242817 3300048904 Bacteria 1402
296 Ga0496102_0092287 3300048905 Bacteria 2804
297 Ga0496104_0009678 3300048907 Bacteria 8587
298 Ga0496104_0262771 3300048907 Unclassified 1639
299 Ga0496108_0336549 3300048911 Bacteria 1317
300 Ga0496110_0174488 3300048913 Bacteria 1951
301 Ga0496113_0151647 3300048916 Bacteria 1829
302 Ga0496114_0168493 3300048917 Bacteria 1908
303 Ga0496115_0033488 3300048918 Bacteria 4057
304 Ga0501032_0252077 3300049569 Bacteria 1146
305 Ga0501033_0112639 3300049570 Bacteria 1979
306 Ga0501036_0004646 3300049572 Bacteria 11098
307 Ga0501036_0260828 3300049572 Bacteria 1452
308 Ga0501040_0003091 3300049576 Bacteria 10796
309 Ga0501040_0136809 3300049576 Bacteria 1725
310 Ga0501040_0269048 3300049576 Bacteria 1217
311 Ga0501041_0033306 3300049577 Bacteria 3117
312 Ga0501041_0149704 3300049577 Bacteria 1457
313 Ga0501042_0024750 3300049578 Bacteria 4212
314 Ga0501042_0139756 3300049578 Bacteria 1746
315 Ga0501048_0023807 3300049582 Bacteria 4472
316 Ga0501067_0025805 3300049583 Bacteria 3257
317 Ga0501071_0007398 3300049587 Bacteria 7206
318 Ga0501071_0141311 3300049587 Bacteria 1793
319 Ga0501072_0004856 3300049588 Bacteria 10230
320 Ga0501074_0028628 3300049590 Bacteria 4038
321 Ga0501075_0006585 3300049591 Bacteria 8001
322 Ga0501076_0000870 3300049592 Bacteria 19633
323 Ga0501077_0113366 3300049593 Bacteria 1719
324 Ga0501079_0046518 3300049741 Bacteria 3348
325 Ga0501079_0169411 3300049741 Bacteria 1703
326 Ga0501080_0012676 3300049742 Bacteria 7731
327 Ga0501081_0046359 3300049743 Bacteria 2987
328 Ga0501083_0301204 3300049744 Bacteria 1043
329 Ga0501035_0136644 3300049822 Bacteria 2134
330 Ga0501045_0003545 3300049824 Bacteria 10711
331 Ga0501045_0045431 3300049824 Bacteria 3198
332 nmdc:mga03683_7300_c1 3300050489 Bacteria 3830
333 nmdc:mga0k408_109935_c1 3300050493 Bacteria 1629
334 nmdc:mga0k408_86828_c1 3300050493 Bacteria 1837
335 nmdc:mga07m45_3597_c1 3300050496 Bacteria 7490
336 nmdc:mga05p37_5784_c1 3300050507 Bacteria 14534
337 nmdc:mga05p37_72_c1 3300050507 Bacteria 88725
338 nmdc:mga09592_14341_c1 3300050508 Bacteria 6470
339 nmdc:mga09592_259_c1 3300050508 Bacteria 38550
340 nmdc:mga0qj67_4903_c1 3300050509 Bacteria 9732
341 nmdc:mga06r32_2762_c1 3300050510 Bacteria 15703
342 nmdc:mga08y16_2144_c1 3300050511 Bacteria 20246
343 nmdc:mga08y16_418209_c1 3300050511 Bacteria 1370
344 nmdc:mga08y16_4422_c1 3300050511 Bacteria 14685
345 nmdc:mga08y16_83354_c1 3300050511 Bacteria 3332
346 nmdc:mga0n895_163156_c1 3300050512 Bacteria 2260
347 nmdc:mga0n895_92731_c1 3300050512 Bacteria 3024
348 nmdc:mga0rr50_374_c1 3300050513 Bacteria 24484
349 nmdc:mga08x19_1134_c1 3300050514 Bacteria 16616
350 nmdc:mga08x19_3627_c1 3300050514 Bacteria 9191
351 nmdc:mga0a205_1144_c1 3300050515 Bacteria 22034
352 nmdc:mga0a205_46157_c1 3300050515 Bacteria 4201
353 nmdc:mga0sz30_14778_c1 3300050516 Bacteria 1483
354 nmdc:mga0sz30_83261_c1 3300050516 Bacteria 1386
355 Ga0495601_0000026 3300053077 Bacteria 126257
356 Ga0495612_0000012 3300053078 Bacteria 223883
357 Ga0495595_0000346 3300053084 Bacteria 17651
358 Ga0495595_0031285 3300053084 Bacteria 2391
359 Ga0495595_0046254 3300053084 Bacteria 2004
360 Ga0495619_0000003 3300053085 Bacteria 515784
361 Ga0495619_0029333 3300053085 Bacteria 3553
362 Ga0500644_0020354 3300053088 Bacteria 1971
363 Ga0500646_0004591 3300053090 Bacteria 3493
364 Ga0500594_0059464 3300053118 Bacteria 1098
365 Ga0500655_002183 3300053133 Bacteria 3610
366 Ga0500568_0013857 3300053139 Bacteria 3662
367 Ga0500604_0000701 3300053151 Bacteria 9187
368 Ga0500637_0233379 3300053178 Bacteria 1035
369 Ga0501084_0002778 3300054114 Bacteria 14139
370 Ga0501082_0021380 3300060353 Bacteria 5581
371 Ga0501082_0314657 3300060353 Bacteria 1364
372 Ga0530510_0004260 3300061734 Bacteria 9897

