F425872

General Info

Members Datasets Scaffolds Average Seq Length
371 202 371 138

Family's Representative Sequence

Representative Sequence 3300049577|Ga0501041_0632969|Ga0501041_0632969_152_655
Length 167
Sequence MELPNTSANTFGMIRINNTAWDLMVSHAKATYPNECCGAMLGSYDDGDRKIVAEAMALENSFAGPQAQRYELRPEDLLKAERAARDRGLDLIGIYHSHPDCDAYFSETDLKNSCPWYSFVVLSIRNGEFDHANSWLPNEEQTAAAKEELEYENGKGTHSHTAQAVRR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
62 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
65 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
95 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
103 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
104 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
106 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
107 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
125 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
137 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
138 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
148 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
149 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.89
Rhizosphere 92.45
Stem 0
Stem Tuber 0
Unclassified 5.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10070133 3300005327 Bacteria 2869
2 Ga0070683_100193227 3300005329 Bacteria 1933
3 Ga0070683_100357096 3300005329 Bacteria 1392
4 Ga0068869_100181099 3300005334 Unclassified 1652
5 Ga0068868_100514555 3300005338 Bacteria 1050
6 Ga0070669_101154777 3300005353 Unclassified 668
7 Ga0070671_100748434 3300005355 Unclassified 849
8 Ga0070667_100316348 3300005367 Archaea 1408
9 Ga0070667_100651392 3300005367 Bacteria 972
10 Ga0070667_101874138 3300005367 Unclassified 564
11 Ga0070709_10095660 3300005434 Bacteria 1968
12 Ga0070709_10628776 3300005434 Bacteria 829
13 Ga0070709_11736209 3300005434 Unclassified 510
14 Ga0070714_100001311 3300005435 Bacteria 17974
15 Ga0070713_100010539 3300005436 Bacteria 6682
16 Ga0070713_100085677 3300005436 Bacteria 2699
17 Ga0070713_100880230 3300005436 Unclassified 861
18 Ga0070710_10596603 3300005437 Bacteria 768
19 Ga0070711_100088534 3300005439 Bacteria 2225
20 Ga0070711_100751754 3300005439 Bacteria 824
21 Ga0070694_100430568 3300005444 Bacteria 1038
22 Ga0070678_100491912 3300005456 Bacteria 1081
23 Ga0070681_10096119 3300005458 Bacteria 2911
24 Ga0070681_10101231 3300005458 Bacteria 2826
25 Ga0070681_10159561 3300005458 Bacteria 2179
26 Ga0070681_10190187 3300005458 Bacteria 1972
27 Ga0070706_100397963 3300005467 Unclassified 1282
28 Ga0070699_100216798 3300005518 Bacteria 1705
29 Ga0070679_100039697 3300005530 Bacteria 4679
30 Ga0070679_100104648 3300005530 Bacteria 2816
31 Ga0070695_100070210 3300005545 Bacteria 2291
32 Ga0070696_100001017 3300005546 Bacteria 18135
33 Ga0070696_100678482 3300005546 Bacteria 838
34 Ga0070665_100048563 3300005548 Bacteria 4260
35 Ga0068855_100007831 3300005563 Bacteria 12909
36 Ga0068855_101104402 3300005563 Unclassified 829
37 Ga0068854_100661226 3300005578 Bacteria 898
38 Ga0068854_102094408 3300005578 Unclassified 522
39 Ga0068852_100068936 3300005616 Bacteria 3098
40 Ga0068859_101111363 3300005617 Unclassified 869
41 Ga0068859_101766347 3300005617 Unclassified 683
42 Ga0068864_100769039 3300005618 Bacteria 945
43 Ga0068864_102027319 3300005618 Bacteria 582
44 Ga0068863_100064466 3300005841 Unclassified 3465
45 Ga0068858_100260463 3300005842 Unclassified 1648
46 Ga0070717_10001670 3300006028 Bacteria 15434
47 Ga0070717_10049492 3300006028 Bacteria 3450
48 Ga0070716_100392138 3300006173 Bacteria 996
49 Ga0070712_100327626 3300006175 Bacteria 1247
50 Ga0070712_100469939 3300006175 Bacteria 1050
51 Ga0070712_101094004 3300006175 Bacteria 692
52 Ga0097621_100608652 3300006237 Bacteria 999
53 Ga0097621_101921763 3300006237 Bacteria 565
54 Ga0097621_102084664 3300006237 Unclassified 542
55 Ga0068871_101895939 3300006358 Unclassified 566
56 Ga0075430_100013661 3300006846 Bacteria 6924
57 Ga0075430_100816121 3300006846 Unclassified 769
58 Ga0075431_100055274 3300006847 Bacteria 4095
59 Ga0075433_11467242 3300006852 Unclassified 589
60 Ga0075434_100861691 3300006871 Bacteria 921
61 Ga0068865_101489511 3300006881 Bacteria 606
62 Ga0075436_100009133 3300006914 Bacteria 6780
63 Ga0097620_101111373 3300006931 Unclassified 869
64 Ga0097620_101766845 3300006931 Unclassified 683
65 Ga0075435_100409057 3300007076 Bacteria 1168
66 Ga0075435_100532959 3300007076 Bacteria 1016
67 Ga0105240_10007807 3300009093 Bacteria 15453
68 Ga0105240_10010677 3300009093 Bacteria 12887
69 Ga0105240_10025983 3300009093 Bacteria 7691
70 Ga0105240_10042747 3300009093 Bacteria 5772
71 Ga0105240_10047451 3300009093 Bacteria 5434
72 Ga0105240_11043701 3300009093 Bacteria 872
73 Ga0105240_11192007 3300009093 Bacteria 807
74 Ga0105240_12694778 3300009093 Unclassified 513
75 Ga0114129_10434015 3300009147 Bacteria 1725
76 Ga0105242_10165487 3300009176 Bacteria 1940
77 Ga0105248_10005309 3300009177 Bacteria 14181
78 Ga0105248_10596828 3300009177 Bacteria 1246
79 Ga0105248_10788529 3300009177 Bacteria 1072
80 Ga0105248_10907387 3300009177 Bacteria 995
81 Ga0105237_10013933 3300009545 Bacteria 8413
82 Ga0105237_10035009 3300009545 Bacteria 5081
83 Ga0105237_10078861 3300009545 Bacteria 3283
84 Ga0105237_10747087 3300009545 Bacteria 985
85 Ga0105237_10844856 3300009545 Archaea 922
86 Ga0105237_11378781 3300009545 Bacteria 711
87 Ga0105237_12292552 3300009545 Unclassified 550
88 Ga0105238_10052700 3300009551 Bacteria 4089
89 Ga0105238_10156344 3300009551 Bacteria 2255
90 Ga0105238_10439409 3300009551 Bacteria 1301
91 Ga0105238_11128630 3300009551 Unclassified 807
92 Ga0105249_12897675 3300009553 Unclassified 551
93 Ga0099796_10060893 3300010159 Unclassified 1337
94 Ga0105239_10046506 3300010375 Bacteria 4756
95 Ga0105239_10872210 3300010375 Unclassified 1033
96 Ga0105239_12589289 3300010375 Bacteria 591
97 Ga0157373_10296930 3300013100 Bacteria 1146
98 Ga0157370_10001584 3300013104 Bacteria 28151
99 Ga0157369_10007997 3300013105 Bacteria 12147
100 Ga0157369_10342064 3300013105 Bacteria 1554
101 Ga0157374_10539709 3300013296 Bacteria 1173
102 Ga0157374_11231735 3300013296 Unclassified 770
103 Ga0157378_10343533 3300013297 Unclassified 1456
104 Ga0157378_10922546 3300013297 Bacteria 905
105 Ga0163162_10886085 3300013306 Unclassified 1006
106 Ga0157372_10233728 3300013307 Bacteria 2132
