F426029
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 372 | 260 | 372 | 292 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10374899|Ga0111539_103748992 |
| Length | 302 |
| Sequence | MPRRSEQEFPMPQVTTNDGVRLYYEEVGSGYPVVFVHEFAGDYRSYETQLRFFARRYRCIAFNARGYPPSDVPEDWRLYSQERARDDIRDVLDGLNIAKAHVVGISMGGFAVLHFGFAYPERASSLVVAGCGYGAQPDKKEQFQEEVARVAAAIEGSGMAEVSKTYGAGPTRVQYQNKDPRGYAEFLGQLAEHSTPGAANTQRGVQGRRPSLWELTEQMKKLDVPTLIATGDEDDPCLEPGLLMKRLIPSAALVVFPNTGHALNIEEPDLFNRSLADFFHQVESGRWPRRDPRSVTGSILGM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 2 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 52 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 53 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 87 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 88 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 89 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 90 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 126 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 129 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 130 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 131 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 132 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 133 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 134 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 135 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 136 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 137 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 139 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 140 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 141 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 142 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 143 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 144 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 145 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 146 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 147 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 148 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 149 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 150 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 151 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 152 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 153 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 154 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 155 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 156 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 159 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 160 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 161 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 162 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 163 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 164 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 165 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 166 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 208 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 209 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 211 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 212 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 213 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 214 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 235 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 236 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 237 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 247 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 252 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 253 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 254 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 255 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 256 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 257 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 258 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.57 |
| Nodule | 0 |
| Rhizoplane | 2.42 |
| Rhizosphere | 88.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10200199 | 3300003323 | Bacteria | 2520 |
| 2 | Ga0070690_100000440 | 3300005330 | Bacteria | 21026 |
| 3 | Ga0068869_100000806 | 3300005334 | Bacteria | 17893 |
| 4 | Ga0070680_100000656 | 3300005336 | Bacteria | 23985 |
| 5 | Ga0070682_100002698 | 3300005337 | Bacteria | 9824 |
| 6 | Ga0068868_100001558 | 3300005338 | Bacteria | 15670 |
| 7 | Ga0070660_100510823 | 3300005339 | Unclassified | 1000 |
| 8 | Ga0070689_100000287 | 3300005340 | Bacteria | 29278 |
| 9 | Ga0070687_100000294 | 3300005343 | Bacteria | 16865 |
| 10 | Ga0070668_100008002 | 3300005347 | Bacteria | 7854 |
| 11 | Ga0070669_100143111 | 3300005353 | Bacteria | 1845 |
| 12 | Ga0070675_100171790 | 3300005354 | Bacteria | 1870 |
| 13 | Ga0070673_100123697 | 3300005364 | Bacteria | 2162 |
| 14 | Ga0070673_100227138 | 3300005364 | Bacteria | 1618 |
| 15 | Ga0070703_10013121 | 3300005406 | Bacteria | 2349 |
| 16 | Ga0070703_10014974 | 3300005406 | Bacteria | 2215 |
| 17 | Ga0070714_100156792 | 3300005435 | Unclassified | 2056 |
| 18 | Ga0070714_100334125 | 3300005435 | Bacteria | 1420 |
| 19 | Ga0070713_100051887 | 3300005436 | Bacteria | 3394 |
| 20 | Ga0070713_100081079 | 3300005436 | Bacteria | 2768 |
| 21 | Ga0070713_100155565 | 3300005436 | Bacteria | 2037 |
| 22 | Ga0070701_10000231 | 3300005438 | Bacteria | 17724 |
| 23 | Ga0070705_100001497 | 3300005440 | Bacteria | 12319 |
| 24 | Ga0070705_100038692 | 3300005440 | Bacteria | 2701 |
| 25 | Ga0070700_100008623 | 3300005441 | Bacteria | 5556 |
| 26 | Ga0070694_100000090 | 3300005444 | Bacteria | 43268 |
| 27 | Ga0070708_100036915 | 3300005445 | Bacteria | 4262 |
| 28 | Ga0070708_100181005 | 3300005445 | Unclassified | 1970 |
| 29 | Ga0070678_100103049 | 3300005456 | Bacteria | 2216 |
| 30 | Ga0070662_100007815 | 3300005457 | Bacteria | 6947 |
| 31 | Ga0070681_10008872 | 3300005458 | Bacteria | 9880 |
| 32 | Ga0070681_10086228 | 3300005458 | Bacteria | 3093 |
| 33 | Ga0068867_100000595 | 3300005459 | Bacteria | 23912 |
| 34 | Ga0070706_100282349 | 3300005467 | Bacteria | 1549 |
| 35 | Ga0070706_100420108 | 3300005467 | Bacteria | 1244 |
| 36 | Ga0070698_100061807 | 3300005471 | Bacteria | 3780 |
| 37 | Ga0070699_100306733 | 3300005518 | Bacteria | 1425 |
| 38 | Ga0070679_100415655 | 3300005530 | Bacteria | 1290 |
| 39 | Ga0070697_100199353 | 3300005536 | Bacteria | 1701 |
| 40 | Ga0068853_100014577 | 3300005539 | Bacteria | 6444 |
| 41 | Ga0070686_100000815 | 3300005544 | Bacteria | 18064 |
| 42 | Ga0070695_100000079 | 3300005545 | Bacteria | 39939 |
| 43 | Ga0070696_100000170 | 3300005546 | Bacteria | 37218 |
| 44 | Ga0070696_100000296 | 3300005546 | Bacteria | 30020 |
| 45 | Ga0070693_100000321 | 3300005547 | Bacteria | 22045 |
| 46 | Ga0070704_100000445 | 3300005549 | Bacteria | 19437 |
| 47 | Ga0068855_100026854 | 3300005563 | Bacteria | 6889 |