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035085 Ga0373929_0021336 Ga0373929_0021336_500_1267 251
2 3300046526 Ga0495666_0022986 Ga0495666_0022986_2300_3064 251
3 3300049744 Ga0501083_0301204 Ga0501083_0301204_33_797 251
4 3300035241 Ga0373961_0090742 Ga0373961_0090742_28_852 270
5 3300053178 Ga0500637_0233379 Ga0500637_0233379_126_1013 270
6 3300006195 Ga0075366_10065994 Ga0075366_100659942 271
7 3300050493 nmdc:mga0k408_109935_c1 nmdc:mga0k408_109935_c1_295_1182 271
8 3300025916 Ga0207663_10203793 Ga0207663_102037932 281
9 3300049572 Ga0501036_0260828 Ga0501036_0260828_501_1355 281
10 3300049576 Ga0501040_0136809 Ga0501040_0136809_308_1162 281
11 3300049577 Ga0501041_0149704 Ga0501041_0149704_268_1122 281
12 3300049741 Ga0501079_0169411 Ga0501079_0169411_267_1121 281
13 3300049824 Ga0501045_0045431 Ga0501045_0045431_1994_2848 281
14 3300005406 Ga0070703_10013121 Ga0070703_100131212 282
15 3300005467 Ga0070706_100282349 Ga0070706_1002823492 282
16 3300005536 Ga0070697_100199353 Ga0070697_1001993532 282
17 3300006871 Ga0075434_100021299 Ga0075434_1000212995 282
18 3300006914 Ga0075436_100003254 Ga0075436_1000032548 282
19 3300007788 Ga0099795_10092591 Ga0099795_100925911 282
20 3300025928 Ga0207700_10279372 Ga0207700_102793722 282
21 3300039447 Ga0436361_0089185 Ga0436361_0089185_6536_7393 282
22 3300039453 Ga0436362_0414841 Ga0436362_0414841_389_1246 282
23 3300048907 Ga0496104_0009678 Ga0496104_0009678_6685_7542 282
24 3300048911 Ga0496108_0336549 Ga0496108_0336549_100_957 282
25 3300048913 Ga0496110_0174488 Ga0496110_0174488_208_1065 282
26 3300048918 Ga0496115_0033488 Ga0496115_0033488_190_1047 282
27 3300049576 Ga0501040_0269048 Ga0501040_0269048_289_1146 282
28 3300049578 Ga0501042_0139756 Ga0501042_0139756_140_997 282
29 3300050512 nmdc:mga0n895_163156_c1 nmdc:mga0n895_163156_c1_1367_2224 282
30 3300050514 nmdc:mga08x19_3627_c1 nmdc:mga08x19_3627_c1_6087_6944 282
31 3300060353 Ga0501082_0314657 Ga0501082_0314657_444_1301 282
32 3300025915 Ga0207693_10033693 Ga0207693_100336933 283
33 3300037853 Ga0436364_0648577 Ga0436364_0648577_177_1037 283
34 3300037853 Ga0436364_1378189 Ga0436364_1378189_603_1463 283
35 3300039437 Ga0436365_1663154 Ga0436365_1663154_1693_2553 283
36 3300046559 Ga0495667_0158135 Ga0495667_0158135_150_1016 283
37 3300047322 Ga0495680_0158033 Ga0495680_0158033_658_1524 283
38 3300047471 Ga0495684_0178241 Ga0495684_0178241_604_1470 283
39 3300048904 Ga0496101_0242817 Ga0496101_0242817_469_1329 283
40 3300048905 Ga0496102_0092287 Ga0496102_0092287_705_1565 283
41 3300048917 Ga0496114_0168493 Ga0496114_0168493_725_1585 283
42 3300053084 Ga0495595_0046254 Ga0495595_0046254_89_949 283
43 3300053085 Ga0495619_0029333 Ga0495619_0029333_1058_1924 283
44 3300053118 Ga0500594_0059464 Ga0500594_0059464_23_910 283
45 3300006914 Ga0075436_100026092 Ga0075436_1000260923 289
46 3300021361 Ga0213872_10105364 Ga0213872_101053641 289
47 3300025913 Ga0207695_10086718 Ga0207695_100867182 289
48 3300031241 Ga0265325_10005278 Ga0265325_100052782 289
49 3300037068 Ga0373925_0174812 Ga0373925_0174812_159_1031 289
50 3300039447 Ga0436361_0094315 Ga0436361_0094315_3123_3995 289
51 3300046516 Ga0495628_0258287 Ga0495628_0258287_11_889 289
52 3300048907 Ga0496104_0262771 Ga0496104_0262771_541_1413 289
53 3300005330 Ga0070690_100000440 Ga0070690_10000044011 290
54 3300005334 Ga0068869_100000806 Ga0068869_1000008069 290
55 3300005336 Ga0070680_100000656 Ga0070680_10000065617 290
56 3300005337 Ga0070682_100002698 Ga0070682_10000269810 290
57 3300005338 Ga0068868_100001558 Ga0068868_1000015589 290
58 3300005340 Ga0070689_100000287 Ga0070689_10000028725 290
59 3300005343 Ga0070687_100000294 Ga0070687_1000002949 290
60 3300005354 Ga0070675_100171790 Ga0070675_1001717902 290
61 3300005364 Ga0070673_100123697 Ga0070673_1001236973 290
62 3300005364 Ga0070673_100227138 Ga0070673_1002271382 290