107 Ga0157372_10632864 3300013307 Bacteria 1246
108 Ga0163163_10038728 3300014325 Unclassified 4647
109 Ga0163163_10092144 3300014325 Bacteria 3045
110 Ga0163163_10184532 3300014325 Bacteria 2134
111 Ga0163163_12853243 3300014325 Bacteria 539
112 Ga0157379_10052373 3300014968 Bacteria 3646
113 Ga0157376_10076252 3300014969 Bacteria 2864
114 Ga0157376_11410050 3300014969 Bacteria 728
115 Ga0206355_1546423 3300020076 Bacteria 1104
116 Ga0206352_11274927 3300020078 Bacteria 1487
117 Ga0213876_10031145 3300021384 Bacteria 2815
118 Ga0213876_10091530 3300021384 Bacteria 1611
119 Ga0213876_10412612 3300021384 Unclassified 718
120 Ga0213875_10000010 3300021388 Bacteria 370268
121 Ga0213875_10014357 3300021388 Bacteria 3864
122 Ga0213875_10184497 3300021388 Unclassified 980
123 Ga0224712_10193591 3300022467 Bacteria 921
124 Ga0207699_10819408 3300025906 Bacteria 685
125 Ga0207705_10012622 3300025909 Bacteria 6097
126 Ga0207705_10411790 3300025909 Bacteria 1046
127 Ga0207705_11005018 3300025909 Viruses 644
128 Ga0207705_11199877 3300025909 Unclassified 582
129 Ga0207684_10355949 3300025910 Unclassified 1260
130 Ga0207707_10015294 3300025912 Bacteria 6681
131 Ga0207707_10061214 3300025912 Bacteria 3276
132 Ga0207707_10923613 3300025912 Bacteria 720
133 Ga0207707_11249022 3300025912 Unclassified 599
134 Ga0207695_10001686 3300025913 Bacteria 35482
135 Ga0207695_10002790 3300025913 Bacteria 25427
136 Ga0207695_10020190 3300025913 Bacteria 7638
137 Ga0207695_10077632 3300025913 Bacteria 3372
138 Ga0207695_10137988 3300025913 Bacteria 2390
139 Ga0207695_11258132 3300025913 Unclassified 620
140 Ga0207671_10181244 3300025914 Bacteria 1639
141 Ga0207671_10331985 3300025914 Bacteria 1204
142 Ga0207671_10477929 3300025914 Bacteria 993
143 Ga0207663_10515779 3300025916 Bacteria 930
144 Ga0207660_10031164 3300025917 Bacteria 3669
145 Ga0207657_10338235 3300025919 Archaea 1188
146 Ga0207652_10094607 3300025921 Bacteria 2631
147 Ga0207652_10370912 3300025921 Bacteria 1292
148 Ga0207694_10315079 3300025924 Bacteria 1290
149 Ga0207694_10802699 3300025924 Bacteria 795
150 Ga0207694_11453481 3300025924 Bacteria 579
151 Ga0207700_10044157 3300025928 Bacteria 3279
152 Ga0207700_10070159 3300025928 Bacteria 2693
153 Ga0207700_10574159 3300025928 Bacteria 1002
154 Ga0207700_10587386 3300025928 Bacteria 991
155 Ga0207700_11084770 3300025928 Bacteria 716
156 Ga0207664_10020100 3300025929 Bacteria 4944
157 Ga0207664_10192298 3300025929 Bacteria 1757
158 Ga0207690_11244088 3300025932 Bacteria 622
159 Ga0207711_10948236 3300025941 Bacteria 799
160 Ga0207689_10114587 3300025942 Unclassified 2216
161 Ga0207661_10017631 3300025944 Bacteria 5289
162 Ga0207667_10006389 3300025949 Bacteria 14288
163 Ga0207667_10028388 3300025949 Bacteria 6078
164 Ga0207640_10610120 3300025981 Bacteria 925
165 Ga0207658_10212018 3300025986 Archaea 1624
166 Ga0207658_10420312 3300025986 Bacteria 1179
167 Ga0207658_10484291 3300025986 Bacteria 1100
168 Ga0207677_10364542 3300026023 Bacteria 1215
169 Ga0207677_10474685 3300026023 Unclassified 1076
170 Ga0207702_10148905 3300026078 Bacteria 2127
171 Ga0207702_10682475 3300026078 Unclassified 1011
172 Ga0207702_11397370 3300026078 Unclassified 694
173 Ga0207641_10249243 3300026088 Bacteria 1658
174 Ga0207641_10281555 3300026088 Archaea 1564
175 Ga0207676_10389751 3300026095 Bacteria 1299
176 Ga0207676_12239901 3300026095 Bacteria 544
177 Ga0207698_10031360 3300026142 Bacteria 3835
178 Ga0268266_10190611 3300028379 Bacteria 1872
179 Ga0268266_11240933 3300028379 Bacteria 721
180 Ga0265323_10000729 3300028653 Bacteria 17814
181 Ga0265338_10400369 3300028800 Bacteria 979
182 Ga0265330_10023325 3300031235 Bacteria 2811
183 Ga0265332_10067509 3300031238 Bacteria 1525
184 Ga0265325_10008411 3300031241 Bacteria 6093
185 Ga0265340_10135823 3300031247 Bacteria 1126
186 Ga0265331_10077367 3300031250 Bacteria 1550
187 Ga0265316_10045436 3300031344 Bacteria 3486
188 Ga0265316_10136137 3300031344 Bacteria 1848
189 Ga0265316_10154828 3300031344 Bacteria 1715
190 Ga0265316_10186904 3300031344 Bacteria 1541
191 Ga0265316_10194359 3300031344 Bacteria 1506
192 Ga0265316_10304902 3300031344 Bacteria 1159
193 Ga0265316_10826176 3300031344 Bacteria 649
194 Ga0307509_10906883 3300031507 Unclassified 546
195 Ga0265314_10022286 3300031711 Bacteria 4854
196 Ga0265342_10327455 3300031712 Bacteria 801
197 Ga0373934_0264626 3300035086 Unclassified 712
198 Ga0373923_0062326 3300035111 Bacteria 1586
199 Ga0373953_0047768 3300035117 Bacteria 1723
200 Ga0373954_0094619 3300035118 Bacteria 1438
201 Ga0373956_0239331 3300035119 Unclassified 863
202 Ga0373943_0148435 3300035170 Bacteria 1269
203 Ga0373943_0497279 3300035170 Bacteria 712
204 Ga0373946_0020372 3300035171 Bacteria 2563
205 Ga0373955_0750031 3300035172 Bacteria 600
206 Ga0373924_0345521 3300035410 Unclassified 663
207 Ga0373931_0177022 3300035691 Bacteria 1261
208 Ga0373935_0136169 3300035692 Bacteria 1655
209 Ga0373935_0558473 3300035692 Bacteria 835
210 Ga0373927_0005072 3300035695 Bacteria 9112
211 Ga0373927_0005236 3300035695 Bacteria 8974
212 Ga0373927_0086516 3300035695 Bacteria 2035
213 Ga0373927_0141203 3300035695 Bacteria 1576
214 Ga0373927_0162559 3300035695 Bacteria 1463
215 Ga0373927_0758547 3300035695 Unclassified 641
216 Ga0373933_0016567 3300035724 Bacteria 4124
217 Ga0373933_0289416 3300035724 Bacteria 1059
218 Ga0373933_0326722 3300035724 Unclassified 995
219 Ga0373933_0940887 3300035724 Unclassified 569
220 Ga0373947_0011939 3300035725 Bacteria 4976
221 Ga0373947_0037492 3300035725 Bacteria 2877
222 Ga0373947_0062387 3300035725 Bacteria 2268
223 Ga0373947_0285005 3300035725 Bacteria 1099
224 Ga0373937_0034424 3300036401 Bacteria 4608
225 Ga0373937_0231738 3300036401 Unclassified 1739
226 Ga0373937_0236658 3300036401 Bacteria 1720
227 Ga0373937_0809800 3300036401 Bacteria 885
228 Ga0373925_0001034 3300037068 Bacteria 25228
229 Ga0373925_0226347 3300037068 Bacteria 1494
230 Ga0373925_0531012 3300037068 Bacteria 967
231 Ga0373925_1171705 3300037068 Unclassified 632
232 Ga0395900_0644068 3300037418 Bacteria 997
233 Ga0395898_0060399 3300037466 Bacteria 3684
234 Ga0436364_0215683 3300037853 Unclassified 673
235 Ga0436364_0461685 3300037853 Bacteria 2712
236 Ga0436364_0612142 3300037853 Bacteria 18155
237 Ga0436364_0715998 3300037853 Unclassified 1256
238 Ga0436364_0852194 3300037853 Bacteria 4957