| 48 | Ga0068855_100299533 | 3300005563 | Bacteria | 1781 |
| 49 | Ga0068855_100629209 | 3300005563 | Bacteria | 1155 |
| 50 | Ga0068854_100004057 | 3300005578 | Bacteria | 9196 |
| 51 | Ga0068854_100096474 | 3300005578 | Bacteria | 2209 |
| 52 | Ga0068856_100005486 | 3300005614 | Bacteria | 12496 |
| 53 | Ga0070702_100000068 | 3300005615 | Bacteria | 29170 |
| 54 | Ga0070702_100047015 | 3300005615 | Bacteria | 2449 |
| 55 | Ga0068859_100002721 | 3300005617 | Bacteria | 17925 |
| 56 | Ga0068859_100062954 | 3300005617 | Bacteria | 3740 |
| 57 | Ga0068864_100081964 | 3300005618 | Bacteria | 2830 |
| 58 | Ga0068866_10000631 | 3300005718 | Bacteria | 15998 |
| 59 | Ga0068861_100000070 | 3300005719 | Bacteria | 49394 |
| 60 | Ga0068861_100012679 | 3300005719 | Bacteria | 5882 |
| 61 | Ga0068870_10020337 | 3300005840 | Bacteria | 3231 |
| 62 | Ga0068858_100003760 | 3300005842 | Bacteria | 15012 |
| 63 | Ga0068860_100002032 | 3300005843 | Bacteria | 21330 |
| 64 | Ga0068860_100225596 | 3300005843 | Bacteria | 1820 |
| 65 | Ga0068862_100000975 | 3300005844 | Bacteria | 27450 |
| 66 | Ga0068862_100051805 | 3300005844 | Bacteria | 3511 |
| 67 | Ga0068862_100274852 | 3300005844 | Bacteria | 1542 |
| 68 | Ga0081455_10251574 | 3300005937 | Bacteria | 1292 |
| 69 | Ga0081538_10011974 | 3300005981 | Bacteria | 6991 |
| 70 | Ga0081540_1009053 | 3300005983 | Bacteria | 6881 |
| 71 | Ga0075369_10003098 | 3300006186 | Bacteria | 6017 |
| 72 | Ga0075366_10037583 | 3300006195 | Bacteria | 2859 |
| 73 | Ga0075366_10065994 | 3300006195 | Bacteria | 2153 |
| 74 | Ga0097621_100000468 | 3300006237 | Bacteria | 28316 |
| 75 | Ga0075370_10025086 | 3300006353 | Bacteria | 3296 |
| 76 | Ga0068871_100000188 | 3300006358 | Bacteria | 42040 |
| 77 | Ga0075428_100000109 | 3300006844 | Bacteria | 69948 |
| 78 | Ga0075430_100016218 | 3300006846 | Bacteria | 6345 |
| 79 | Ga0075431_100005187 | 3300006847 | Bacteria | 12829 |
| 80 | Ga0075433_10001494 | 3300006852 | Bacteria | 17286 |
| 81 | Ga0075433_10063982 | 3300006852 | Bacteria | 3224 |
| 82 | Ga0075434_100000349 | 3300006871 | Bacteria | 33394 |
| 83 | Ga0075434_100021299 | 3300006871 | Bacteria | 6302 |
| 84 | Ga0075434_100271124 | 3300006871 | Bacteria | 1716 |
| 85 | Ga0075429_100001875 | 3300006880 | Bacteria | 17419 |
| 86 | Ga0075429_100028692 | 3300006880 | Bacteria | 4833 |
| 87 | Ga0068865_100000774 | 3300006881 | Bacteria | 17943 |
| 88 | Ga0075436_100000075 | 3300006914 | Bacteria | 59554 |
| 89 | Ga0075436_100003254 | 3300006914 | Bacteria | 11122 |
| 90 | Ga0075436_100008688 | 3300006914 | Bacteria | 6943 |
| 91 | Ga0075436_100026092 | 3300006914 | Bacteria | 4023 |
| 92 | Ga0097620_100002721 | 3300006931 | Bacteria | 17925 |
| 93 | Ga0097620_100062952 | 3300006931 | Bacteria | 3740 |
| 94 | Ga0075435_100000116 | 3300007076 | Bacteria | 44259 |
| 95 | Ga0099795_10082321 | 3300007788 | Bacteria | 1234 |
| 96 | Ga0099795_10092591 | 3300007788 | Bacteria | 1174 |
| 97 | Ga0105240_10503021 | 3300009093 | Bacteria | 1347 |
| 98 | Ga0111539_10001832 | 3300009094 | Bacteria | 28267 |
| 99 | Ga0111539_10005738 | 3300009094 | Bacteria | 16054 |
| 100 | Ga0111539_10006398 | 3300009094 | Bacteria | 15194 |
| 101 | Ga0111539_10374899 | 3300009094 | Bacteria | 1656 |
| 102 | Ga0105245_10001758 | 3300009098 | Bacteria | 19754 |
| 103 | Ga0105245_10004295 | 3300009098 | Bacteria | 12622 |
| 104 | Ga0114129_10001030 | 3300009147 | Bacteria | 36420 |
| 105 | Ga0114129_10032825 | 3300009147 | Bacteria | 7335 |
| 106 | Ga0105243_10004393 | 3300009148 | Bacteria | 11153 |
| 107 | Ga0105241_10008485 | 3300009174 | Bacteria | 7554 |
| 108 | Ga0105242_10000161 | 3300009176 | Bacteria | 50082 |
| 109 | Ga0105248_10358285 | 3300009177 | Bacteria | 1642 |
| 110 | Ga0105249_10003007 | 3300009553 | Bacteria | 14541 |
| 111 | Ga0099796_10002945 | 3300010159 | Bacteria | 3852 |
| 112 | Ga0099796_10076028 | 3300010159 | Unclassified | 1222 |
| 113 | Ga0105239_10155643 | 3300010375 | Bacteria | 2552 |
| 114 | Ga0105246_10183411 | 3300011119 | Bacteria | 1613 |
| 115 | Ga0157378_10001854 | 3300013297 | Bacteria | 18981 |
| 116 | Ga0163162_10130067 | 3300013306 | Bacteria | 2626 |
| 117 | Ga0182008_10089618 | 3300014497 | Bacteria | 1516 |
| 118 | Ga0157379_10156974 | 3300014968 | Bacteria | 2053 |
| 119 | Ga0157376_10002507 | 3300014969 | Bacteria | 12440 |
| 120 | Ga0163161_10091117 | 3300017792 | Bacteria | 2256 |
| 121 | Ga0213872_10105364 | 3300021361 | Bacteria | 1255 |
| 122 | Ga0213874_10014439 | 3300021377 | Bacteria | 2066 |
| 123 | Ga0213876_10060071 | 3300021384 | Bacteria | 2006 |
| 124 | Ga0213876_10231521 | 3300021384 | Bacteria | 982 |
| 125 | Ga0213875_10000189 | 3300021388 | Bacteria | 63108 |
| 126 | Ga0213875_10039457 | 3300021388 | Bacteria | 2224 |
| 127 | Ga0207653_10005768 | 3300025885 | Bacteria | 3861 |
| 128 | Ga0207692_10230648 | 3300025898 | Unclassified | 1102 |
| 129 | Ga0207642_10000249 | 3300025899 | Bacteria | 16057 |
| 130 | Ga0207688_10153428 | 3300025901 | Unclassified | 1362 |
| 131 | Ga0207699_10156404 | 3300025906 | Bacteria | 1513 |
| 132 | Ga0207643_10033718 | 3300025908 | Bacteria | 2865 |
| 133 | Ga0207654_10018671 | 3300025911 | Bacteria | 3643 |
| 134 | Ga0207707_10005043 | 3300025912 | Bacteria | 11589 |
| 135 | Ga0207695_10086718 | 3300025913 | Bacteria | 3156 |
| 136 | Ga0207693_10011477 | 3300025915 | Bacteria | 7166 |
| 137 | Ga0207693_10033693 | 3300025915 | Bacteria | 4041 |
| 138 | Ga0207663_10071113 | 3300025916 | Bacteria | 2244 |
| 139 | Ga0207663_10203793 | 3300025916 | Bacteria | 1429 |
| 140 | Ga0207660_10003897 | 3300025917 | Bacteria | 9726 |
| 141 | Ga0207662_10000064 | 3300025918 | Bacteria | 46399 |
| 142 | Ga0207646_10024927 | 3300025922 | Bacteria | 5473 |
| 143 | Ga0207681_10081722 | 3300025923 | Bacteria | 2282 |
| 144 | Ga0207681_10120707 | 3300025923 | Bacteria | 1922 |
| 145 | Ga0207659_10157701 | 3300025926 | Bacteria | 1779 |
| 146 | Ga0207687_10000267 | 3300025927 | Bacteria | 35541 |
| 147 | Ga0207687_10027852 | 3300025927 | Bacteria | 3793 |
| 148 | Ga0207700_10021530 | 3300025928 | Bacteria | 4404 |
| 149 | Ga0207700_10055111 | 3300025928 | Bacteria | 2988 |
| 150 | Ga0207700_10119234 | 3300025928 | Bacteria | 2136 |
| 151 | Ga0207700_10279372 | 3300025928 | Unclassified | 1436 |
| 152 | Ga0207706_10008368 | 3300025933 | Bacteria | 9544 |
| 153 | Ga0207686_10065519 | 3300025934 | Bacteria | 2317 |
| 154 | Ga0207709_10000473 | 3300025935 | Bacteria | 36885 |
| 155 | Ga0207670_10003751 | 3300025936 | Bacteria | 8074 |
| 156 | Ga0207670_10022528 | 3300025936 | Bacteria | 3906 |
| 157 | Ga0207669_10528550 | 3300025937 | Bacteria | 948 |
| 158 | Ga0207704_10000581 | 3300025938 | Bacteria | 16249 |
| 159 | Ga0207689_10000200 | 3300025942 | Bacteria | 52703 |
| 160 | Ga0207667_10006516 | 3300025949 | Bacteria | 14127 |
| 161 | Ga0207667_10238610 | 3300025949 | Bacteria | 1861 |
| 162 | Ga0207712_10001270 | 3300025961 | Bacteria | 17369 |
| 163 | Ga0207712_10003450 | 3300025961 | Bacteria | 9989 |