63 3300005406 Ga0070703_10014974 Ga0070703_100149742 290
64 3300005438 Ga0070701_10000231 Ga0070701_100002319 290
65 3300005440 Ga0070705_100001497 Ga0070705_1000014977 290
66 3300005440 Ga0070705_100038692 Ga0070705_1000386923 290
67 3300005441 Ga0070700_100008623 Ga0070700_1000086232 290
68 3300005444 Ga0070694_100000090 Ga0070694_10000009030 290
69 3300005445 Ga0070708_100036915 Ga0070708_1000369155 290
70 3300005456 Ga0070678_100103049 Ga0070678_1001030491 290
71 3300005458 Ga0070681_10008872 Ga0070681_100088729 290
72 3300005458 Ga0070681_10086228 Ga0070681_100862284 290
73 3300005459 Ga0068867_100000595 Ga0068867_10000059514 290
74 3300005530 Ga0070679_100415655 Ga0070679_1004156552 290
75 3300005539 Ga0068853_100014577 Ga0068853_1000145776 290
76 3300005544 Ga0070686_100000815 Ga0070686_1000008159 290
77 3300005545 Ga0070695_100000079 Ga0070695_10000007910 290
78 3300005546 Ga0070696_100000170 Ga0070696_10000017033 290
79 3300005546 Ga0070696_100000296 Ga0070696_10000029626 290
80 3300005547 Ga0070693_100000321 Ga0070693_10000032112 290
81 3300005549 Ga0070704_100000445 Ga0070704_10000044514 290
82 3300005563 Ga0068855_100026854 Ga0068855_1000268542 290
83 3300005563 Ga0068855_100299533 Ga0068855_1002995333 290
84 3300005578 Ga0068854_100004057 Ga0068854_1000040578 290
85 3300005614 Ga0068856_100005486 Ga0068856_10000548613 290
86 3300005615 Ga0070702_100000068 Ga0070702_10000006823 290
87 3300005617 Ga0068859_100002721 Ga0068859_10000272115 290
88 3300005617 Ga0068859_100062954 Ga0068859_1000629544 290
89 3300005618 Ga0068864_100081964 Ga0068864_1000819645 290
90 3300005718 Ga0068866_10000631 Ga0068866_1000063115 290
91 3300005719 Ga0068861_100000070 Ga0068861_10000007042 290
92 3300005840 Ga0068870_10020337 Ga0068870_100203373 290
93 3300005842 Ga0068858_100003760 Ga0068858_1000037604 290
94 3300005843 Ga0068860_100002032 Ga0068860_10000203211 290
95 3300005843 Ga0068860_100225596 Ga0068860_1002255963 290
96 3300005844 Ga0068862_100000975 Ga0068862_10000097523 290
97 3300005844 Ga0068862_100274852 Ga0068862_1002748522 290
98 3300006237 Ga0097621_100000468 Ga0097621_1000004686 290
99 3300006358 Ga0068871_100000188 Ga0068871_10000018811 290
100 3300006844 Ga0075428_100000109 Ga0075428_10000010929 290
101 3300006852 Ga0075433_10001494 Ga0075433_1000149413 290
102 3300006852 Ga0075433_10063982 Ga0075433_100639822 290
103 3300006871 Ga0075434_100000349 Ga0075434_10000034916 290
104 3300006871 Ga0075434_100271124 Ga0075434_1002711243 290
105 3300006880 Ga0075429_100001875 Ga0075429_1000018758 290
106 3300006881 Ga0068865_100000774 Ga0068865_10000077415 290
107 3300006914 Ga0075436_100000075 Ga0075436_10000007548 290
108 3300006914 Ga0075436_100008688 Ga0075436_1000086884 290
109 3300006931 Ga0097620_100002721 Ga0097620_10000272115 290
110 3300006931 Ga0097620_100062952 Ga0097620_1000629524 290
111 3300007076 Ga0075435_100000116 Ga0075435_10000011626 290
112 3300009094 Ga0111539_10001832 Ga0111539_100018326 290
113 3300009094 Ga0111539_10006398 Ga0111539_1000639813 290
114 3300009098 Ga0105245_10001758 Ga0105245_1000175811 290
115 3300009147 Ga0114129_10001030 Ga0114129_100010306 290
116 3300009148 Ga0105243_10004393 Ga0105243_1000439315 290
117 3300009174 Ga0105241_10008485 Ga0105241_100084854 290
118 3300009176 Ga0105242_10000161 Ga0105242_1000016110 290
119 3300011119 Ga0105246_10183411 Ga0105246_101834112 290
120 3300013297 Ga0157378_10001854 Ga0157378_1000185410 290
121 3300014969 Ga0157376_10002507 Ga0157376_100025078 290
122 3300025885 Ga0207653_10005768 Ga0207653_100057683 290
123 3300025899 Ga0207642_10000249 Ga0207642_100002497 290
124 3300025908 Ga0207643_10033718 Ga0207643_100337182 290
125 3300025911 Ga0207654_10018671 Ga0207654_100186714 290
126 3300025912 Ga0207707_10005043 Ga0207707_100050432 290
127 3300025917 Ga0207660_10003897 Ga0207660_100038972 290
128 3300025918 Ga0207662_10000064 Ga0207662_1000006430 290