239 Ga0436365_0008373 3300039437 Bacteria 1605
240 Ga0436365_0995669 3300039437 Bacteria 4824
241 Ga0436365_1062155 3300039437 Bacteria 760
242 Ga0436365_1881556 3300039437 Bacteria 888
243 Ga0436363_0056823 3300039450 Bacteria 993
244 Ga0436363_0889766 3300039450 Bacteria 2618
245 Ga0436363_1180825 3300039450 Unclassified 689
246 Ga0436363_1588649 3300039450 Unclassified 849
247 Ga0436362_0091619 3300039453 Unclassified 1683
248 Ga0436362_0284621 3300039453 Unclassified 608
249 Ga0451833_1361737 3300041491 Unclassified 534
250 Ga0451577_0822310 3300042876 Bacteria 839
251 Ga0451577_1299056 3300042876 Bacteria 647
252 Ga0453683_0232653 3300044673 Bacteria 1173
253 Ga0453683_0417308 3300044673 Bacteria 866
254 Ga0453684_1742135 3300044712 Unclassified 635
255 Ga0466959_0448827 3300045049 Bacteria 874
256 Ga0451576_1106712 3300045051 Bacteria 829
257 Ga0451576_1419883 3300045051 Unclassified 722
258 Ga0466958_0317157 3300045836 Bacteria 1002
259 Ga0495592_0299888 3300046454 Unclassified 1045
260 Ga0495651_0334037 3300046462 Bacteria 1006
261 Ga0495580_0001940 3300046472 Bacteria 18176
262 Ga0495580_0006059 3300046472 Bacteria 9898
263 Ga0495580_0024237 3300046472 Bacteria 4445
264 Ga0495580_0436332 3300046472 Unclassified 880
265 Ga0495580_0787949 3300046472 Bacteria 617
266 Ga0495582_0203916 3300046473 Unclassified 1130
267 Ga0495639_0186385 3300046475 Bacteria 1012
268 Ga0495664_0034060 3300046477 Bacteria 2994
269 Ga0495618_0058883 3300046514 Bacteria 2434
270 Ga0495628_0245238 3300046516 Bacteria 1339
271 Ga0495628_0567702 3300046516 Bacteria 813
272 Ga0495630_0454227 3300046517 Bacteria 982
273 Ga0495630_1234291 3300046517 Bacteria 565
274 Ga0495652_0258123 3300046529 Bacteria 1288
275 Ga0495652_0324619 3300046529 Bacteria 1111
276 Ga0495665_0066584 3300046531 Bacteria 1901
277 Ga0495665_0184464 3300046531 Bacteria 1084
278 Ga0495645_0130587 3300046543 Bacteria 1761
279 Ga0495645_0148156 3300046543 Bacteria 1633
280 Ga0495645_0212066 3300046543 Bacteria 1307
281 Ga0495645_0256368 3300046543 Bacteria 1160
282 Ga0495645_0370951 3300046543 Bacteria 918
283 Ga0495645_0401387 3300046543 Unclassified 873
284 Ga0495667_0029356 3300046559 Bacteria 3702
285 Ga0495667_0090946 3300046559 Bacteria 1977
286 Ga0495667_0167612 3300046559 Bacteria 1412
287 Ga0495667_0189040 3300046559 Bacteria 1320
288 Ga0495635_0598251 3300046663 Unclassified 720
289 Ga0495635_0677729 3300046663 Bacteria 670
290 Ga0495599_0391977 3300046678 Unclassified 828
291 Ga0495599_0751236 3300046678 Unclassified 560
292 Ga0495623_0033935 3300046679 Bacteria 3274
293 Ga0495623_0105817 3300046679 Bacteria 1710
294 Ga0495646_0430821 3300046680 Unclassified 683
295 Ga0495669_0417333 3300046684 Bacteria 651
296 Ga0495613_0413454 3300046689 Bacteria 919
297 Ga0495613_0714596 3300046689 Unclassified 659
298 Ga0495600_0252658 3300046809 Bacteria 1121
299 Ga0495600_0404393 3300046809 Bacteria 849
300 Ga0495604_0213242 3300047317 Bacteria 1333
301 Ga0495604_0237774 3300047317 Bacteria 1247
302 Ga0495604_0476918 3300047317 Unclassified 812
303 Ga0495604_0864279 3300047317 Unclassified 567
304 Ga0495674_0012491 3300047319 Bacteria 8002
305 Ga0495674_0122604 3300047319 Bacteria 2195
306 Ga0495674_0188162 3300047319 Bacteria 1717
307 Ga0495674_0224551 3300047319 Bacteria 1552
308 Ga0495680_0199509 3300047322 Bacteria 1436
309 Ga0495675_0113740 3300047444 Bacteria 1688
310 Ga0495675_0671685 3300047444 Bacteria 582
311 Ga0495684_0009432 3300047471 Bacteria 7535
312 Ga0495684_0011691 3300047471 Bacteria 6776
313 Ga0495684_0026150 3300047471 Bacteria 4485
314 Ga0495684_0151877 3300047471 Bacteria 1731
315 Ga0495602_0345123 3300048088 Unclassified 1076
316 Ga0495602_0642295 3300048088 Bacteria 726
317 Ga0495602_0667815 3300048088 Bacteria 708
318 Ga0495602_1051467 3300048088 Bacteria 535
319 Ga0496105_0885664 3300048908 Bacteria 674
320 Ga0496110_1285023 3300048913 Bacteria 641
321 Ga0496112_0807249 3300048915 Bacteria 863
322 Ga0496112_0872886 3300048915 Bacteria 822
323 Ga0496113_0412516 3300048916 Bacteria 1085
324 Ga0496115_0212870 3300048918 Bacteria 1596
325 Ga0496115_0662155 3300048918 Bacteria 824
326 Ga0501031_0042225 3300049568 Bacteria 2977
327 Ga0501032_0018662 3300049569 Bacteria 4856
328 Ga0501033_0006644 3300049570 Bacteria 9044
329 Ga0501034_0019213 3300049571 Bacteria 6995
330 Ga0501036_0001048 3300049572 Bacteria 20896
331 Ga0501037_0006507 3300049573 Bacteria 8546
332 Ga0501038_0004876 3300049574 Bacteria 12462
333 Ga0501039_0019797 3300049575 Bacteria 5159
334 Ga0501041_0632969 3300049577 Viruses 683
335 Ga0501042_0099972 3300049578 Bacteria 2085
336 Ga0501043_0003466 3300049579 Bacteria 12956
337 Ga0501046_0001216 3300049580 Bacteria 24953
338 Ga0501047_0046044 3300049581 Bacteria 4217
339 Ga0501047_0076030 3300049581 Bacteria 3231
340 Ga0501047_0201598 3300049581 Bacteria 1851
341 Ga0501048_0560720 3300049582 Bacteria 820
342 Ga0501067_0028112 3300049583 Bacteria 3115
343 Ga0501068_0000115 3300049584 Bacteria 34788
344 Ga0501069_0005546 3300049585 Bacteria 6570
345 Ga0501070_0007505 3300049586 Bacteria 9264
346 Ga0501072_0000772 3300049588 Bacteria 23375
347 Ga0501073_0003337 3300049589 Bacteria 12065
348 Ga0501074_0025322 3300049590 Bacteria 4310
349 Ga0501075_1334302 3300049591 Unclassified 543
350 Ga0501076_0032509 3300049592 Bacteria 4072
351 Ga0501077_0002896 3300049593 Bacteria 10290
352 Ga0501079_0006363 3300049741 Bacteria 8864
353 Ga0501080_0000565 3300049742 Bacteria 29305
354 Ga0501083_0017380 3300049744 Bacteria 5014
355 Ga0501035_0049452 3300049822 Bacteria 3767
356 Ga0501035_1196529 3300049822 Viruses 590
357 Ga0501044_0006983 3300049823 Bacteria 12423
358 Ga0501044_0099727 3300049823 Bacteria 2922
359 Ga0501045_0841437 3300049824 Bacteria 675
360 nmdc:mga05p37_1972038_c1 3300050507 Bacteria 554
361 nmdc:mga0qj67_418221_c1 3300050509 Bacteria 1081
362 nmdc:mga0qj67_534498_c1 3300050509 Bacteria 941
363 nmdc:mga06r32_112463_c1 3300050510 Bacteria 2680
364 nmdc:mga0n895_2030469_c1 3300050512 Bacteria 532
365 nmdc:mga0n895_961706_c1 3300050512 Bacteria 837
366 nmdc:mga0rr50_654699_c1 3300050513 Bacteria 896
367 nmdc:mga08x19_1108_c1 3300050514 Bacteria 16801
368 nmdc:mga0a205_1108475_c1 3300050515 Unclassified 639
369 Ga0501084_0002226 3300054114 Bacteria 15578
370 Ga0501082_0042991 3300060353 Bacteria 3894
371 Ga0466962_0301673 3300061719 Bacteria 792