| 164 | Ga0207677_10010986 | 3300026023 | Bacteria | 5143 |
| 165 | Ga0207703_10009109 | 3300026035 | Bacteria | 7816 |
| 166 | Ga0207639_10008151 | 3300026041 | Bacteria | 7163 |
| 167 | Ga0207708_10001866 | 3300026075 | Bacteria | 15534 |
| 168 | Ga0207702_10009686 | 3300026078 | Bacteria | 8090 |
| 169 | Ga0207648_10000309 | 3300026089 | Bacteria | 53487 |
| 170 | Ga0207675_100000089 | 3300026118 | Bacteria | 71258 |
| 171 | Ga0207675_100000839 | 3300026118 | Bacteria | 30616 |
| 172 | Ga0207683_10390386 | 3300026121 | Bacteria | 1280 |
| 173 | Ga0207428_10002692 | 3300027907 | Bacteria | 17705 |
| 174 | Ga0207428_10005877 | 3300027907 | Bacteria | 11370 |
| 175 | Ga0207428_10197292 | 3300027907 | Bacteria | 1515 |
| 176 | Ga0268265_10002816 | 3300028380 | Bacteria | 12795 |
| 177 | Ga0268264_10001651 | 3300028381 | Bacteria | 20603 |
| 178 | Ga0307511_10000216 | 3300030521 | Bacteria | 58288 |
| 179 | Ga0265325_10005278 | 3300031241 | Bacteria | 8010 |
| 180 | Ga0307405_10078294 | 3300031731 | Bacteria | 2151 |
| 181 | Ga0307409_100185646 | 3300031995 | Bacteria | 1845 |
| 182 | Ga0307416_100006871 | 3300032002 | Bacteria | 7162 |
| 183 | Ga0373929_0004446 | 3300035085 | Bacteria | 2513 |
| 184 | Ga0373929_0021336 | 3300035085 | Bacteria | 1313 |
| 185 | Ga0373934_0023273 | 3300035086 | Bacteria | 2393 |
| 186 | Ga0373934_0085981 | 3300035086 | Bacteria | 1265 |
| 187 | Ga0373949_0025099 | 3300035090 | Bacteria | 1389 |
| 188 | Ga0373923_0009272 | 3300035111 | Bacteria | 3547 |
| 189 | Ga0373932_0024275 | 3300035112 | Bacteria | 1630 |
| 190 | Ga0373936_0001521 | 3300035113 | Bacteria | 8436 |
| 191 | Ga0373936_0008198 | 3300035113 | Bacteria | 3926 |
| 192 | Ga0373936_0010505 | 3300035113 | Bacteria | 3494 |
| 193 | Ga0373939_0004879 | 3300035114 | Bacteria | 3182 |
| 194 | Ga0373941_0011259 | 3300035115 | Bacteria | 2307 |
| 195 | Ga0373941_0076963 | 3300035115 | Bacteria | 1119 |
| 196 | Ga0373945_0000982 | 3300035116 | Bacteria | 8516 |
| 197 | Ga0373945_0002868 | 3300035116 | Bacteria | 5417 |
| 198 | Ga0373953_0022574 | 3300035117 | Bacteria | 2374 |
| 199 | Ga0373954_0003405 | 3300035118 | Bacteria | 6734 |
| 200 | Ga0373960_0048312 | 3300035121 | Bacteria | 1255 |
| 201 | Ga0373943_0002679 | 3300035170 | Bacteria | 8093 |
| 202 | Ga0373943_0020216 | 3300035170 | Bacteria | 3068 |
| 203 | Ga0373943_0086697 | 3300035170 | Bacteria | 1615 |
| 204 | Ga0373946_0004375 | 3300035171 | Bacteria | 5060 |
| 205 | Ga0373955_0000218 | 3300035172 | Bacteria | 24095 |
| 206 | Ga0373961_0090742 | 3300035241 | Bacteria | 975 |
| 207 | Ga0373962_0018301 | 3300035242 | Bacteria | 1822 |
| 208 | Ga0373924_0022303 | 3300035410 | Bacteria | 2475 |
| 209 | Ga0373931_0002168 | 3300035691 | Bacteria | 8651 |
| 210 | Ga0373931_0017523 | 3300035691 | Bacteria | 3546 |
| 211 | Ga0373935_0000260 | 3300035692 | Bacteria | 26221 |
| 212 | Ga0373935_0080847 | 3300035692 | Bacteria | 2112 |
| 213 | Ga0373935_0084628 | 3300035692 | Bacteria | 2066 |
| 214 | Ga0373935_0113975 | 3300035692 | Bacteria | 1798 |
| 215 | Ga0373927_0003881 | 3300035695 | Bacteria | 10599 |
| 216 | Ga0373927_0017047 | 3300035695 | Bacteria | 4786 |
| 217 | Ga0373927_0040828 | 3300035695 | Bacteria | 3009 |
| 218 | Ga0373933_0004564 | 3300035724 | Bacteria | 7590 |
| 219 | Ga0373947_0007059 | 3300035725 | Bacteria | 6509 |
| 220 | Ga0373947_0008661 | 3300035725 | Bacteria | 5854 |
| 221 | Ga0373947_0012091 | 3300035725 | Bacteria | 4944 |
| 222 | Ga0373937_0000697 | 3300036401 | Bacteria | 29311 |
| 223 | Ga0373925_0000071 | 3300037068 | Bacteria | 106825 |
| 224 | Ga0373925_0009958 | 3300037068 | Bacteria | 6903 |
| 225 | Ga0373925_0111445 | 3300037068 | Unclassified | 2114 |
| 226 | Ga0373925_0174812 | 3300037068 | Bacteria | 1697 |
| 227 | Ga0373925_0179148 | 3300037068 | Bacteria | 1676 |
| 228 | Ga0436364_0463644 | 3300037853 | Unclassified | 2235 |
| 229 | Ga0436364_0648577 | 3300037853 | Bacteria | 1375 |
| 230 | Ga0436364_1269605 | 3300037853 | Bacteria | 19715 |
| 231 | Ga0436364_1378189 | 3300037853 | Bacteria | 2556 |
| 232 | Ga0436364_1480641 | 3300037853 | Bacteria | 33054 |
| 233 | Ga0436364_1514411 | 3300037853 | Bacteria | 3351 |
| 234 | Ga0436365_0561561 | 3300039437 | Bacteria | 1644 |
| 235 | Ga0436365_1663154 | 3300039437 | Bacteria | 5079 |
| 236 | Ga0436365_1893197 | 3300039437 | Bacteria | 1246 |
| 237 | Ga0436360_1131979 | 3300039438 | Bacteria | 1381 |
| 238 | Ga0436361_0089185 | 3300039447 | Bacteria | 7542 |
| 239 | Ga0436361_0094315 | 3300039447 | Bacteria | 6956 |
| 240 | Ga0436363_1288856 | 3300039450 | Bacteria | 2117 |
| 241 | Ga0436362_0134496 | 3300039453 | Unclassified | 2521 |
| 242 | Ga0436362_0414841 | 3300039453 | Bacteria | 1819 |
| 243 | Ga0451577_0197016 | 3300042876 | Unclassified | 1818 |
| 244 | Ga0451576_0001678 | 3300045051 | Bacteria | 36726 |
| 245 | Ga0451576_0021497 | 3300045051 | Bacteria | 7013 |
| 246 | Ga0451576_0135309 | 3300045051 | Bacteria | 2569 |
| 247 | Ga0451576_0244918 | 3300045051 | Bacteria | 1873 |
| 248 | Ga0495592_0000117 | 3300046454 | Bacteria | 69975 |
| 249 | Ga0495603_0035696 | 3300046455 | Bacteria | 2986 |
| 250 | Ga0495629_0011403 | 3300046459 | Bacteria | 6456 |
| 251 | Ga0495651_0000156 | 3300046462 | Bacteria | 50159 |
| 252 | Ga0495653_0000047 | 3300046463 | Bacteria | 111093 |
| 253 | Ga0495580_0008568 | 3300046472 | Bacteria | 8114 |
| 254 | Ga0495582_0029711 | 3300046473 | Bacteria | 3000 |
| 255 | Ga0495639_0061687 | 3300046475 | Bacteria | 1719 |
| 256 | Ga0495639_0085046 | 3300046475 | Bacteria | 1478 |
| 257 | Ga0495662_0052595 | 3300046476 | Bacteria | 1966 |
| 258 | Ga0495664_0000024 | 3300046477 | Bacteria | 126593 |
| 259 | Ga0495608_0000004 | 3300046511 | Bacteria | 355027 |
| 260 | Ga0495618_0000036 | 3300046514 | Bacteria | 101535 |
| 261 | Ga0495628_0000006 | 3300046516 | Bacteria | 306606 |
| 262 | Ga0495628_0258287 | 3300046516 | Bacteria | 1299 |
| 263 | Ga0495630_0000575 | 3300046517 | Bacteria | 26810 |
| 264 | Ga0495666_0022986 | 3300046526 | Bacteria | 3085 |
| 265 | Ga0495652_0000038 | 3300046529 | Bacteria | 129311 |
| 266 | Ga0495640_0000001 | 3300046533 | Bacteria | 853827 |
| 267 | Ga0495586_0002775 | 3300046535 | Bacteria | 9467 |
| 268 | Ga0495586_0092020 | 3300046535 | Bacteria | 1676 |
| 269 | Ga0495587_0000004 | 3300046536 | Bacteria | 358433 |
| 270 | Ga0495598_0002102 | 3300046537 | Bacteria | 4063 |
| 271 | Ga0495645_0000001 | 3300046543 | Bacteria | 657910 |
| 272 | Ga0495667_0000093 | 3300046559 | Bacteria | 65066 |
| 273 | Ga0495667_0158135 | 3300046559 | Bacteria | 1458 |
| 274 | Ga0495634_0016330 | 3300046642 | Bacteria | 5310 |
| 275 | Ga0495635_0000003 | 3300046663 | Bacteria | 390055 |
| 276 | Ga0495588_0016001 | 3300046674 | Bacteria | 3620 |
| 277 | Ga0495657_0003983 | 3300046675 | Bacteria | 11851 |
| 278 | Ga0495599_0000012 | 3300046678 | Bacteria | 181156 |
| 279 | Ga0495623_0000015 | 3300046679 | Bacteria | 117329 |
| 280 | Ga0495646_0000005 | 3300046680 | Bacteria | 266899 |