129 3300025923 Ga0207681_10081722 Ga0207681_100817223 290
130 3300025926 Ga0207659_10157701 Ga0207659_101577013 290
131 3300025927 Ga0207687_10000267 Ga0207687_1000026733 290
132 3300025934 Ga0207686_10065519 Ga0207686_100655193 290
133 3300025935 Ga0207709_10000473 Ga0207709_100004736 290
134 3300025936 Ga0207670_10003751 Ga0207670_100037515 290
135 3300025936 Ga0207670_10022528 Ga0207670_100225282 290
136 3300025937 Ga0207669_10528550 Ga0207669_105285501 290
137 3300025938 Ga0207704_10000581 Ga0207704_1000058119 290
138 3300025942 Ga0207689_10000200 Ga0207689_1000020012 290
139 3300025949 Ga0207667_10006516 Ga0207667_1000651610 290
140 3300025949 Ga0207667_10238610 Ga0207667_102386101 290
141 3300025961 Ga0207712_10001270 Ga0207712_1000127022 290
142 3300026023 Ga0207677_10010986 Ga0207677_100109865 290
143 3300026035 Ga0207703_10009109 Ga0207703_100091093 290
144 3300026041 Ga0207639_10008151 Ga0207639_100081516 290
145 3300026075 Ga0207708_10001866 Ga0207708_1000186620 290
146 3300026078 Ga0207702_10009686 Ga0207702_100096867 290
147 3300026089 Ga0207648_10000309 Ga0207648_1000030913 290
148 3300026118 Ga0207675_100000089 Ga0207675_10000008913 290
149 3300026121 Ga0207683_10390386 Ga0207683_103903862 290
150 3300027907 Ga0207428_10002692 Ga0207428_1000269213 290
151 3300027907 Ga0207428_10197292 Ga0207428_101972922 290
152 3300028380 Ga0268265_10002816 Ga0268265_1000281617 290
153 3300028381 Ga0268264_10001651 Ga0268264_100016513 290
154 3300035085 Ga0373929_0004446 Ga0373929_0004446_1453_2334 290
155 3300035090 Ga0373949_0025099 Ga0373949_0025099_247_1128 290
156 3300035112 Ga0373932_0024275 Ga0373932_0024275_393_1274 290
157 3300035113 Ga0373936_0001521 Ga0373936_0001521_5033_5926 290
158 3300035113 Ga0373936_0010505 Ga0373936_0010505_608_1501 290
159 3300035114 Ga0373939_0004879 Ga0373939_0004879_1739_2620 290
160 3300035115 Ga0373941_0011259 Ga0373941_0011259_1399_2280 290
161 3300035115 Ga0373941_0076963 Ga0373941_0076963_144_1025 290
162 3300035116 Ga0373945_0000982 Ga0373945_0000982_4850_5743 290
163 3300035121 Ga0373960_0048312 Ga0373960_0048312_288_1172 290
164 3300035170 Ga0373943_0002679 Ga0373943_0002679_7000_7893 290
165 3300035170 Ga0373943_0020216 Ga0373943_0020216_1548_2441 290
166 3300035171 Ga0373946_0004375 Ga0373946_0004375_1679_2572 290
167 3300035242 Ga0373962_0018301 Ga0373962_0018301_385_1266 290
168 3300035691 Ga0373931_0002168 Ga0373931_0002168_3681_4562 290
169 3300035691 Ga0373931_0017523 Ga0373931_0017523_517_1398 290
170 3300035692 Ga0373935_0080847 Ga0373935_0080847_670_1563 290
171 3300035695 Ga0373927_0040828 Ga0373927_0040828_833_1726 290
172 3300035725 Ga0373947_0007059 Ga0373947_0007059_3435_4328 290
173 3300035725 Ga0373947_0008661 Ga0373947_0008661_3079_3972 290
174 3300037068 Ga0373925_0009958 Ga0373925_0009958_2518_3411 290
175 3300037068 Ga0373925_0179148 Ga0373925_0179148_55_948 290
176 3300042876 Ga0451577_0197016 Ga0451577_0197016_249_1130 290
177 3300045051 Ga0451576_0001678 Ga0451576_0001678_16753_17634 290
178 3300045051 Ga0451576_0021497 Ga0451576_0021497_1451_2332 290
179 3300045051 Ga0451576_0135309 Ga0451576_0135309_198_1082 290
180 3300045051 Ga0451576_0244918 Ga0451576_0244918_375_1256 290
181 3300046455 Ga0495603_0035696 Ga0495603_0035696_116_1009 290
182 3300046472 Ga0495580_0008568 Ga0495580_0008568_2310_3203 290
183 3300046473 Ga0495582_0029711 Ga0495582_0029711_1191_2084 290
184 3300046475 Ga0495639_0061687 Ga0495639_0061687_120_1013 290
185 3300046535 Ga0495586_0002775 Ga0495586_0002775_1866_2759 290
186 3300046537 Ga0495598_0002102 Ga0495598_0002102_262_1143 290
187 3300046674 Ga0495588_0016001 Ga0495588_0016001_932_1825 290
188 3300046683 Ga0495658_0046435 Ga0495658_0046435_480_1373 290
189 3300046684 Ga0495669_0148682 Ga0495669_0148682_14_895 290
190 3300049569 Ga0501032_0252077 Ga0501032_0252077_53_934 290