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041491 Ga0451833_1361737 Ga0451833_1361737_179_523 114
2 3300005434 Ga0070709_10095660 Ga0070709_100956602 124
3 3300005435 Ga0070714_100001311 Ga0070714_10000131113 124
4 3300005436 Ga0070713_100010539 Ga0070713_1000105394 124
5 3300005439 Ga0070711_100088534 Ga0070711_1000885342 124
6 3300025928 Ga0207700_10044157 Ga0207700_100441572 124
7 3300025929 Ga0207664_10192298 Ga0207664_101922982 124
8 3300049591 Ga0501075_1334302 Ga0501075_1334302_16_390 124
9 3300009545 Ga0105237_12292552 Ga0105237_122925521 127
10 3300035172 Ga0373955_0750031 Ga0373955_0750031_185_568 127
11 3300035724 Ga0373933_0289416 Ga0373933_0289416_654_1037 127
12 3300036401 Ga0373937_0809800 Ga0373937_0809800_24_407 127
13 3300037853 Ga0436364_0715998 Ga0436364_0715998_237_620 127
14 3300039437 Ga0436365_0008373 Ga0436365_0008373_292_675 127
15 3300046529 Ga0495652_0324619 Ga0495652_0324619_716_1099 127
16 3300046663 Ga0495635_0598251 Ga0495635_0598251_21_404 127
17 3300046678 Ga0495599_0751236 Ga0495599_0751236_153_536 127
18 3300046679 Ga0495623_0033935 Ga0495623_0033935_23_406 127
19 3300046679 Ga0495623_0105817 Ga0495623_0105817_1312_1695 127
20 3300009177 Ga0105248_10596828 Ga0105248_105968282 128
21 3300009553 Ga0105249_12897675 Ga0105249_128976751 128
22 3300035695 Ga0373927_0005236 Ga0373927_0005236_1317_1703 128
23 3300035724 Ga0373933_0940887 Ga0373933_0940887_12_398 128
24 3300035725 Ga0373947_0011939 Ga0373947_0011939_4184_4570 128
25 3300037068 Ga0373925_0001034 Ga0373925_0001034_18519_18905 128
26 3300037068 Ga0373925_1171705 Ga0373925_1171705_26_412 128
27 3300048908 Ga0496105_0885664 Ga0496105_0885664_266_652 128
28 3300048913 Ga0496110_1285023 Ga0496110_1285023_144_530 128
29 3300005434 Ga0070709_11736209 Ga0070709_117362091 135
30 3300005437 Ga0070710_10596603 Ga0070710_105966032 135
31 3300006028 Ga0070717_10001670 Ga0070717_1000167012 135
32 3300006173 Ga0070716_100392138 Ga0070716_1003921382 135
33 3300006175 Ga0070712_100469939 Ga0070712_1004699392 135
34 3300009093 Ga0105240_10042747 Ga0105240_100427475 135
35 3300009545 Ga0105237_10747087 Ga0105237_107470872 135
36 3300010159 Ga0099796_10060893 Ga0099796_100608932 135
37 3300021388 Ga0213875_10014357 Ga0213875_100143573 135
38 3300025913 Ga0207695_10077632 Ga0207695_100776322 135
39 3300025914 Ga0207671_10477929 Ga0207671_104779292 135
40 3300025916 Ga0207663_10515779 Ga0207663_105157792 135
41 3300025924 Ga0207694_10315079 Ga0207694_103150792 135
42 3300025928 Ga0207700_10574159 Ga0207700_105741592 135
43 3300025928 Ga0207700_11084770 Ga0207700_110847702 135
44 3300035111 Ga0373923_0062326 Ga0373923_0062326_591_998 135
45 3300035117 Ga0373953_0047768 Ga0373953_0047768_534_941 135
46 3300035118 Ga0373954_0094619 Ga0373954_0094619_228_635 135
47 3300035170 Ga0373943_0497279 Ga0373943_0497279_282_689 135
48 3300035410 Ga0373924_0345521 Ga0373924_0345521_121_528 135
49 3300035692 Ga0373935_0136169 Ga0373935_0136169_615_1022 135
50 3300035695 Ga0373927_0005072 Ga0373927_0005072_6982_7389 135
51 3300035695 Ga0373927_0086516 Ga0373927_0086516_1384_1791 135
52 3300035695 Ga0373927_0162559 Ga0373927_0162559_519_926 135
53 3300035724 Ga0373933_0016567 Ga0373933_0016567_524_931 135
54 3300035724 Ga0373933_0326722 Ga0373933_0326722_221_628 135
55 3300035725 Ga0373947_0037492 Ga0373947_0037492_502_909 135
56 3300035725 Ga0373947_0062387 Ga0373947_0062387_1288_1695 135
57 3300035725 Ga0373947_0285005 Ga0373947_0285005_658_1065 135
58 3300036401 Ga0373937_0034424 Ga0373937_0034424_3208_3615 135
59 3300036401 Ga0373937_0231738 Ga0373937_0231738_654_1061 135
60 3300037068 Ga0373925_0226347 Ga0373925_0226347_696_1103 135
61 3300037853 Ga0436364_0461685 Ga0436364_0461685_1803_2210 135
62 3300046462 Ga0495651_0334037 Ga0495651_0334037_222_629 135
63 3300046472 Ga0495580_0024237 Ga0495580_0024237_2629_3036 135
64 3300046517 Ga0495630_0454227 Ga0495630_0454227_61_468 135
65 3300046531 Ga0495665_0066584 Ga0495665_0066584_404_811 135
66 3300046543 Ga0495645_0370951 Ga0495645_0370951_345_752 135
67 3300046559 Ga0495667_0090946 Ga0495667_0090946_327_734 135
68 3300046689 Ga0495613_0413454 Ga0495613_0413454_191_598 135
69 3300046809 Ga0495600_0404393 Ga0495600_0404393_156_563 135
70 3300047319 Ga0495674_0122604 Ga0495674_0122604_441_848 135
71 3300047471 Ga0495684_0026150 Ga0495684_0026150_2911_3318 135
72 3300048088 Ga0495602_0642295 Ga0495602_0642295_301_708 135
73 3300048088 Ga0495602_1051467 Ga0495602_1051467_17_424 135
74 3300049568 Ga0501031_0042225 Ga0501031_0042225_1598_2005 135
75 3300049569 Ga0501032_0018662 Ga0501032_0018662_2127_2534 135
76 3300049570 Ga0501033_0006644 Ga0501033_0006644_1375_1782 135
77 3300049571 Ga0501034_0019213 Ga0501034_0019213_4595_5002 135
78 3300049572 Ga0501036_0001048 Ga0501036_0001048_18966_19373 135
79 3300049573 Ga0501037_0006507 Ga0501037_0006507_6765_7172 135
80 3300049574 Ga0501038_0004876 Ga0501038_0004876_9692_10099 135
81 3300049575 Ga0501039_0019797 Ga0501039_0019797_1855_2262 135
82 3300049578 Ga0501042_0099972 Ga0501042_0099972_1165_1572 135
83 3300049579 Ga0501043_0003466 Ga0501043_0003466_3412_3819 135
84 3300049580 Ga0501046_0001216 Ga0501046_0001216_11193_11600 135
85 3300049581 Ga0501047_0076030 Ga0501047_0076030_1491_1898 135
86 3300049583 Ga0501067_0028112 Ga0501067_0028112_1503_1910 135
87 3300049584 Ga0501068_0000115 Ga0501068_0000115_18967_19374 135
88 3300049585 Ga0501069_0005546 Ga0501069_0005546_1838_2245 135
89 3300049586 Ga0501070_0007505 Ga0501070_0007505_2125_2532 135
90 3300049588 Ga0501072_0000772 Ga0501072_0000772_20805_21212 135
91 3300049589 Ga0501073_0003337 Ga0501073_0003337_1375_1782 135
92 3300049590 Ga0501074_0025322 Ga0501074_0025322_1910_2317 135