| 281 | Ga0495658_0046435 | 3300046683 | Bacteria | 2441 |
| 282 | Ga0495669_0148682 | 3300046684 | Bacteria | 1108 |
| 283 | Ga0495624_0060792 | 3300046690 | Bacteria | 2368 |
| 284 | Ga0495600_0000051 | 3300046809 | Bacteria | 69572 |
| 285 | Ga0495604_0000002 | 3300047317 | Bacteria | 530904 |
| 286 | Ga0495674_0000004 | 3300047319 | Bacteria | 531855 |
| 287 | Ga0495680_0006865 | 3300047322 | Bacteria | 10517 |
| 288 | Ga0495680_0139710 | 3300047322 | Bacteria | 1773 |
| 289 | Ga0495680_0158033 | 3300047322 | Bacteria | 1648 |
| 290 | Ga0495675_0000465 | 3300047444 | Bacteria | 26712 |
| 291 | Ga0495684_0000004 | 3300047471 | Bacteria | 307093 |
| 292 | Ga0495684_0178241 | 3300047471 | Bacteria | 1577 |
| 293 | Ga0495593_0005703 | 3300047673 | Bacteria | 7348 |
| 294 | Ga0495602_0000001 | 3300048088 | Bacteria | 510904 |
| 295 | Ga0496101_0242817 | 3300048904 | Bacteria | 1402 |
| 296 | Ga0496102_0092287 | 3300048905 | Bacteria | 2804 |
| 297 | Ga0496104_0009678 | 3300048907 | Bacteria | 8587 |
| 298 | Ga0496104_0262771 | 3300048907 | Unclassified | 1639 |
| 299 | Ga0496108_0336549 | 3300048911 | Bacteria | 1317 |
| 300 | Ga0496110_0174488 | 3300048913 | Bacteria | 1951 |
| 301 | Ga0496113_0151647 | 3300048916 | Bacteria | 1829 |
| 302 | Ga0496114_0168493 | 3300048917 | Bacteria | 1908 |
| 303 | Ga0496115_0033488 | 3300048918 | Bacteria | 4057 |
| 304 | Ga0501032_0252077 | 3300049569 | Bacteria | 1146 |
| 305 | Ga0501033_0112639 | 3300049570 | Bacteria | 1979 |
| 306 | Ga0501036_0004646 | 3300049572 | Bacteria | 11098 |
| 307 | Ga0501036_0260828 | 3300049572 | Bacteria | 1452 |
| 308 | Ga0501040_0003091 | 3300049576 | Bacteria | 10796 |
| 309 | Ga0501040_0136809 | 3300049576 | Bacteria | 1725 |
| 310 | Ga0501040_0269048 | 3300049576 | Bacteria | 1217 |
| 311 | Ga0501041_0033306 | 3300049577 | Bacteria | 3117 |
| 312 | Ga0501041_0149704 | 3300049577 | Bacteria | 1457 |
| 313 | Ga0501042_0024750 | 3300049578 | Bacteria | 4212 |
| 314 | Ga0501042_0139756 | 3300049578 | Bacteria | 1746 |
| 315 | Ga0501048_0023807 | 3300049582 | Bacteria | 4472 |
| 316 | Ga0501067_0025805 | 3300049583 | Bacteria | 3257 |
| 317 | Ga0501071_0007398 | 3300049587 | Bacteria | 7206 |
| 318 | Ga0501071_0141311 | 3300049587 | Bacteria | 1793 |
| 319 | Ga0501072_0004856 | 3300049588 | Bacteria | 10230 |
| 320 | Ga0501074_0028628 | 3300049590 | Bacteria | 4038 |
| 321 | Ga0501075_0006585 | 3300049591 | Bacteria | 8001 |
| 322 | Ga0501076_0000870 | 3300049592 | Bacteria | 19633 |
| 323 | Ga0501077_0113366 | 3300049593 | Bacteria | 1719 |
| 324 | Ga0501079_0046518 | 3300049741 | Bacteria | 3348 |
| 325 | Ga0501079_0169411 | 3300049741 | Bacteria | 1703 |
| 326 | Ga0501080_0012676 | 3300049742 | Bacteria | 7731 |
| 327 | Ga0501081_0046359 | 3300049743 | Bacteria | 2987 |
| 328 | Ga0501083_0301204 | 3300049744 | Bacteria | 1043 |
| 329 | Ga0501035_0136644 | 3300049822 | Bacteria | 2134 |
| 330 | Ga0501045_0003545 | 3300049824 | Bacteria | 10711 |
| 331 | Ga0501045_0045431 | 3300049824 | Bacteria | 3198 |
| 332 | nmdc:mga03683_7300_c1 | 3300050489 | Bacteria | 3830 |
| 333 | nmdc:mga0k408_109935_c1 | 3300050493 | Bacteria | 1629 |
| 334 | nmdc:mga0k408_86828_c1 | 3300050493 | Bacteria | 1837 |
| 335 | nmdc:mga07m45_3597_c1 | 3300050496 | Bacteria | 7490 |
| 336 | nmdc:mga05p37_5784_c1 | 3300050507 | Bacteria | 14534 |
| 337 | nmdc:mga05p37_72_c1 | 3300050507 | Bacteria | 88725 |
| 338 | nmdc:mga09592_14341_c1 | 3300050508 | Bacteria | 6470 |
| 339 | nmdc:mga09592_259_c1 | 3300050508 | Bacteria | 38550 |
| 340 | nmdc:mga0qj67_4903_c1 | 3300050509 | Bacteria | 9732 |
| 341 | nmdc:mga06r32_2762_c1 | 3300050510 | Bacteria | 15703 |
| 342 | nmdc:mga08y16_2144_c1 | 3300050511 | Bacteria | 20246 |
| 343 | nmdc:mga08y16_418209_c1 | 3300050511 | Bacteria | 1370 |
| 344 | nmdc:mga08y16_4422_c1 | 3300050511 | Bacteria | 14685 |
| 345 | nmdc:mga08y16_83354_c1 | 3300050511 | Bacteria | 3332 |
| 346 | nmdc:mga0n895_163156_c1 | 3300050512 | Bacteria | 2260 |
| 347 | nmdc:mga0n895_92731_c1 | 3300050512 | Bacteria | 3024 |
| 348 | nmdc:mga0rr50_374_c1 | 3300050513 | Bacteria | 24484 |
| 349 | nmdc:mga08x19_1134_c1 | 3300050514 | Bacteria | 16616 |
| 350 | nmdc:mga08x19_3627_c1 | 3300050514 | Bacteria | 9191 |
| 351 | nmdc:mga0a205_1144_c1 | 3300050515 | Bacteria | 22034 |
| 352 | nmdc:mga0a205_46157_c1 | 3300050515 | Bacteria | 4201 |
| 353 | nmdc:mga0sz30_14778_c1 | 3300050516 | Bacteria | 1483 |
| 354 | nmdc:mga0sz30_83261_c1 | 3300050516 | Bacteria | 1386 |
| 355 | Ga0495601_0000026 | 3300053077 | Bacteria | 126257 |
| 356 | Ga0495612_0000012 | 3300053078 | Bacteria | 223883 |
| 357 | Ga0495595_0000346 | 3300053084 | Bacteria | 17651 |
| 358 | Ga0495595_0031285 | 3300053084 | Bacteria | 2391 |
| 359 | Ga0495595_0046254 | 3300053084 | Bacteria | 2004 |
| 360 | Ga0495619_0000003 | 3300053085 | Bacteria | 515784 |
| 361 | Ga0495619_0029333 | 3300053085 | Bacteria | 3553 |
| 362 | Ga0500644_0020354 | 3300053088 | Bacteria | 1971 |
| 363 | Ga0500646_0004591 | 3300053090 | Bacteria | 3493 |
| 364 | Ga0500594_0059464 | 3300053118 | Bacteria | 1098 |
| 365 | Ga0500655_002183 | 3300053133 | Bacteria | 3610 |
| 366 | Ga0500568_0013857 | 3300053139 | Bacteria | 3662 |
| 367 | Ga0500604_0000701 | 3300053151 | Bacteria | 9187 |
| 368 | Ga0500637_0233379 | 3300053178 | Bacteria | 1035 |
| 369 | Ga0501084_0002778 | 3300054114 | Bacteria | 14139 |
| 370 | Ga0501082_0021380 | 3300060353 | Bacteria | 5581 |
| 371 | Ga0501082_0314657 | 3300060353 | Bacteria | 1364 |
| 372 | Ga0530510_0004260 | 3300061734 | Bacteria | 9897 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035085 | Ga0373929_0021336 | Ga0373929_0021336_500_1267 | 251 |
| 2 | 3300046526 | Ga0495666_0022986 | Ga0495666_0022986_2300_3064 | 251 |
| 3 | 3300049744 | Ga0501083_0301204 | Ga0501083_0301204_33_797 | 251 |
| 4 | 3300035241 | Ga0373961_0090742 | Ga0373961_0090742_28_852 | 270 |
| 5 | 3300053178 | Ga0500637_0233379 | Ga0500637_0233379_126_1013 | 270 |
| 6 | 3300006195 | Ga0075366_10065994 | Ga0075366_100659942 | 271 |
| 7 | 3300050493 | nmdc:mga0k408_109935_c1 | nmdc:mga0k408_109935_c1_295_1182 | 271 |
| 8 | 3300025916 | Ga0207663_10203793 | Ga0207663_102037932 | 281 |
| 9 | 3300049572 | Ga0501036_0260828 | Ga0501036_0260828_501_1355 | 281 |
| 10 | 3300049576 | Ga0501040_0136809 | Ga0501040_0136809_308_1162 | 281 |
| 11 | 3300049577 | Ga0501041_0149704 | Ga0501041_0149704_268_1122 | 281 |
| 12 | 3300049741 | Ga0501079_0169411 | Ga0501079_0169411_267_1121 | 281 |
| 13 | 3300049824 | Ga0501045_0045431 | Ga0501045_0045431_1994_2848 | 281 |
| 14 | 3300005406 | Ga0070703_10013121 | Ga0070703_100131212 | 282 |
| 15 | 3300005467 | Ga0070706_100282349 | Ga0070706_1002823492 | 282 |
| 16 | 3300005536 | Ga0070697_100199353 | Ga0070697_1001993532 | 282 |
| 17 | 3300006871 | Ga0075434_100021299 | Ga0075434_1000212995 | 282 |
| 18 | 3300006914 | Ga0075436_100003254 | Ga0075436_1000032548 | 282 |
| 19 | 3300007788 | Ga0099795_10092591 | Ga0099795_100925911 | 282 |