191 3300049570 Ga0501033_0112639 Ga0501033_0112639_265_1146 290
192 3300049572 Ga0501036_0004646 Ga0501036_0004646_433_1314 290
193 3300049576 Ga0501040_0003091 Ga0501040_0003091_1836_2717 290
194 3300049577 Ga0501041_0033306 Ga0501041_0033306_2107_2988 290
195 3300049578 Ga0501042_0024750 Ga0501042_0024750_3082_3963 290
196 3300049582 Ga0501048_0023807 Ga0501048_0023807_2813_3694 290
197 3300049583 Ga0501067_0025805 Ga0501067_0025805_2121_3005 290
198 3300049587 Ga0501071_0007398 Ga0501071_0007398_5910_6791 290
199 3300049587 Ga0501071_0141311 Ga0501071_0141311_301_1182 290
200 3300049588 Ga0501072_0004856 Ga0501072_0004856_8426_9307 290
201 3300049590 Ga0501074_0028628 Ga0501074_0028628_1421_2302 290
202 3300049591 Ga0501075_0006585 Ga0501075_0006585_6762_7643 290
203 3300049592 Ga0501076_0000870 Ga0501076_0000870_8869_9750 290
204 3300049593 Ga0501077_0113366 Ga0501077_0113366_785_1678 290
205 3300049741 Ga0501079_0046518 Ga0501079_0046518_299_1180 290
206 3300049742 Ga0501080_0012676 Ga0501080_0012676_6576_7457 290
207 3300049743 Ga0501081_0046359 Ga0501081_0046359_1865_2746 290
208 3300049822 Ga0501035_0136644 Ga0501035_0136644_545_1426 290
209 3300049824 Ga0501045_0003545 Ga0501045_0003545_793_1674 290
210 3300050507 nmdc:mga05p37_72_c1 nmdc:mga05p37_72_c1_3504_4385 290
211 3300050508 nmdc:mga09592_259_c1 nmdc:mga09592_259_c1_673_1554 290
212 3300050511 nmdc:mga08y16_2144_c1 nmdc:mga08y16_2144_c1_14658_15539 290
213 3300050511 nmdc:mga08y16_83354_c1 nmdc:mga08y16_83354_c1_613_1494 290
214 3300050512 nmdc:mga0n895_92731_c1 nmdc:mga0n895_92731_c1_595_1476 290
215 3300050513 nmdc:mga0rr50_374_c1 nmdc:mga0rr50_374_c1_22507_23388 290
216 3300050514 nmdc:mga08x19_1134_c1 nmdc:mga08x19_1134_c1_5856_6737 290
217 3300050515 nmdc:mga0a205_1144_c1 nmdc:mga0a205_1144_c1_9294_10175 290
218 3300050515 nmdc:mga0a205_46157_c1 nmdc:mga0a205_46157_c1_1428_2309 290
219 3300054114 Ga0501084_0002778 Ga0501084_0002778_11641_12522 290
220 3300060353 Ga0501082_0021380 Ga0501082_0021380_282_1163 290
221 3300061734 Ga0530510_0004260 Ga0530510_0004260_8323_9204 290
222 3300003323 rootH1_10200199 rootH1_102001992 291
223 3300005339 Ga0070660_100510823 Ga0070660_1005108231 291
224 3300005347 Ga0070668_100008002 Ga0070668_1000080025 291
225 3300005353 Ga0070669_100143111 Ga0070669_1001431112 291
226 3300005435 Ga0070714_100156792 Ga0070714_1001567922 291
227 3300005435 Ga0070714_100334125 Ga0070714_1003341252 291
228 3300005436 Ga0070713_100051887 Ga0070713_1000518872 291
229 3300005436 Ga0070713_100081079 Ga0070713_1000810792 291
230 3300005436 Ga0070713_100155565 Ga0070713_1001555651 291
231 3300005445 Ga0070708_100181005 Ga0070708_1001810053 291
232 3300005457 Ga0070662_100007815 Ga0070662_1000078154 291
233 3300005467 Ga0070706_100420108 Ga0070706_1004201082 291
234 3300005471 Ga0070698_100061807 Ga0070698_1000618072 291
235 3300005518 Ga0070699_100306733 Ga0070699_1003067331 291
236 3300005563 Ga0068855_100629209 Ga0068855_1006292091 291
237 3300005578 Ga0068854_100096474 Ga0068854_1000964744 291
238 3300005615 Ga0070702_100047015 Ga0070702_1000470151 291
239 3300005719 Ga0068861_100012679 Ga0068861_1000126793 291
240 3300005844 Ga0068862_100051805 Ga0068862_1000518054 291
241 3300005937 Ga0081455_10251574 Ga0081455_102515742 291
242 3300005981 Ga0081538_10011974 Ga0081538_100119743 291
243 3300005983 Ga0081540_1009053 Ga0081540_10090533 291
244 3300006186 Ga0075369_10003098 Ga0075369_100030983 291
245 3300006195 Ga0075366_10037583 Ga0075366_100375833 291
246 3300006353 Ga0075370_10025086 Ga0075370_100250862 291
247 3300006846 Ga0075430_100016218 Ga0075430_1000162184 291
248 3300006847 Ga0075431_100005187 Ga0075431_10000518713 291
249 3300006880 Ga0075429_100028692 Ga0075429_1000286924 291
250 3300007788 Ga0099795_10082321 Ga0099795_100823211 291
251 3300009093 Ga0105240_10503021 Ga0105240_105030212 291
252 3300009094 Ga0111539_10005738 Ga0111539_1000573812 291