93 3300049592 Ga0501076_0032509 Ga0501076_0032509_686_1093 135
94 3300049593 Ga0501077_0002896 Ga0501077_0002896_6397_6804 135
95 3300049741 Ga0501079_0006363 Ga0501079_0006363_1334_1741 135
96 3300049742 Ga0501080_0000565 Ga0501080_0000565_20677_21084 135
97 3300049744 Ga0501083_0017380 Ga0501083_0017380_2486_2893 135
98 3300049822 Ga0501035_0049452 Ga0501035_0049452_1619_2026 135
99 3300049823 Ga0501044_0099727 Ga0501044_0099727_394_801 135
100 3300054114 Ga0501084_0002226 Ga0501084_0002226_13670_14077 135
101 3300060353 Ga0501082_0042991 Ga0501082_0042991_1870_2277 135
102 3300035086 Ga0373934_0264626 Ga0373934_0264626_157_570 137
103 3300005329 Ga0070683_100357096 Ga0070683_1003570962 138
104 3300005338 Ga0068868_100514555 Ga0068868_1005145552 138
105 3300005355 Ga0070671_100748434 Ga0070671_1007484341 138
106 3300005367 Ga0070667_101874138 Ga0070667_1018741382 138
107 3300005434 Ga0070709_10628776 Ga0070709_106287762 138
108 3300005436 Ga0070713_100085677 Ga0070713_1000856773 138
109 3300005436 Ga0070713_100880230 Ga0070713_1008802302 138
110 3300005439 Ga0070711_100751754 Ga0070711_1007517542 138
111 3300005456 Ga0070678_100491912 Ga0070678_1004919122 138
112 3300005548 Ga0070665_100048563 Ga0070665_1000485632 138
113 3300005578 Ga0068854_102094408 Ga0068854_1020944081 138
114 3300005617 Ga0068859_101111363 Ga0068859_1011113632 138
115 3300005617 Ga0068859_101766347 Ga0068859_1017663472 138
116 3300005618 Ga0068864_100769039 Ga0068864_1007690392 138
117 3300005618 Ga0068864_102027319 Ga0068864_1020273191 138
118 3300006028 Ga0070717_10049492 Ga0070717_100494922 138
119 3300006358 Ga0068871_101895939 Ga0068871_1018959391 138
120 3300006881 Ga0068865_101489511 Ga0068865_1014895111 138
121 3300006931 Ga0097620_101111373 Ga0097620_1011113732 138
122 3300006931 Ga0097620_101766845 Ga0097620_1017668452 138
123 3300007076 Ga0075435_100532959 Ga0075435_1005329592 138
124 3300009093 Ga0105240_10007807 Ga0105240_100078076 138
125 3300009093 Ga0105240_10047451 Ga0105240_100474514 138
126 3300009093 Ga0105240_11192007 Ga0105240_111920072 138
127 3300009176 Ga0105242_10165487 Ga0105242_101654873 138
128 3300009177 Ga0105248_10005309 Ga0105248_100053092 138
129 3300009177 Ga0105248_10788529 Ga0105248_107885292 138
130 3300009177 Ga0105248_10907387 Ga0105248_109073872 138
131 3300009545 Ga0105237_10035009 Ga0105237_100350093 138
132 3300009545 Ga0105237_10844856 Ga0105237_108448562 138
133 3300009551 Ga0105238_10052700 Ga0105238_100527003 138
134 3300009551 Ga0105238_10156344 Ga0105238_101563442 138
135 3300009551 Ga0105238_10439409 Ga0105238_104394092 138
136 3300010375 Ga0105239_10046506 Ga0105239_100465066 138
137 3300013296 Ga0157374_10539709 Ga0157374_105397093 138
138 3300013296 Ga0157374_11231735 Ga0157374_112317352 138
139 3300014325 Ga0163163_10038728 Ga0163163_100387282 138
140 3300014325 Ga0163163_10092144 Ga0163163_100921443 138
141 3300014325 Ga0163163_10184532 Ga0163163_101845322 138
142 3300014325 Ga0163163_12853243 Ga0163163_128532431 138
143 3300014968 Ga0157379_10052373 Ga0157379_100523733 138
144 3300014969 Ga0157376_10076252 Ga0157376_100762523 138
145 3300014969 Ga0157376_11410050 Ga0157376_114100502 138
146 3300020078 Ga0206352_11274927 Ga0206352_112749271 138
147 3300021384 Ga0213876_10412612 Ga0213876_104126122 138
148 3300025906 Ga0207699_10819408 Ga0207699_108194082 138
149 3300025913 Ga0207695_10001686 Ga0207695_1000168620 138
150 3300025913 Ga0207695_10137988 Ga0207695_101379883 138
151 3300025913 Ga0207695_11258132 Ga0207695_112581322 138
152 3300025914 Ga0207671_10331985 Ga0207671_103319852 138
153 3300025924 Ga0207694_10802699 Ga0207694_108026992 138
154 3300025924 Ga0207694_11453481 Ga0207694_114534812 138
155 3300025928 Ga0207700_10070159 Ga0207700_100701593 138
156 3300025928 Ga0207700_10587386 Ga0207700_105873862 138
157 3300025941 Ga0207711_10948236 Ga0207711_109482361 138
158 3300025944 Ga0207661_10017631 Ga0207661_100176313 138
159 3300025986 Ga0207658_10484291 Ga0207658_104842912 138
160 3300026023 Ga0207677_10364542 Ga0207677_103645422 138
161 3300026023 Ga0207677_10474685 Ga0207677_104746853 138
162 3300026088 Ga0207641_10249243 Ga0207641_102492433 138
163 3300026095 Ga0207676_10389751 Ga0207676_103897512 138
164 3300026095 Ga0207676_12239901 Ga0207676_122399012 138
165 3300028379 Ga0268266_10190611 Ga0268266_101906112 138
166 3300028379 Ga0268266_11240933 Ga0268266_112409332 138
167 3300028800 Ga0265338_10400369 Ga0265338_104003692 138
168 3300031238 Ga0265332_10067509 Ga0265332_100675092 138
169 3300031247 Ga0265340_10135823 Ga0265340_101358232 138
170 3300031250 Ga0265331_10077367 Ga0265331_100773672 138
171 3300031344 Ga0265316_10045436 Ga0265316_100454363 138
172 3300031344 Ga0265316_10136137 Ga0265316_101361372 138
173 3300031344 Ga0265316_10186904 Ga0265316_101869042 138
174 3300031344 Ga0265316_10194359 Ga0265316_101943592 138
175 3300031344 Ga0265316_10304902 Ga0265316_103049022 138
176 3300031507 Ga0307509_10906883 Ga0307509_109068831 138
177 3300031711 Ga0265314_10022286 Ga0265314_100222865 138
178 3300035119 Ga0373956_0239331 Ga0373956_0239331_265_681 138
179 3300035170 Ga0373943_0148435 Ga0373943_0148435_144_560 138
180 3300035171 Ga0373946_0020372 Ga0373946_0020372_299_715 138
181 3300035691 Ga0373931_0177022 Ga0373931_0177022_200_616 138
182 3300035692 Ga0373935_0558473 Ga0373935_0558473_211_627 138
183 3300035695 Ga0373927_0141203 Ga0373927_0141203_202_618 138
184 3300035695 Ga0373927_0758547 Ga0373927_0758547_130_546 138
185 3300036401 Ga0373937_0236658 Ga0373937_0236658_423_839 138
186 3300037068 Ga0373925_0531012 Ga0373925_0531012_458_874 138
187 3300042876 Ga0451577_0822310 Ga0451577_0822310_145_561 138