| 20 | 3300025928 | Ga0207700_10279372 | Ga0207700_102793722 | 282 |
| 21 | 3300039447 | Ga0436361_0089185 | Ga0436361_0089185_6536_7393 | 282 |
| 22 | 3300039453 | Ga0436362_0414841 | Ga0436362_0414841_389_1246 | 282 |
| 23 | 3300048907 | Ga0496104_0009678 | Ga0496104_0009678_6685_7542 | 282 |
| 24 | 3300048911 | Ga0496108_0336549 | Ga0496108_0336549_100_957 | 282 |
| 25 | 3300048913 | Ga0496110_0174488 | Ga0496110_0174488_208_1065 | 282 |
| 26 | 3300048918 | Ga0496115_0033488 | Ga0496115_0033488_190_1047 | 282 |
| 27 | 3300049576 | Ga0501040_0269048 | Ga0501040_0269048_289_1146 | 282 |
| 28 | 3300049578 | Ga0501042_0139756 | Ga0501042_0139756_140_997 | 282 |
| 29 | 3300050512 | nmdc:mga0n895_163156_c1 | nmdc:mga0n895_163156_c1_1367_2224 | 282 |
| 30 | 3300050514 | nmdc:mga08x19_3627_c1 | nmdc:mga08x19_3627_c1_6087_6944 | 282 |
| 31 | 3300060353 | Ga0501082_0314657 | Ga0501082_0314657_444_1301 | 282 |
| 32 | 3300025915 | Ga0207693_10033693 | Ga0207693_100336933 | 283 |
| 33 | 3300037853 | Ga0436364_0648577 | Ga0436364_0648577_177_1037 | 283 |
| 34 | 3300037853 | Ga0436364_1378189 | Ga0436364_1378189_603_1463 | 283 |
| 35 | 3300039437 | Ga0436365_1663154 | Ga0436365_1663154_1693_2553 | 283 |
| 36 | 3300046559 | Ga0495667_0158135 | Ga0495667_0158135_150_1016 | 283 |
| 37 | 3300047322 | Ga0495680_0158033 | Ga0495680_0158033_658_1524 | 283 |
| 38 | 3300047471 | Ga0495684_0178241 | Ga0495684_0178241_604_1470 | 283 |
| 39 | 3300048904 | Ga0496101_0242817 | Ga0496101_0242817_469_1329 | 283 |
| 40 | 3300048905 | Ga0496102_0092287 | Ga0496102_0092287_705_1565 | 283 |
| 41 | 3300048917 | Ga0496114_0168493 | Ga0496114_0168493_725_1585 | 283 |
| 42 | 3300053084 | Ga0495595_0046254 | Ga0495595_0046254_89_949 | 283 |
| 43 | 3300053085 | Ga0495619_0029333 | Ga0495619_0029333_1058_1924 | 283 |
| 44 | 3300053118 | Ga0500594_0059464 | Ga0500594_0059464_23_910 | 283 |
| 45 | 3300006914 | Ga0075436_100026092 | Ga0075436_1000260923 | 289 |
| 46 | 3300021361 | Ga0213872_10105364 | Ga0213872_101053641 | 289 |
| 47 | 3300025913 | Ga0207695_10086718 | Ga0207695_100867182 | 289 |
| 48 | 3300031241 | Ga0265325_10005278 | Ga0265325_100052782 | 289 |
| 49 | 3300037068 | Ga0373925_0174812 | Ga0373925_0174812_159_1031 | 289 |
| 50 | 3300039447 | Ga0436361_0094315 | Ga0436361_0094315_3123_3995 | 289 |
| 51 | 3300046516 | Ga0495628_0258287 | Ga0495628_0258287_11_889 | 289 |
| 52 | 3300048907 | Ga0496104_0262771 | Ga0496104_0262771_541_1413 | 289 |
| 53 | 3300005330 | Ga0070690_100000440 | Ga0070690_10000044011 | 290 |
| 54 | 3300005334 | Ga0068869_100000806 | Ga0068869_1000008069 | 290 |
| 55 | 3300005336 | Ga0070680_100000656 | Ga0070680_10000065617 | 290 |
| 56 | 3300005337 | Ga0070682_100002698 | Ga0070682_10000269810 | 290 |
| 57 | 3300005338 | Ga0068868_100001558 | Ga0068868_1000015589 | 290 |
| 58 | 3300005340 | Ga0070689_100000287 | Ga0070689_10000028725 | 290 |
| 59 | 3300005343 | Ga0070687_100000294 | Ga0070687_1000002949 | 290 |
| 60 | 3300005354 | Ga0070675_100171790 | Ga0070675_1001717902 | 290 |
| 61 | 3300005364 | Ga0070673_100123697 | Ga0070673_1001236973 | 290 |
| 62 | 3300005364 | Ga0070673_100227138 | Ga0070673_1002271382 | 290 |
| 63 | 3300005406 | Ga0070703_10014974 | Ga0070703_100149742 | 290 |
| 64 | 3300005438 | Ga0070701_10000231 | Ga0070701_100002319 | 290 |
| 65 | 3300005440 | Ga0070705_100001497 | Ga0070705_1000014977 | 290 |
| 66 | 3300005440 | Ga0070705_100038692 | Ga0070705_1000386923 | 290 |
| 67 | 3300005441 | Ga0070700_100008623 | Ga0070700_1000086232 | 290 |
| 68 | 3300005444 | Ga0070694_100000090 | Ga0070694_10000009030 | 290 |
| 69 | 3300005445 | Ga0070708_100036915 | Ga0070708_1000369155 | 290 |
| 70 | 3300005456 | Ga0070678_100103049 | Ga0070678_1001030491 | 290 |
| 71 | 3300005458 | Ga0070681_10008872 | Ga0070681_100088729 | 290 |
| 72 | 3300005458 | Ga0070681_10086228 | Ga0070681_100862284 | 290 |
| 73 | 3300005459 | Ga0068867_100000595 | Ga0068867_10000059514 | 290 |
| 74 | 3300005530 | Ga0070679_100415655 | Ga0070679_1004156552 | 290 |
| 75 | 3300005539 | Ga0068853_100014577 | Ga0068853_1000145776 | 290 |
| 76 | 3300005544 | Ga0070686_100000815 | Ga0070686_1000008159 | 290 |
| 77 | 3300005545 | Ga0070695_100000079 | Ga0070695_10000007910 | 290 |
| 78 | 3300005546 | Ga0070696_100000170 | Ga0070696_10000017033 | 290 |
| 79 | 3300005546 | Ga0070696_100000296 | Ga0070696_10000029626 | 290 |
| 80 | 3300005547 | Ga0070693_100000321 | Ga0070693_10000032112 | 290 |
| 81 | 3300005549 | Ga0070704_100000445 | Ga0070704_10000044514 | 290 |
| 82 | 3300005563 | Ga0068855_100026854 | Ga0068855_1000268542 | 290 |
| 83 | 3300005563 | Ga0068855_100299533 | Ga0068855_1002995333 | 290 |
| 84 | 3300005578 | Ga0068854_100004057 | Ga0068854_1000040578 | 290 |
| 85 | 3300005614 | Ga0068856_100005486 | Ga0068856_10000548613 | 290 |
| 86 | 3300005615 | Ga0070702_100000068 | Ga0070702_10000006823 | 290 |
| 87 | 3300005617 | Ga0068859_100002721 | Ga0068859_10000272115 | 290 |
| 88 | 3300005617 | Ga0068859_100062954 | Ga0068859_1000629544 | 290 |
| 89 | 3300005618 | Ga0068864_100081964 | Ga0068864_1000819645 | 290 |
| 90 | 3300005718 | Ga0068866_10000631 | Ga0068866_1000063115 | 290 |
| 91 | 3300005719 | Ga0068861_100000070 | Ga0068861_10000007042 | 290 |
| 92 | 3300005840 | Ga0068870_10020337 | Ga0068870_100203373 | 290 |
| 93 | 3300005842 | Ga0068858_100003760 | Ga0068858_1000037604 | 290 |
| 94 | 3300005843 | Ga0068860_100002032 | Ga0068860_10000203211 | 290 |
| 95 | 3300005843 | Ga0068860_100225596 | Ga0068860_1002255963 | 290 |
| 96 | 3300005844 | Ga0068862_100000975 | Ga0068862_10000097523 | 290 |
| 97 | 3300005844 | Ga0068862_100274852 | Ga0068862_1002748522 | 290 |
| 98 | 3300006237 | Ga0097621_100000468 | Ga0097621_1000004686 | 290 |
| 99 | 3300006358 | Ga0068871_100000188 | Ga0068871_10000018811 | 290 |
| 100 | 3300006844 | Ga0075428_100000109 | Ga0075428_10000010929 | 290 |
| 101 | 3300006852 | Ga0075433_10001494 | Ga0075433_1000149413 | 290 |
| 102 | 3300006852 | Ga0075433_10063982 | Ga0075433_100639822 | 290 |
| 103 | 3300006871 | Ga0075434_100000349 | Ga0075434_10000034916 | 290 |
| 104 | 3300006871 | Ga0075434_100271124 | Ga0075434_1002711243 | 290 |
| 105 | 3300006880 | Ga0075429_100001875 | Ga0075429_1000018758 | 290 |
| 106 | 3300006881 | Ga0068865_100000774 | Ga0068865_10000077415 | 290 |
| 107 | 3300006914 | Ga0075436_100000075 | Ga0075436_10000007548 | 290 |
| 108 | 3300006914 | Ga0075436_100008688 | Ga0075436_1000086884 | 290 |
| 109 | 3300006931 | Ga0097620_100002721 | Ga0097620_10000272115 | 290 |
| 110 | 3300006931 | Ga0097620_100062952 | Ga0097620_1000629524 | 290 |
| 111 | 3300007076 | Ga0075435_100000116 | Ga0075435_10000011626 | 290 |
| 112 | 3300009094 | Ga0111539_10001832 | Ga0111539_100018326 | 290 |
| 113 | 3300009094 | Ga0111539_10006398 | Ga0111539_1000639813 | 290 |
| 114 | 3300009098 | Ga0105245_10001758 | Ga0105245_1000175811 | 290 |
| 115 | 3300009147 | Ga0114129_10001030 | Ga0114129_100010306 | 290 |
| 116 | 3300009148 | Ga0105243_10004393 | Ga0105243_1000439315 | 290 |