253 3300009094 Ga0111539_10374899 Ga0111539_103748992 291
254 3300009098 Ga0105245_10004295 Ga0105245_100042957 291
255 3300009147 Ga0114129_10032825 Ga0114129_100328254 291
256 3300009177 Ga0105248_10358285 Ga0105248_103582853 291
257 3300009553 Ga0105249_10003007 Ga0105249_1000300715 291
258 3300010159 Ga0099796_10002945 Ga0099796_100029452 291
259 3300010159 Ga0099796_10076028 Ga0099796_100760281 291
260 3300010375 Ga0105239_10155643 Ga0105239_101556432 291
261 3300013306 Ga0163162_10130067 Ga0163162_101300671 291
262 3300014497 Ga0182008_10089618 Ga0182008_100896182 291
263 3300014968 Ga0157379_10156974 Ga0157379_101569742 291
264 3300017792 Ga0163161_10091117 Ga0163161_100911173 291
265 3300021377 Ga0213874_10014439 Ga0213874_100144392 291
266 3300021384 Ga0213876_10060071 Ga0213876_100600713 291
267 3300021384 Ga0213876_10231521 Ga0213876_102315211 291
268 3300021388 Ga0213875_10000189 Ga0213875_1000018927 291
269 3300021388 Ga0213875_10039457 Ga0213875_100394572 291
270 3300025898 Ga0207692_10230648 Ga0207692_102306482 291
271 3300025901 Ga0207688_10153428 Ga0207688_101534281 291
272 3300025906 Ga0207699_10156404 Ga0207699_101564042 291
273 3300025915 Ga0207693_10011477 Ga0207693_100114776 291
274 3300025916 Ga0207663_10071113 Ga0207663_100711132 291
275 3300025922 Ga0207646_10024927 Ga0207646_100249275 291
276 3300025923 Ga0207681_10120707 Ga0207681_101207072 291
277 3300025927 Ga0207687_10027852 Ga0207687_100278522 291
278 3300025928 Ga0207700_10021530 Ga0207700_100215303 291
279 3300025928 Ga0207700_10055111 Ga0207700_100551112 291
280 3300025928 Ga0207700_10119234 Ga0207700_101192342 291
281 3300025933 Ga0207706_10008368 Ga0207706_100083686 291
282 3300025961 Ga0207712_10003450 Ga0207712_1000345010 291
283 3300026118 Ga0207675_100000839 Ga0207675_10000083926 291
284 3300027907 Ga0207428_10005877 Ga0207428_1000587711 291
285 3300030521 Ga0307511_10000216 Ga0307511_1000021629 291
286 3300031731 Ga0307405_10078294 Ga0307405_100782943 291
287 3300031995 Ga0307409_100185646 Ga0307409_1001856461 291
288 3300032002 Ga0307416_100006871 Ga0307416_1000068711 291
289 3300035086 Ga0373934_0023273 Ga0373934_0023273_1012_1890 291
290 3300035086 Ga0373934_0085981 Ga0373934_0085981_335_1213 291
291 3300035111 Ga0373923_0009272 Ga0373923_0009272_717_1595 291
292 3300035113 Ga0373936_0008198 Ga0373936_0008198_1409_2287 291
293 3300035116 Ga0373945_0002868 Ga0373945_0002868_3321_4199 291
294 3300035117 Ga0373953_0022574 Ga0373953_0022574_327_1205 291
295 3300035118 Ga0373954_0003405 Ga0373954_0003405_616_1494 291
296 3300035170 Ga0373943_0086697 Ga0373943_0086697_138_1016 291
297 3300035172 Ga0373955_0000218 Ga0373955_0000218_8545_9423 291
298 3300035410 Ga0373924_0022303 Ga0373924_0022303_348_1226 291
299 3300035692 Ga0373935_0000260 Ga0373935_0000260_10477_11355 291
300 3300035692 Ga0373935_0084628 Ga0373935_0084628_853_1731 291
301 3300035692 Ga0373935_0113975 Ga0373935_0113975_248_1141 291
302 3300035695 Ga0373927_0003881 Ga0373927_0003881_8006_8884 291
303 3300035695 Ga0373927_0017047 Ga0373927_0017047_1140_2018 291
304 3300035724 Ga0373933_0004564 Ga0373933_0004564_511_1389 291
305 3300035725 Ga0373947_0012091 Ga0373947_0012091_1716_2594 291
306 3300036401 Ga0373937_0000697 Ga0373937_0000697_10026_10904 291
307 3300037068 Ga0373925_0000071 Ga0373925_0000071_60164_61042 291
308 3300037068 Ga0373925_0111445 Ga0373925_0111445_237_1115 291
309 3300037853 Ga0436364_0463644 Ga0436364_0463644_680_1558 291
310 3300037853 Ga0436364_1269605 Ga0436364_1269605_197_1075 291
311 3300037853 Ga0436364_1480641 Ga0436364_1480641_6386_7264 291
312 3300037853 Ga0436364_1514411 Ga0436364_1514411_1526_2404 291
313 3300039437 Ga0436365_0561561 Ga0436365_0561561_201_1079 291
314 3300039437 Ga0436365_1893197 Ga0436365_1893197_314_1192 291
315 3300039438 Ga0436360_1131979 Ga0436360_1131979_475_1353 291