188 3300045049 Ga0466959_0448827 Ga0466959_0448827_296_712 138
189 3300045051 Ga0451576_1106712 Ga0451576_1106712_110_526 138
190 3300046454 Ga0495592_0299888 Ga0495592_0299888_176_592 138
191 3300046472 Ga0495580_0001940 Ga0495580_0001940_5658_6074 138
192 3300046472 Ga0495580_0006059 Ga0495580_0006059_2930_3346 138
193 3300046472 Ga0495580_0436332 Ga0495580_0436332_404_820 138
194 3300046473 Ga0495582_0203916 Ga0495582_0203916_399_815 138
195 3300046475 Ga0495639_0186385 Ga0495639_0186385_493_909 138
196 3300046477 Ga0495664_0034060 Ga0495664_0034060_185_601 138
197 3300046514 Ga0495618_0058883 Ga0495618_0058883_488_904 138
198 3300046516 Ga0495628_0245238 Ga0495628_0245238_386_802 138
199 3300046516 Ga0495628_0567702 Ga0495628_0567702_196_612 138
200 3300046517 Ga0495630_1234291 Ga0495630_1234291_31_447 138
201 3300046529 Ga0495652_0258123 Ga0495652_0258123_67_483 138
202 3300046531 Ga0495665_0184464 Ga0495665_0184464_49_465 138
203 3300046543 Ga0495645_0130587 Ga0495645_0130587_446_862 138
204 3300046543 Ga0495645_0148156 Ga0495645_0148156_333_749 138
205 3300046543 Ga0495645_0212066 Ga0495645_0212066_783_1199 138
206 3300046543 Ga0495645_0256368 Ga0495645_0256368_92_508 138
207 3300046543 Ga0495645_0401387 Ga0495645_0401387_436_852 138
208 3300046559 Ga0495667_0029356 Ga0495667_0029356_852_1268 138
209 3300046559 Ga0495667_0167612 Ga0495667_0167612_272_688 138
210 3300046559 Ga0495667_0189040 Ga0495667_0189040_545_961 138
211 3300046678 Ga0495599_0391977 Ga0495599_0391977_59_475 138
212 3300046680 Ga0495646_0430821 Ga0495646_0430821_196_612 138
213 3300046684 Ga0495669_0417333 Ga0495669_0417333_80_496 138
214 3300046689 Ga0495613_0714596 Ga0495613_0714596_164_580 138
215 3300046809 Ga0495600_0252658 Ga0495600_0252658_664_1080 138
216 3300047317 Ga0495604_0213242 Ga0495604_0213242_186_602 138
217 3300047317 Ga0495604_0237774 Ga0495604_0237774_344_760 138
218 3300047317 Ga0495604_0476918 Ga0495604_0476918_50_466 138
219 3300047317 Ga0495604_0864279 Ga0495604_0864279_130_546 138
220 3300047319 Ga0495674_0012491 Ga0495674_0012491_2491_2907 138
221 3300047319 Ga0495674_0188162 Ga0495674_0188162_533_949 138
222 3300047319 Ga0495674_0224551 Ga0495674_0224551_847_1263 138
223 3300047322 Ga0495680_0199509 Ga0495680_0199509_636_1052 138
224 3300047444 Ga0495675_0113740 Ga0495675_0113740_237_653 138
225 3300047444 Ga0495675_0671685 Ga0495675_0671685_77_493 138
226 3300047471 Ga0495684_0009432 Ga0495684_0009432_6973_7389 138
227 3300047471 Ga0495684_0011691 Ga0495684_0011691_2121_2537 138
228 3300047471 Ga0495684_0151877 Ga0495684_0151877_233_649 138
229 3300048088 Ga0495602_0345123 Ga0495602_0345123_520_936 138
230 3300048088 Ga0495602_0667815 Ga0495602_0667815_73_489 138
231 3300048915 Ga0496112_0807249 Ga0496112_0807249_391_807 138
232 3300048915 Ga0496112_0872886 Ga0496112_0872886_127_543 138
233 3300048916 Ga0496113_0412516 Ga0496113_0412516_378_794 138
234 3300048918 Ga0496115_0662155 Ga0496115_0662155_268_684 138
235 3300050513 nmdc:mga0rr50_654699_c1 nmdc:mga0rr50_654699_c1_241_657 138
236 3300005353 Ga0070669_101154777 Ga0070669_1011547772 139
237 3300005444 Ga0070694_100430568 Ga0070694_1004305682 139
238 3300005458 Ga0070681_10159561 Ga0070681_101595612 139
239 3300005458 Ga0070681_10190187 Ga0070681_101901872 139
240 3300005518 Ga0070699_100216798 Ga0070699_1002167982 139
241 3300005530 Ga0070679_100039697 Ga0070679_1000396976 139
242 3300005545 Ga0070695_100070210 Ga0070695_1000702102 139
243 3300005546 Ga0070696_100001017 Ga0070696_10000101711 139
244 3300005546 Ga0070696_100678482 Ga0070696_1006784821 139
245 3300006175 Ga0070712_101094004 Ga0070712_1010940041 139
246 3300006237 Ga0097621_100608652 Ga0097621_1006086522 139
247 3300006846 Ga0075430_100816121 Ga0075430_1008161212 139
248 3300006914 Ga0075436_100009133 Ga0075436_1000091336 139
249 3300007076 Ga0075435_100409057 Ga0075435_1004090572 139
250 3300009545 Ga0105237_11378781 Ga0105237_113787812 139
251 3300010375 Ga0105239_12589289 Ga0105239_125892892 139
252 3300013297 Ga0157378_10922546 Ga0157378_109225462 139
253 3300025912 Ga0207707_10015294 Ga0207707_100152947 139
254 3300025912 Ga0207707_10061214 Ga0207707_100612142 139
255 3300025921 Ga0207652_10370912 Ga0207652_103709122 139
256 3300044673 Ga0453683_0417308 Ga0453683_0417308_248_667 139
257 3300044712 Ga0453684_1742135 Ga0453684_1742135_85_504 139
258 3300046472 Ga0495580_0787949 Ga0495580_0787949_34_453 139
259 3300050509 nmdc:mga0qj67_534498_c1 nmdc:mga0qj67_534498_c1_220_639 139
260 3300050512 nmdc:mga0n895_2030469_c1 nmdc:mga0n895_2030469_c1_92_511 139
261 3300050514 nmdc:mga08x19_1108_c1 nmdc:mga08x19_1108_c1_14786_15205 139
262 3300005334 Ga0068869_100181099 Ga0068869_1001810992 140
263 3300005367 Ga0070667_100316348 Ga0070667_1003163482 140
264 3300005458 Ga0070681_10096119 Ga0070681_100961194 140
265 3300005563 Ga0068855_101104402 Ga0068855_1011044022 140
266 3300005841 Ga0068863_100064466 Ga0068863_1000644664 140
267 3300005842 Ga0068858_100260463 Ga0068858_1002604632 140
268 3300006237 Ga0097621_101921763 Ga0097621_1019217631 140
269 3300009093 Ga0105240_10010677 Ga0105240_100106778 140
270 3300009545 Ga0105237_10013933 Ga0105237_100139334 140
271 3300013297 Ga0157378_10343533 Ga0157378_103435333 140
272 3300025912 Ga0207707_11249022 Ga0207707_112490222 140
273 3300025913 Ga0207695_10002790 Ga0207695_1000279019 140
274 3300025942 Ga0207689_10114587 Ga0207689_101145873 140
275 3300025986 Ga0207658_10212018 Ga0207658_102120183 140
276 3300026088 Ga0207641_10281555 Ga0207641_102815552 140
277 3300048918 Ga0496115_0212870 Ga0496115_0212870_24_446 140
278 3300005327 Ga0070658_10070133 Ga0070658_100701333 141
279 3300005329 Ga0070683_100193227 Ga0070683_1001932272 141