| 117 | 3300009174 | Ga0105241_10008485 | Ga0105241_100084854 | 290 |
| 118 | 3300009176 | Ga0105242_10000161 | Ga0105242_1000016110 | 290 |
| 119 | 3300011119 | Ga0105246_10183411 | Ga0105246_101834112 | 290 |
| 120 | 3300013297 | Ga0157378_10001854 | Ga0157378_1000185410 | 290 |
| 121 | 3300014969 | Ga0157376_10002507 | Ga0157376_100025078 | 290 |
| 122 | 3300025885 | Ga0207653_10005768 | Ga0207653_100057683 | 290 |
| 123 | 3300025899 | Ga0207642_10000249 | Ga0207642_100002497 | 290 |
| 124 | 3300025908 | Ga0207643_10033718 | Ga0207643_100337182 | 290 |
| 125 | 3300025911 | Ga0207654_10018671 | Ga0207654_100186714 | 290 |
| 126 | 3300025912 | Ga0207707_10005043 | Ga0207707_100050432 | 290 |
| 127 | 3300025917 | Ga0207660_10003897 | Ga0207660_100038972 | 290 |
| 128 | 3300025918 | Ga0207662_10000064 | Ga0207662_1000006430 | 290 |
| 129 | 3300025923 | Ga0207681_10081722 | Ga0207681_100817223 | 290 |
| 130 | 3300025926 | Ga0207659_10157701 | Ga0207659_101577013 | 290 |
| 131 | 3300025927 | Ga0207687_10000267 | Ga0207687_1000026733 | 290 |
| 132 | 3300025934 | Ga0207686_10065519 | Ga0207686_100655193 | 290 |
| 133 | 3300025935 | Ga0207709_10000473 | Ga0207709_100004736 | 290 |
| 134 | 3300025936 | Ga0207670_10003751 | Ga0207670_100037515 | 290 |
| 135 | 3300025936 | Ga0207670_10022528 | Ga0207670_100225282 | 290 |
| 136 | 3300025937 | Ga0207669_10528550 | Ga0207669_105285501 | 290 |
| 137 | 3300025938 | Ga0207704_10000581 | Ga0207704_1000058119 | 290 |
| 138 | 3300025942 | Ga0207689_10000200 | Ga0207689_1000020012 | 290 |
| 139 | 3300025949 | Ga0207667_10006516 | Ga0207667_1000651610 | 290 |
| 140 | 3300025949 | Ga0207667_10238610 | Ga0207667_102386101 | 290 |
| 141 | 3300025961 | Ga0207712_10001270 | Ga0207712_1000127022 | 290 |
| 142 | 3300026023 | Ga0207677_10010986 | Ga0207677_100109865 | 290 |
| 143 | 3300026035 | Ga0207703_10009109 | Ga0207703_100091093 | 290 |
| 144 | 3300026041 | Ga0207639_10008151 | Ga0207639_100081516 | 290 |
| 145 | 3300026075 | Ga0207708_10001866 | Ga0207708_1000186620 | 290 |
| 146 | 3300026078 | Ga0207702_10009686 | Ga0207702_100096867 | 290 |
| 147 | 3300026089 | Ga0207648_10000309 | Ga0207648_1000030913 | 290 |
| 148 | 3300026118 | Ga0207675_100000089 | Ga0207675_10000008913 | 290 |
| 149 | 3300026121 | Ga0207683_10390386 | Ga0207683_103903862 | 290 |
| 150 | 3300027907 | Ga0207428_10002692 | Ga0207428_1000269213 | 290 |
| 151 | 3300027907 | Ga0207428_10197292 | Ga0207428_101972922 | 290 |
| 152 | 3300028380 | Ga0268265_10002816 | Ga0268265_1000281617 | 290 |
| 153 | 3300028381 | Ga0268264_10001651 | Ga0268264_100016513 | 290 |
| 154 | 3300035085 | Ga0373929_0004446 | Ga0373929_0004446_1453_2334 | 290 |
| 155 | 3300035090 | Ga0373949_0025099 | Ga0373949_0025099_247_1128 | 290 |
| 156 | 3300035112 | Ga0373932_0024275 | Ga0373932_0024275_393_1274 | 290 |
| 157 | 3300035113 | Ga0373936_0001521 | Ga0373936_0001521_5033_5926 | 290 |
| 158 | 3300035113 | Ga0373936_0010505 | Ga0373936_0010505_608_1501 | 290 |
| 159 | 3300035114 | Ga0373939_0004879 | Ga0373939_0004879_1739_2620 | 290 |
| 160 | 3300035115 | Ga0373941_0011259 | Ga0373941_0011259_1399_2280 | 290 |
| 161 | 3300035115 | Ga0373941_0076963 | Ga0373941_0076963_144_1025 | 290 |
| 162 | 3300035116 | Ga0373945_0000982 | Ga0373945_0000982_4850_5743 | 290 |
| 163 | 3300035121 | Ga0373960_0048312 | Ga0373960_0048312_288_1172 | 290 |
| 164 | 3300035170 | Ga0373943_0002679 | Ga0373943_0002679_7000_7893 | 290 |
| 165 | 3300035170 | Ga0373943_0020216 | Ga0373943_0020216_1548_2441 | 290 |
| 166 | 3300035171 | Ga0373946_0004375 | Ga0373946_0004375_1679_2572 | 290 |
| 167 | 3300035242 | Ga0373962_0018301 | Ga0373962_0018301_385_1266 | 290 |
| 168 | 3300035691 | Ga0373931_0002168 | Ga0373931_0002168_3681_4562 | 290 |
| 169 | 3300035691 | Ga0373931_0017523 | Ga0373931_0017523_517_1398 | 290 |
| 170 | 3300035692 | Ga0373935_0080847 | Ga0373935_0080847_670_1563 | 290 |
| 171 | 3300035695 | Ga0373927_0040828 | Ga0373927_0040828_833_1726 | 290 |
| 172 | 3300035725 | Ga0373947_0007059 | Ga0373947_0007059_3435_4328 | 290 |
| 173 | 3300035725 | Ga0373947_0008661 | Ga0373947_0008661_3079_3972 | 290 |
| 174 | 3300037068 | Ga0373925_0009958 | Ga0373925_0009958_2518_3411 | 290 |
| 175 | 3300037068 | Ga0373925_0179148 | Ga0373925_0179148_55_948 | 290 |
| 176 | 3300042876 | Ga0451577_0197016 | Ga0451577_0197016_249_1130 | 290 |
| 177 | 3300045051 | Ga0451576_0001678 | Ga0451576_0001678_16753_17634 | 290 |
| 178 | 3300045051 | Ga0451576_0021497 | Ga0451576_0021497_1451_2332 | 290 |
| 179 | 3300045051 | Ga0451576_0135309 | Ga0451576_0135309_198_1082 | 290 |
| 180 | 3300045051 | Ga0451576_0244918 | Ga0451576_0244918_375_1256 | 290 |
| 181 | 3300046455 | Ga0495603_0035696 | Ga0495603_0035696_116_1009 | 290 |
| 182 | 3300046472 | Ga0495580_0008568 | Ga0495580_0008568_2310_3203 | 290 |
| 183 | 3300046473 | Ga0495582_0029711 | Ga0495582_0029711_1191_2084 | 290 |
| 184 | 3300046475 | Ga0495639_0061687 | Ga0495639_0061687_120_1013 | 290 |
| 185 | 3300046535 | Ga0495586_0002775 | Ga0495586_0002775_1866_2759 | 290 |
| 186 | 3300046537 | Ga0495598_0002102 | Ga0495598_0002102_262_1143 | 290 |
| 187 | 3300046674 | Ga0495588_0016001 | Ga0495588_0016001_932_1825 | 290 |
| 188 | 3300046683 | Ga0495658_0046435 | Ga0495658_0046435_480_1373 | 290 |
| 189 | 3300046684 | Ga0495669_0148682 | Ga0495669_0148682_14_895 | 290 |
| 190 | 3300049569 | Ga0501032_0252077 | Ga0501032_0252077_53_934 | 290 |
| 191 | 3300049570 | Ga0501033_0112639 | Ga0501033_0112639_265_1146 | 290 |
| 192 | 3300049572 | Ga0501036_0004646 | Ga0501036_0004646_433_1314 | 290 |
| 193 | 3300049576 | Ga0501040_0003091 | Ga0501040_0003091_1836_2717 | 290 |
| 194 | 3300049577 | Ga0501041_0033306 | Ga0501041_0033306_2107_2988 | 290 |
| 195 | 3300049578 | Ga0501042_0024750 | Ga0501042_0024750_3082_3963 | 290 |
| 196 | 3300049582 | Ga0501048_0023807 | Ga0501048_0023807_2813_3694 | 290 |
| 197 | 3300049583 | Ga0501067_0025805 | Ga0501067_0025805_2121_3005 | 290 |
| 198 | 3300049587 | Ga0501071_0007398 | Ga0501071_0007398_5910_6791 | 290 |
| 199 | 3300049587 | Ga0501071_0141311 | Ga0501071_0141311_301_1182 | 290 |
| 200 | 3300049588 | Ga0501072_0004856 | Ga0501072_0004856_8426_9307 | 290 |
| 201 | 3300049590 | Ga0501074_0028628 | Ga0501074_0028628_1421_2302 | 290 |
| 202 | 3300049591 | Ga0501075_0006585 | Ga0501075_0006585_6762_7643 | 290 |
| 203 | 3300049592 | Ga0501076_0000870 | Ga0501076_0000870_8869_9750 | 290 |
| 204 | 3300049593 | Ga0501077_0113366 | Ga0501077_0113366_785_1678 | 290 |
| 205 | 3300049741 | Ga0501079_0046518 | Ga0501079_0046518_299_1180 | 290 |
| 206 | 3300049742 | Ga0501080_0012676 | Ga0501080_0012676_6576_7457 | 290 |
| 207 | 3300049743 | Ga0501081_0046359 | Ga0501081_0046359_1865_2746 | 290 |
| 208 | 3300049822 | Ga0501035_0136644 | Ga0501035_0136644_545_1426 | 290 |
| 209 | 3300049824 | Ga0501045_0003545 | Ga0501045_0003545_793_1674 | 290 |
| 210 | 3300050507 | nmdc:mga05p37_72_c1 | nmdc:mga05p37_72_c1_3504_4385 | 290 |