316 3300039450 Ga0436363_1288856 Ga0436363_1288856_625_1503 291
317 3300039453 Ga0436362_0134496 Ga0436362_0134496_714_1592 291
318 3300046454 Ga0495592_0000117 Ga0495592_0000117_64706_65584 291
319 3300046459 Ga0495629_0011403 Ga0495629_0011403_2620_3498 291
320 3300046462 Ga0495651_0000156 Ga0495651_0000156_29532_30410 291
321 3300046463 Ga0495653_0000047 Ga0495653_0000047_39835_40713 291
322 3300046475 Ga0495639_0085046 Ga0495639_0085046_191_1069 291
323 3300046476 Ga0495662_0052595 Ga0495662_0052595_65_943 291
324 3300046477 Ga0495664_0000024 Ga0495664_0000024_10682_11560 291
325 3300046511 Ga0495608_0000004 Ga0495608_0000004_131466_132344 291
326 3300046514 Ga0495618_0000036 Ga0495618_0000036_82276_83154 291
327 3300046516 Ga0495628_0000006 Ga0495628_0000006_18389_19267 291
328 3300046517 Ga0495630_0000575 Ga0495630_0000575_18450_19328 291
329 3300046529 Ga0495652_0000038 Ga0495652_0000038_13400_14278 291
330 3300046533 Ga0495640_0000001 Ga0495640_0000001_79853_80731 291
331 3300046535 Ga0495586_0092020 Ga0495586_0092020_322_1200 291
332 3300046536 Ga0495587_0000004 Ga0495587_0000004_134931_135809 291
333 3300046543 Ga0495645_0000001 Ga0495645_0000001_222772_223650 291
334 3300046559 Ga0495667_0000093 Ga0495667_0000093_4518_5396 291
335 3300046642 Ga0495634_0016330 Ga0495634_0016330_355_1233 291
336 3300046663 Ga0495635_0000003 Ga0495635_0000003_222403_223281 291
337 3300046675 Ga0495657_0003983 Ga0495657_0003983_310_1188 291
338 3300046678 Ga0495599_0000012 Ga0495599_0000012_74945_75823 291
339 3300046679 Ga0495623_0000015 Ga0495623_0000015_112008_112886 291
340 3300046680 Ga0495646_0000005 Ga0495646_0000005_134943_135821 291
341 3300046690 Ga0495624_0060792 Ga0495624_0060792_415_1293 291
342 3300046809 Ga0495600_0000051 Ga0495600_0000051_67841_68719 291
343 3300047317 Ga0495604_0000002 Ga0495604_0000002_307368_308246 291
344 3300047319 Ga0495674_0000004 Ga0495674_0000004_306917_307795 291
345 3300047322 Ga0495680_0006865 Ga0495680_0006865_9270_10148 291
346 3300047322 Ga0495680_0139710 Ga0495680_0139710_803_1681 291
347 3300047444 Ga0495675_0000465 Ga0495675_0000465_22570_23448 291
348 3300047471 Ga0495684_0000004 Ga0495684_0000004_287793_288671 291
349 3300047673 Ga0495593_0005703 Ga0495593_0005703_1933_2811 291
350 3300048088 Ga0495602_0000001 Ga0495602_0000001_222445_223323 291
351 3300048916 Ga0496113_0151647 Ga0496113_0151647_357_1235 291
352 3300050489 nmdc:mga03683_7300_c1 nmdc:mga03683_7300_c1_2059_2946 291
353 3300050493 nmdc:mga0k408_86828_c1 nmdc:mga0k408_86828_c1_53_940 291
354 3300050496 nmdc:mga07m45_3597_c1 nmdc:mga07m45_3597_c1_3399_4286 291
355 3300050507 nmdc:mga05p37_5784_c1 nmdc:mga05p37_5784_c1_9434_10327 291
356 3300050508 nmdc:mga09592_14341_c1 nmdc:mga09592_14341_c1_2342_3235 291
357 3300050509 nmdc:mga0qj67_4903_c1 nmdc:mga0qj67_4903_c1_8109_9002 291
358 3300050510 nmdc:mga06r32_2762_c1 nmdc:mga06r32_2762_c1_1779_2672 291
359 3300050511 nmdc:mga08y16_418209_c1 nmdc:mga08y16_418209_c1_128_1036 291
360 3300050511 nmdc:mga08y16_4422_c1 nmdc:mga08y16_4422_c1_9434_10327 291
361 3300050516 nmdc:mga0sz30_14778_c1 nmdc:mga0sz30_14778_c1_333_1220 291
362 3300050516 nmdc:mga0sz30_83261_c1 nmdc:mga0sz30_83261_c1_88_975 291
363 3300053077 Ga0495601_0000026 Ga0495601_0000026_10474_11352 291
364 3300053078 Ga0495612_0000012 Ga0495612_0000012_377_1255 291
365 3300053084 Ga0495595_0000346 Ga0495595_0000346_10449_11327 291
366 3300053084 Ga0495595_0031285 Ga0495595_0031285_1030_1908 291
367 3300053085 Ga0495619_0000003 Ga0495619_0000003_227567_228445 291
368 3300053088 Ga0500644_0020354 Ga0500644_0020354_869_1756 291
369 3300053090 Ga0500646_0004591 Ga0500646_0004591_2138_3025 291
370 3300053133 Ga0500655_002183 Ga0500655_002183_1166_2053 291
371 3300053139 Ga0500568_0013857 Ga0500568_0013857_2357_3244 291
372 3300053151 Ga0500604_0000701 Ga0500604_0000701_6399_7286 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

31

269

0.81

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

31

268

0.79

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

33

274

0.63

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xmz-assembly1.cif.gz_A structure of menh from s. aureus 0.9121 12 272
3om8-assembly1.cif.gz_B the crystal structure of a hydrolase from pseudomonas aeruginosa pa01 0.9048 2 268
2xmz-assembly1.cif.gz_A structure of menh from s. aureus 0.8926 12 272
4uhd-assembly1.cif.gz_A structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) 0.8897 2 273
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8856 2 115
ID Description Score Start End Superfamily
af_I1KMX1_1_216_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9502 2 115 3.40.50.1820
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9111 2 87 3.40.50.12270
af_Q2FZL6_1_267_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9092 10 273 3.40.50.1820
af_Q15KI9_1423_1693_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9015 15 268 3.40.50.1820
3om8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8991 2 268 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A1K1SRM7-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9893 1 290 GO:0016020
AF-A0A1C7P5P5-F1-model_v4 Alpha/beta hydrolase 0.9889 2 283 GO:0016020
GO:0016787
AF-A0A1Q7CFY0-F1-model_v4 Alpha/beta hydrolase 0.9885 1 291 GO:0016020
GO:0016787
AF-A0A7W8DYH1-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9875 1 287 GO:0016020
AF-A0A1Q7CFY0-F1-model_v4 Alpha/beta hydrolase 0.9852 1 291 GO:0016020
GO:0016787

Feature Viewer

pLDDT pTM Quality
94.43 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map