280 3300005367 Ga0070667_100651392 Ga0070667_1006513922 141
281 3300005458 Ga0070681_10101231 Ga0070681_101012313 141
282 3300005467 Ga0070706_100397963 Ga0070706_1003979632 141
283 3300005530 Ga0070679_100104648 Ga0070679_1001046483 141
284 3300005563 Ga0068855_100007831 Ga0068855_10000783111 141
285 3300005578 Ga0068854_100661226 Ga0068854_1006612262 141
286 3300005616 Ga0068852_100068936 Ga0068852_1000689363 141
287 3300006175 Ga0070712_100327626 Ga0070712_1003276262 141
288 3300006237 Ga0097621_102084664 Ga0097621_1020846642 141
289 3300006846 Ga0075430_100013661 Ga0075430_1000136617 141
290 3300006847 Ga0075431_100055274 Ga0075431_1000552744 141
291 3300006852 Ga0075433_11467242 Ga0075433_114672422 141
292 3300006871 Ga0075434_100861691 Ga0075434_1008616912 141
293 3300009093 Ga0105240_10025983 Ga0105240_100259838 141
294 3300009093 Ga0105240_11043701 Ga0105240_110437012 141
295 3300009093 Ga0105240_12694778 Ga0105240_126947781 141
296 3300009147 Ga0114129_10434015 Ga0114129_104340152 141
297 3300009545 Ga0105237_10078861 Ga0105237_100788614 141
298 3300009551 Ga0105238_11128630 Ga0105238_111286302 141
299 3300010375 Ga0105239_10872210 Ga0105239_108722102 141
300 3300013100 Ga0157373_10296930 Ga0157373_102969302 141
301 3300013104 Ga0157370_10001584 Ga0157370_100015847 141
302 3300013105 Ga0157369_10007997 Ga0157369_100079975 141
303 3300013105 Ga0157369_10342064 Ga0157369_103420642 141
304 3300013306 Ga0163162_10886085 Ga0163162_108860852 141
305 3300013307 Ga0157372_10233728 Ga0157372_102337282 141
306 3300013307 Ga0157372_10632864 Ga0157372_106328642 141
307 3300020076 Ga0206355_1546423 Ga0206355_15464232 141
308 3300021384 Ga0213876_10031145 Ga0213876_100311452 141
309 3300021384 Ga0213876_10091530 Ga0213876_100915302 141
310 3300021388 Ga0213875_10000010 Ga0213875_1000001045 141
311 3300021388 Ga0213875_10184497 Ga0213875_101844972 141
312 3300022467 Ga0224712_10193591 Ga0224712_101935912 141
313 3300025909 Ga0207705_10012622 Ga0207705_100126226 141
314 3300025909 Ga0207705_10411790 Ga0207705_104117902 141
315 3300025909 Ga0207705_11005018 Ga0207705_110050181 141
316 3300025909 Ga0207705_11199877 Ga0207705_111998771 141
317 3300025910 Ga0207684_10355949 Ga0207684_103559492 141
318 3300025912 Ga0207707_10923613 Ga0207707_109236132 141
319 3300025913 Ga0207695_10020190 Ga0207695_100201907 141
320 3300025914 Ga0207671_10181244 Ga0207671_101812441 141
321 3300025917 Ga0207660_10031164 Ga0207660_100311643 141
322 3300025919 Ga0207657_10338235 Ga0207657_103382352 141
323 3300025921 Ga0207652_10094607 Ga0207652_100946073 141
324 3300025929 Ga0207664_10020100 Ga0207664_100201003 141
325 3300025932 Ga0207690_11244088 Ga0207690_112440881 141
326 3300025949 Ga0207667_10006389 Ga0207667_100063893 141
327 3300025949 Ga0207667_10028388 Ga0207667_100283886 141
328 3300025981 Ga0207640_10610120 Ga0207640_106101202 141
329 3300025986 Ga0207658_10420312 Ga0207658_104203122 141
330 3300026078 Ga0207702_10148905 Ga0207702_101489053 141
331 3300026078 Ga0207702_10682475 Ga0207702_106824752 141
332 3300026078 Ga0207702_11397370 Ga0207702_113973702 141
333 3300026142 Ga0207698_10031360 Ga0207698_100313602 141
334 3300028653 Ga0265323_10000729 Ga0265323_1000072912 141
335 3300031235 Ga0265330_10023325 Ga0265330_100233254 141
336 3300031241 Ga0265325_10008411 Ga0265325_100084112 141
337 3300031344 Ga0265316_10154828 Ga0265316_101548282 141
338 3300031344 Ga0265316_10826176 Ga0265316_108261762 141
339 3300031712 Ga0265342_10327455 Ga0265342_103274552 141
340 3300037418 Ga0395900_0644068 Ga0395900_0644068_437_862 141
341 3300037466 Ga0395898_0060399 Ga0395898_0060399_415_840 141
342 3300037853 Ga0436364_0215683 Ga0436364_0215683_51_476 141
343 3300037853 Ga0436364_0612142 Ga0436364_0612142_13884_14309 141
344 3300037853 Ga0436364_0852194 Ga0436364_0852194_4378_4803 141
345 3300039437 Ga0436365_0995669 Ga0436365_0995669_1759_2184 141
346 3300039437 Ga0436365_1062155 Ga0436365_1062155_43_468 141
347 3300039437 Ga0436365_1881556 Ga0436365_1881556_339_764 141
348 3300039450 Ga0436363_0056823 Ga0436363_0056823_342_767 141
349 3300039450 Ga0436363_0889766 Ga0436363_0889766_637_1062 141
350 3300039450 Ga0436363_1180825 Ga0436363_1180825_246_671 141
351 3300039450 Ga0436363_1588649 Ga0436363_1588649_84_509 141
352 3300039453 Ga0436362_0091619 Ga0436362_0091619_765_1190 141
353 3300039453 Ga0436362_0284621 Ga0436362_0284621_119_544 141
354 3300042876 Ga0451577_1299056 Ga0451577_1299056_193_618 141
355 3300044673 Ga0453683_0232653 Ga0453683_0232653_429_854 141
356 3300045051 Ga0451576_1419883 Ga0451576_1419883_216_659 141
357 3300045836 Ga0466958_0317157 Ga0466958_0317157_411_836 141
358 3300046663 Ga0495635_0677729 Ga0495635_0677729_135_560 141
359 3300049577 Ga0501041_0632969 Ga0501041_0632969_152_655 141
360 3300049581 Ga0501047_0046044 Ga0501047_0046044_2995_3420 141
361 3300049581 Ga0501047_0201598 Ga0501047_0201598_506_931 141
362 3300049582 Ga0501048_0560720 Ga0501048_0560720_154_579 141
363 3300049822 Ga0501035_1196529 Ga0501035_1196529_100_525 141
364 3300049823 Ga0501044_0006983 Ga0501044_0006983_10777_11202 141
365 3300049824 Ga0501045_0841437 Ga0501045_0841437_45_470 141
366 3300050507 nmdc:mga05p37_1972038_c1 nmdc:mga05p37_1972038_c1_91_528 141
367 3300050509 nmdc:mga0qj67_418221_c1 nmdc:mga0qj67_418221_c1_148_585 141
368 3300050510 nmdc:mga06r32_112463_c1 nmdc:mga06r32_112463_c1_718_1155 141
369 3300050512 nmdc:mga0n895_961706_c1 nmdc:mga0n895_961706_c1_109_534 141
370 3300050515 nmdc:mga0a205_1108475_c1 nmdc:mga0a205_1108475_c1_106_531 141
371 3300061719 Ga0466962_0301673 Ga0466962_0301673_312_737 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14464

Prok-JAB

Prokaryotic homologs of the JAB domain

18

138

0.83

PF01398

JAB

JAB1/Mov34/MPN/PAD-1 ubiquitin protease

9

117

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kks-assembly1.cif.gz_A solution structure of protein dsy2949 from desulfitobacterium hafniense. northeast structural genomics consortium target dhr27 0.854 1 141
1oi0-assembly1.cif.gz_A crystal structure of af2198, a jab1/mpn domain protein from archaeoglobus fulgidus 0.8385 2 139
2kks-assembly1.cif.gz_A solution structure of protein dsy2949 from desulfitobacterium hafniense. northeast structural genomics consortium target dhr27 0.8319 1 141
1oi0-assembly3.cif.gz_C crystal structure of af2198, a jab1/mpn domain protein from archaeoglobus fulgidus 0.8301 1 140
6h3c-assembly1.cif.gz_G cryo-em structure of the brisc complex bound to shmt2 0.812 2 141
ID Description Score Start End Superfamily
2kksA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.854 1 141 3.40.140.10
af_Q55FM0_2_113_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.833 2 85 3.40.140.10
2kksA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8319 1 141 3.40.140.10
af_A0A0R4IER2_1_165_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8085 2 139 3.40.140.10
af_P9WHS1_10_146_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.7983 4 141 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A7H4NKM8-F1-model_v4 deleted 0.9775 78 135
AF-A0A1F2RPD5-F1-model_v4 JAB domain-containing protein 0.9631 58 136 GO:0006508
GO:0008235
GO:0008270
AF-A0A3D4JCX9-F1-model_v4 JAB domain-containing protein 0.9613 82 137 GO:0006508
GO:0008235
GO:0008270
AF-A0A6P1UUM6-F1-model_v4 M67 family metallopeptidase 0.9568 1 139 GO:0006508
GO:0008235
GO:0008270
AF-A0A2V9C5G2-F1-model_v4 MPN domain-containing protein 0.956 1 139 GO:0006508
GO:0008235
GO:0008270

Feature Viewer

pLDDT pTM Quality
86.37 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map