| 211 | 3300050508 | nmdc:mga09592_259_c1 | nmdc:mga09592_259_c1_673_1554 | 290 |
| 212 | 3300050511 | nmdc:mga08y16_2144_c1 | nmdc:mga08y16_2144_c1_14658_15539 | 290 |
| 213 | 3300050511 | nmdc:mga08y16_83354_c1 | nmdc:mga08y16_83354_c1_613_1494 | 290 |
| 214 | 3300050512 | nmdc:mga0n895_92731_c1 | nmdc:mga0n895_92731_c1_595_1476 | 290 |
| 215 | 3300050513 | nmdc:mga0rr50_374_c1 | nmdc:mga0rr50_374_c1_22507_23388 | 290 |
| 216 | 3300050514 | nmdc:mga08x19_1134_c1 | nmdc:mga08x19_1134_c1_5856_6737 | 290 |
| 217 | 3300050515 | nmdc:mga0a205_1144_c1 | nmdc:mga0a205_1144_c1_9294_10175 | 290 |
| 218 | 3300050515 | nmdc:mga0a205_46157_c1 | nmdc:mga0a205_46157_c1_1428_2309 | 290 |
| 219 | 3300054114 | Ga0501084_0002778 | Ga0501084_0002778_11641_12522 | 290 |
| 220 | 3300060353 | Ga0501082_0021380 | Ga0501082_0021380_282_1163 | 290 |
| 221 | 3300061734 | Ga0530510_0004260 | Ga0530510_0004260_8323_9204 | 290 |
| 222 | 3300003323 | rootH1_10200199 | rootH1_102001992 | 291 |
| 223 | 3300005339 | Ga0070660_100510823 | Ga0070660_1005108231 | 291 |
| 224 | 3300005347 | Ga0070668_100008002 | Ga0070668_1000080025 | 291 |
| 225 | 3300005353 | Ga0070669_100143111 | Ga0070669_1001431112 | 291 |
| 226 | 3300005435 | Ga0070714_100156792 | Ga0070714_1001567922 | 291 |
| 227 | 3300005435 | Ga0070714_100334125 | Ga0070714_1003341252 | 291 |
| 228 | 3300005436 | Ga0070713_100051887 | Ga0070713_1000518872 | 291 |
| 229 | 3300005436 | Ga0070713_100081079 | Ga0070713_1000810792 | 291 |
| 230 | 3300005436 | Ga0070713_100155565 | Ga0070713_1001555651 | 291 |
| 231 | 3300005445 | Ga0070708_100181005 | Ga0070708_1001810053 | 291 |
| 232 | 3300005457 | Ga0070662_100007815 | Ga0070662_1000078154 | 291 |
| 233 | 3300005467 | Ga0070706_100420108 | Ga0070706_1004201082 | 291 |
| 234 | 3300005471 | Ga0070698_100061807 | Ga0070698_1000618072 | 291 |
| 235 | 3300005518 | Ga0070699_100306733 | Ga0070699_1003067331 | 291 |
| 236 | 3300005563 | Ga0068855_100629209 | Ga0068855_1006292091 | 291 |
| 237 | 3300005578 | Ga0068854_100096474 | Ga0068854_1000964744 | 291 |
| 238 | 3300005615 | Ga0070702_100047015 | Ga0070702_1000470151 | 291 |
| 239 | 3300005719 | Ga0068861_100012679 | Ga0068861_1000126793 | 291 |
| 240 | 3300005844 | Ga0068862_100051805 | Ga0068862_1000518054 | 291 |
| 241 | 3300005937 | Ga0081455_10251574 | Ga0081455_102515742 | 291 |
| 242 | 3300005981 | Ga0081538_10011974 | Ga0081538_100119743 | 291 |
| 243 | 3300005983 | Ga0081540_1009053 | Ga0081540_10090533 | 291 |
| 244 | 3300006186 | Ga0075369_10003098 | Ga0075369_100030983 | 291 |
| 245 | 3300006195 | Ga0075366_10037583 | Ga0075366_100375833 | 291 |
| 246 | 3300006353 | Ga0075370_10025086 | Ga0075370_100250862 | 291 |
| 247 | 3300006846 | Ga0075430_100016218 | Ga0075430_1000162184 | 291 |
| 248 | 3300006847 | Ga0075431_100005187 | Ga0075431_10000518713 | 291 |
| 249 | 3300006880 | Ga0075429_100028692 | Ga0075429_1000286924 | 291 |
| 250 | 3300007788 | Ga0099795_10082321 | Ga0099795_100823211 | 291 |
| 251 | 3300009093 | Ga0105240_10503021 | Ga0105240_105030212 | 291 |
| 252 | 3300009094 | Ga0111539_10005738 | Ga0111539_1000573812 | 291 |
| 253 | 3300009094 | Ga0111539_10374899 | Ga0111539_103748992 | 291 |
| 254 | 3300009098 | Ga0105245_10004295 | Ga0105245_100042957 | 291 |
| 255 | 3300009147 | Ga0114129_10032825 | Ga0114129_100328254 | 291 |
| 256 | 3300009177 | Ga0105248_10358285 | Ga0105248_103582853 | 291 |
| 257 | 3300009553 | Ga0105249_10003007 | Ga0105249_1000300715 | 291 |
| 258 | 3300010159 | Ga0099796_10002945 | Ga0099796_100029452 | 291 |
| 259 | 3300010159 | Ga0099796_10076028 | Ga0099796_100760281 | 291 |
| 260 | 3300010375 | Ga0105239_10155643 | Ga0105239_101556432 | 291 |
| 261 | 3300013306 | Ga0163162_10130067 | Ga0163162_101300671 | 291 |
| 262 | 3300014497 | Ga0182008_10089618 | Ga0182008_100896182 | 291 |
| 263 | 3300014968 | Ga0157379_10156974 | Ga0157379_101569742 | 291 |
| 264 | 3300017792 | Ga0163161_10091117 | Ga0163161_100911173 | 291 |
| 265 | 3300021377 | Ga0213874_10014439 | Ga0213874_100144392 | 291 |
| 266 | 3300021384 | Ga0213876_10060071 | Ga0213876_100600713 | 291 |
| 267 | 3300021384 | Ga0213876_10231521 | Ga0213876_102315211 | 291 |
| 268 | 3300021388 | Ga0213875_10000189 | Ga0213875_1000018927 | 291 |
| 269 | 3300021388 | Ga0213875_10039457 | Ga0213875_100394572 | 291 |
| 270 | 3300025898 | Ga0207692_10230648 | Ga0207692_102306482 | 291 |
| 271 | 3300025901 | Ga0207688_10153428 | Ga0207688_101534281 | 291 |
| 272 | 3300025906 | Ga0207699_10156404 | Ga0207699_101564042 | 291 |
| 273 | 3300025915 | Ga0207693_10011477 | Ga0207693_100114776 | 291 |
| 274 | 3300025916 | Ga0207663_10071113 | Ga0207663_100711132 | 291 |
| 275 | 3300025922 | Ga0207646_10024927 | Ga0207646_100249275 | 291 |
| 276 | 3300025923 | Ga0207681_10120707 | Ga0207681_101207072 | 291 |
| 277 | 3300025927 | Ga0207687_10027852 | Ga0207687_100278522 | 291 |
| 278 | 3300025928 | Ga0207700_10021530 | Ga0207700_100215303 | 291 |
| 279 | 3300025928 | Ga0207700_10055111 | Ga0207700_100551112 | 291 |
| 280 | 3300025928 | Ga0207700_10119234 | Ga0207700_101192342 | 291 |
| 281 | 3300025933 | Ga0207706_10008368 | Ga0207706_100083686 | 291 |
| 282 | 3300025961 | Ga0207712_10003450 | Ga0207712_1000345010 | 291 |
| 283 | 3300026118 | Ga0207675_100000839 | Ga0207675_10000083926 | 291 |
| 284 | 3300027907 | Ga0207428_10005877 | Ga0207428_1000587711 | 291 |
| 285 | 3300030521 | Ga0307511_10000216 | Ga0307511_1000021629 | 291 |
| 286 | 3300031731 | Ga0307405_10078294 | Ga0307405_100782943 | 291 |
| 287 | 3300031995 | Ga0307409_100185646 | Ga0307409_1001856461 | 291 |
| 288 | 3300032002 | Ga0307416_100006871 | Ga0307416_1000068711 | 291 |
| 289 | 3300035086 | Ga0373934_0023273 | Ga0373934_0023273_1012_1890 | 291 |
| 290 | 3300035086 | Ga0373934_0085981 | Ga0373934_0085981_335_1213 | 291 |
| 291 | 3300035111 | Ga0373923_0009272 | Ga0373923_0009272_717_1595 | 291 |
| 292 | 3300035113 | Ga0373936_0008198 | Ga0373936_0008198_1409_2287 | 291 |
| 293 | 3300035116 | Ga0373945_0002868 | Ga0373945_0002868_3321_4199 | 291 |
| 294 | 3300035117 | Ga0373953_0022574 | Ga0373953_0022574_327_1205 | 291 |
| 295 | 3300035118 | Ga0373954_0003405 | Ga0373954_0003405_616_1494 | 291 |
| 296 | 3300035170 | Ga0373943_0086697 | Ga0373943_0086697_138_1016 | 291 |
| 297 | 3300035172 | Ga0373955_0000218 | Ga0373955_0000218_8545_9423 | 291 |
| 298 | 3300035410 | Ga0373924_0022303 | Ga0373924_0022303_348_1226 | 291 |
| 299 | 3300035692 | Ga0373935_0000260 | Ga0373935_0000260_10477_11355 | 291 |
| 300 | 3300035692 | Ga0373935_0084628 | Ga0373935_0084628_853_1731 | 291 |
| 301 | 3300035692 | Ga0373935_0113975 | Ga0373935_0113975_248_1141 | 291 |
| 302 | 3300035695 | Ga0373927_0003881 | Ga0373927_0003881_8006_8884 | 291 |
| 303 | 3300035695 | Ga0373927_0017047 | Ga0373927_0017047_1140_2018 | 291 |
| 304 | 3300035724 | Ga0373933_0004564 | Ga0373933_0004564_511_1389 | 291 |
| 305 | 3300035725 | Ga0373947_0012091 | Ga0373947_0012091_1716_2594 | 291 |
| 306 | 3300036401 | Ga0373937_0000697 | Ga0373937_0000697_10026_10904 | 291 |
| 307 | 3300037068 | Ga0373925_0000071 | Ga0373925_0000071_60164_61042 | 291 |
| 308 | 3300037068 | Ga0373925_0111445 | Ga0373925_0111445_237_1115 | 291 |
| 309 | 3300037853 | Ga0436364_0463644 | Ga0436364_0463644_680_1558 | 291 |
| 310 | 3300037853 | Ga0436364_1269605 | Ga0436364_1269605_197_1075 | 291 |
| 311 | 3300037853 | Ga0436364_1480641 | Ga0436364_1480641_6386_7264 | 291 |
| 312 | 3300037853 | Ga0436364_1514411 | Ga0436364_1514411_1526_2404 | 291 |
| 313 | 3300039437 | Ga0436365_0561561 | Ga0436365_0561561_201_1079 | 291 |
| 314 | 3300039437 | Ga0436365_1893197 | Ga0436365_1893197_314_1192 | 291 |
| 315 | 3300039438 | Ga0436360_1131979 | Ga0436360_1131979_475_1353 | 291 |
| 316 | 3300039450 | Ga0436363_1288856 | Ga0436363_1288856_625_1503 | 291 |
| 317 | 3300039453 | Ga0436362_0134496 | Ga0436362_0134496_714_1592 | 291 |
| 318 | 3300046454 | Ga0495592_0000117 | Ga0495592_0000117_64706_65584 | 291 |
| 319 | 3300046459 | Ga0495629_0011403 | Ga0495629_0011403_2620_3498 | 291 |
| 320 | 3300046462 | Ga0495651_0000156 | Ga0495651_0000156_29532_30410 | 291 |
| 321 | 3300046463 | Ga0495653_0000047 | Ga0495653_0000047_39835_40713 | 291 |
| 322 | 3300046475 | Ga0495639_0085046 | Ga0495639_0085046_191_1069 | 291 |
| 323 | 3300046476 | Ga0495662_0052595 | Ga0495662_0052595_65_943 | 291 |
| 324 | 3300046477 | Ga0495664_0000024 | Ga0495664_0000024_10682_11560 | 291 |
| 325 | 3300046511 | Ga0495608_0000004 | Ga0495608_0000004_131466_132344 | 291 |
| 326 | 3300046514 | Ga0495618_0000036 | Ga0495618_0000036_82276_83154 | 291 |
| 327 | 3300046516 | Ga0495628_0000006 | Ga0495628_0000006_18389_19267 | 291 |
| 328 | 3300046517 | Ga0495630_0000575 | Ga0495630_0000575_18450_19328 | 291 |
| 329 | 3300046529 | Ga0495652_0000038 | Ga0495652_0000038_13400_14278 | 291 |
| 330 | 3300046533 | Ga0495640_0000001 | Ga0495640_0000001_79853_80731 | 291 |
| 331 | 3300046535 | Ga0495586_0092020 | Ga0495586_0092020_322_1200 | 291 |
| 332 | 3300046536 | Ga0495587_0000004 | Ga0495587_0000004_134931_135809 | 291 |
| 333 | 3300046543 | Ga0495645_0000001 | Ga0495645_0000001_222772_223650 | 291 |
| 334 | 3300046559 | Ga0495667_0000093 | Ga0495667_0000093_4518_5396 | 291 |
| 335 | 3300046642 | Ga0495634_0016330 | Ga0495634_0016330_355_1233 | 291 |
| 336 | 3300046663 | Ga0495635_0000003 | Ga0495635_0000003_222403_223281 | 291 |
| 337 | 3300046675 | Ga0495657_0003983 | Ga0495657_0003983_310_1188 | 291 |
| 338 | 3300046678 | Ga0495599_0000012 | Ga0495599_0000012_74945_75823 | 291 |
| 339 | 3300046679 | Ga0495623_0000015 | Ga0495623_0000015_112008_112886 | 291 |
| 340 | 3300046680 | Ga0495646_0000005 | Ga0495646_0000005_134943_135821 | 291 |
| 341 | 3300046690 | Ga0495624_0060792 | Ga0495624_0060792_415_1293 | 291 |
| 342 | 3300046809 | Ga0495600_0000051 | Ga0495600_0000051_67841_68719 | 291 |
| 343 | 3300047317 | Ga0495604_0000002 | Ga0495604_0000002_307368_308246 | 291 |
| 344 | 3300047319 | Ga0495674_0000004 | Ga0495674_0000004_306917_307795 | 291 |
| 345 | 3300047322 | Ga0495680_0006865 | Ga0495680_0006865_9270_10148 | 291 |
| 346 | 3300047322 | Ga0495680_0139710 | Ga0495680_0139710_803_1681 | 291 |
| 347 | 3300047444 | Ga0495675_0000465 | Ga0495675_0000465_22570_23448 | 291 |
| 348 | 3300047471 | Ga0495684_0000004 | Ga0495684_0000004_287793_288671 | 291 |
| 349 | 3300047673 | Ga0495593_0005703 | Ga0495593_0005703_1933_2811 | 291 |
| 350 | 3300048088 | Ga0495602_0000001 | Ga0495602_0000001_222445_223323 | 291 |
| 351 | 3300048916 | Ga0496113_0151647 | Ga0496113_0151647_357_1235 | 291 |
| 352 | 3300050489 | nmdc:mga03683_7300_c1 | nmdc:mga03683_7300_c1_2059_2946 | 291 |
| 353 | 3300050493 | nmdc:mga0k408_86828_c1 | nmdc:mga0k408_86828_c1_53_940 | 291 |
| 354 | 3300050496 | nmdc:mga07m45_3597_c1 | nmdc:mga07m45_3597_c1_3399_4286 | 291 |
| 355 | 3300050507 | nmdc:mga05p37_5784_c1 | nmdc:mga05p37_5784_c1_9434_10327 | 291 |
| 356 | 3300050508 | nmdc:mga09592_14341_c1 | nmdc:mga09592_14341_c1_2342_3235 | 291 |
| 357 | 3300050509 | nmdc:mga0qj67_4903_c1 | nmdc:mga0qj67_4903_c1_8109_9002 | 291 |
| 358 | 3300050510 | nmdc:mga06r32_2762_c1 | nmdc:mga06r32_2762_c1_1779_2672 | 291 |
| 359 | 3300050511 | nmdc:mga08y16_418209_c1 | nmdc:mga08y16_418209_c1_128_1036 | 291 |
| 360 | 3300050511 | nmdc:mga08y16_4422_c1 | nmdc:mga08y16_4422_c1_9434_10327 | 291 |
| 361 | 3300050516 | nmdc:mga0sz30_14778_c1 | nmdc:mga0sz30_14778_c1_333_1220 | 291 |
| 362 | 3300050516 | nmdc:mga0sz30_83261_c1 | nmdc:mga0sz30_83261_c1_88_975 | 291 |
| 363 | 3300053077 | Ga0495601_0000026 | Ga0495601_0000026_10474_11352 | 291 |
| 364 | 3300053078 | Ga0495612_0000012 | Ga0495612_0000012_377_1255 | 291 |
| 365 | 3300053084 | Ga0495595_0000346 | Ga0495595_0000346_10449_11327 | 291 |
| 366 | 3300053084 | Ga0495595_0031285 | Ga0495595_0031285_1030_1908 | 291 |
| 367 | 3300053085 | Ga0495619_0000003 | Ga0495619_0000003_227567_228445 | 291 |
| 368 | 3300053088 | Ga0500644_0020354 | Ga0500644_0020354_869_1756 | 291 |
| 369 | 3300053090 | Ga0500646_0004591 | Ga0500646_0004591_2138_3025 | 291 |
| 370 | 3300053133 | Ga0500655_002183 | Ga0500655_002183_1166_2053 | 291 |
| 371 | 3300053139 | Ga0500568_0013857 | Ga0500568_0013857_2357_3244 | 291 |
| 372 | 3300053151 | Ga0500604_0000701 | Ga0500604_0000701_6399_7286 | 291 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2xmz-assembly1.cif.gz_A | structure of menh from s. aureus | 0.9121 | 12 | 272 |
| 3om8-assembly1.cif.gz_B | the crystal structure of a hydrolase from pseudomonas aeruginosa pa01 | 0.9048 | 2 | 268 |
| 2xmz-assembly1.cif.gz_A | structure of menh from s. aureus | 0.8926 | 12 | 272 |
| 4uhd-assembly1.cif.gz_A | structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) | 0.8897 | 2 | 273 |
| 8b6p-assembly1.cif.gz_A | x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) | 0.8856 | 2 | 115 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1KMX1_1_216_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9502 | 2 | 115 | 3.40.50.1820 |
| af_A0A0R0KMM0_1_93_3.40.50.12270 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9111 | 2 | 87 | 3.40.50.12270 |
| af_Q2FZL6_1_267_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9092 | 10 | 273 | 3.40.50.1820 |
| af_Q15KI9_1423_1693_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9015 | 15 | 268 | 3.40.50.1820 |
| 3om8B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8991 | 2 | 268 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1K1SRM7-F1-model_v4 | Pimeloyl-ACP methyl ester carboxylesterase | 0.9893 | 1 | 290 |
GO:0016020
|
| AF-A0A1C7P5P5-F1-model_v4 | Alpha/beta hydrolase | 0.9889 | 2 | 283 |
GO:0016020
GO:0016787 |
| AF-A0A1Q7CFY0-F1-model_v4 | Alpha/beta hydrolase | 0.9885 | 1 | 291 |
GO:0016020
GO:0016787 |
| AF-A0A7W8DYH1-F1-model_v4 | Pimeloyl-ACP methyl ester carboxylesterase | 0.9875 | 1 | 287 |
GO:0016020
|
| AF-A0A1Q7CFY0-F1-model_v4 | Alpha/beta hydrolase | 0.9852 | 1 | 291 |
GO:0016020
GO:0016787 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar