F425801

General Info

Members Datasets Scaffolds Average Seq Length
371 165 742 151

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0303580|Ga0395899_0303580_278_820
Length 180
Sequence VDVEALQRCDVIGGDASLLDRFNGLTRLVFNVVLVEPEIPPNTGNVGRLCLATRSTLHLVGPLGFSLGDRQLKRAGLDYWDEVDVREWSSLDELQGANASARFFYLTTKAKQPYFDVAFQAKDFLVFGRETKGLPERVLKENRESCITIPMHGTRSLNLATAVAIVLFEAVRQQRAGGRR

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
135 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
145 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
146 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
149 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.2
Rhizosphere 93.8
Stem 0
Stem Tuber 0
Unclassified 23.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0303580 3300037312 Bacteria 1080
2 JGI24035J26624_1007305 3300002126 Bacteria 1073
3 JGI25405J52794_10000076 3300003911 Bacteria 10773
4 JGI25405J52794_10007676 3300003911 Unclassified 1995
5 JGI25405J52794_10067173 3300003911 Bacteria 780
6 Ga0065704_10039782 3300005289 Bacteria 1102
7 Ga0065704_10084849 3300005289 Bacteria 3288
8 Ga0065712_10006191 3300005290 Bacteria 3318
9 Ga0065712_10009043 3300005290 Unclassified 2287
10 Ga0065712_10013268 3300005290 Bacteria 3038
11 Ga0065712_10112111 3300005290 Unclassified 1805
12 Ga0065712_10125422 3300005290 Bacteria 1614
13 Ga0065712_10157472 3300005290 Bacteria 1325
14 Ga0065715_10002403 3300005293 Bacteria 7364
15 Ga0065715_10074734 3300005293 Bacteria 696
16 Ga0065715_10093205 3300005293 Unclassified 4769
17 Ga0065715_10114904 3300005293 Bacteria 2434
18 Ga0065707_10024551 3300005295 Bacteria 1306
19 Ga0070676_10001748 3300005328 Bacteria 11050
20 Ga0070676_10115255 3300005328 Bacteria 1679
21 Ga0070676_10123505 3300005328 Unclassified 1628
22 Ga0070690_100160425 3300005330 Bacteria 1540
23 Ga0070670_100975418 3300005331 Unclassified 770
24 Ga0070666_10122306 3300005335 Bacteria 1805
25 Ga0070666_10157677 3300005335 Bacteria 1585
26 Ga0070666_10904028 3300005335 Unclassified 653
27 Ga0068868_100011494 3300005338 Bacteria 6447
28 Ga0070660_100608116 3300005339 Unclassified 914
29 Ga0070689_100574245 3300005340 Unclassified 974
30 Ga0070687_100000356 3300005343 Bacteria 15574
31 Ga0070661_101676657 3300005344 Unclassified 538
32 Ga0070661_101691693 3300005344 Unclassified 536
33 Ga0070668_100058976 3300005347 Bacteria 2971
34 Ga0070668_100069310 3300005347 Bacteria 2743
35 Ga0070668_100216801 3300005347 Unclassified 1577
36 Ga0070668_101497279 3300005347 Unclassified 617
37 Ga0070669_100029629 3300005353 Bacteria 3946
38 Ga0070669_100547383 3300005353 Unclassified 964
39 Ga0070675_100007595 3300005354 Bacteria 8389
40 Ga0070675_100084661 3300005354 Bacteria 2648
41 Ga0070675_100169779 3300005354 Bacteria 1880
42 Ga0070675_100715059 3300005354 Bacteria 913
43 Ga0070671_100019197 3300005355 Bacteria 5561
44 Ga0070671_100217116 3300005355 Bacteria 1622
45 Ga0070674_100083109 3300005356 Bacteria 2292
46 Ga0070673_100069160 3300005364 Bacteria 2829
47 Ga0070673_100134183 3300005364 Bacteria 2081
48 Ga0070673_100404762 3300005364 Bacteria 1221
49 Ga0070673_100412293 3300005364 Bacteria 1210
50 Ga0070688_100364585 3300005365 Bacteria 1061
51 Ga0070688_100608680 3300005365 Unclassified 837
52 Ga0070659_100051371 3300005366 Unclassified 3241
53 Ga0070667_100022315 3300005367 Bacteria 5251
54 Ga0070667_100061745 3300005367 Bacteria 3173
55 Ga0070667_101429728 3300005367 Unclassified 649
56 Ga0070709_10024292 3300005434 Bacteria 3566
57 Ga0070709_10132770 3300005434 Bacteria 1701
58 Ga0070714_100081830 3300005435 Bacteria 2812
59 Ga0070713_100382409 3300005436 Bacteria 1312
60 Ga0070713_100875040 3300005436 Bacteria 863
61 Ga0070713_100878641 3300005436 Bacteria 862
62 Ga0070713_101111995 3300005436 Unclassified 764
63 Ga0070711_100030844 3300005439 Bacteria 3554
64 Ga0070711_100534007 3300005439 Bacteria 971
65 Ga0070711_101049452 3300005439 Unclassified 701
66 Ga0070705_100191650 3300005440 Bacteria 1394
67 Ga0070708_100042690 3300005445 Bacteria 3983
68 Ga0070708_100053898 3300005445 Bacteria 3570
69 Ga0070708_100107801 3300005445 Bacteria 2558
70 Ga0070708_100123799 3300005445 Bacteria 2388
71 Ga0070708_100356288 3300005445 Bacteria 1379
72 Ga0070708_100490377 3300005445 Bacteria 1159
73 Ga0070708_100950559 3300005445 Bacteria 806
74 Ga0070678_100070333 3300005456 Bacteria 2616
75 Ga0070678_100141372 3300005456 Bacteria 1926
76 Ga0070662_100003266 3300005457 Bacteria 10089
77 Ga0070662_100170301 3300005457 Bacteria 1710
78 Ga0070662_101640045 3300005457 Unclassified 555
79 Ga0068867_101694223 3300005459 Bacteria 593
80 Ga0070685_10063847 3300005466 Bacteria 2163
81 Ga0070685_10183051 3300005466 Bacteria 1350
82 Ga0070706_100034594 3300005467 Bacteria 4667
83 Ga0070706_100264348 3300005467 Unclassified 1606
84 Ga0070706_100532362 3300005467 Bacteria 1093
85 Ga0070706_100547050 3300005467 Bacteria 1077
86 Ga0070706_100688700 3300005467 Bacteria 948
87 Ga0070707_100002660 3300005468 Bacteria 16976
88 Ga0070707_100068520 3300005468 Bacteria 3416
89 Ga0070707_100134881 3300005468 Bacteria 2401
90 Ga0070707_100228049 3300005468 Unclassified 1814
91 Ga0070707_100288977 3300005468 Bacteria 1593
92 Ga0070707_100960203 3300005468 Bacteria 820
93 Ga0070707_101479042 3300005468 Bacteria 646
94 Ga0070698_100008629 3300005471 Bacteria 10984
95 Ga0070699_100057688 3300005518 Bacteria 3363
96 Ga0070684_100572392 3300005535 Bacteria 1049
97 Ga0070684_100745745 3300005535 Bacteria 914
98 Ga0070697_100003890 3300005536 Bacteria 11467
99 Ga0070697_100021832 3300005536 Bacteria 5075
100 Ga0070697_100067959 3300005536 Bacteria 2916
101 Ga0070697_100446219 3300005536 Bacteria 1127
102 Ga0070697_100483360 3300005536 Bacteria 1082
103 Ga0070697_100501179 3300005536 Bacteria 1062
104 Ga0070696_100420883 3300005546 Unclassified 1049
105 Ga0070693_100191535 3300005547 Bacteria 1323
106 Ga0070665_100143656 3300005548 Bacteria 2390
107 Ga0068857_100656852 3300005577 Unclassified 994
108 Ga0068856_100782086 3300005614 Bacteria 974
109 Ga0068856_101481261 3300005614 Bacteria 693
110 Ga0068861_100041839 3300005719 Bacteria 3433
111 Ga0068861_100404830 3300005719 Bacteria 1212
112 Ga0068863_100005260 3300005841 Bacteria 12779
113 Ga0068863_100194671 3300005841 Bacteria 1949
114 Ga0068863_101547043 3300005841 Unclassified 672
115 Ga0068863_102182552 3300005841 Unclassified 564
116 Ga0068858_101368038 3300005842 Bacteria 697
117 Ga0068860_100031825 3300005843 Bacteria 5072
118 Ga0068862_100056102 3300005844 Unclassified 3374
119 Ga0068862_100648762 3300005844 Bacteria 1018
120 Ga0081455_10000920 3300005937 Bacteria 37814
121 Ga0081455_10004503 3300005937 Bacteria 15580
122 Ga0081455_10008179 3300005937 Bacteria 10910
123 Ga0081455_10015032 3300005937 Bacteria 7539
124 Ga0081455_10044957 3300005937 Unclassified 3846
125 Ga0081455_10591179 3300005937 Unclassified 725
126 Ga0081538_10053415 3300005981 Bacteria 2402
127 Ga0081540_1000223 3300005983 Bacteria 59812
128 Ga0081539_10000671 3300005985 Bacteria 68678
129 Ga0081539_10040389 3300005985 Bacteria 2739
130 Ga0081539_10127427 3300005985 Unclassified 1255
131 Ga0070717_10012975 3300006028 Bacteria 6365
132 Ga0070717_10307844 3300006028 Bacteria 1409
133 Ga0070717_10437498 3300006028 Bacteria 1177
134 Ga0070715_10035083 3300006163 Bacteria 2061
135 Ga0070715_10944740 3300006163 Unclassified 533
136 Ga0070716_100248916 3300006173 Unclassified 1209
137 Ga0070716_100720363 3300006173 Bacteria 764
138 Ga0070716_100923992 3300006173 Bacteria 685
139 Ga0070712_100022562 3300006175 Bacteria 4148
140 Ga0070712_100032858 3300006175 Unclassified 3506
141 Ga0070712_100038640 3300006175 Bacteria 3263
142 Ga0070712_100065539 3300006175 Unclassified 2578
143 Ga0070712_100439363 3300006175 Unclassified 1084
144 Ga0070712_100886127 3300006175 Bacteria 769
145 Ga0070712_101497317 3300006175 Bacteria 590
146 Ga0070712_101687058 3300006175 Unclassified 554
147 Ga0097621_101682001 3300006237 Bacteria 604
148 Ga0068871_100308676 3300006358 Bacteria 1390
149 Ga0075428_100627737 3300006844 Bacteria 1147
150 Ga0075434_100340133 3300006871 Bacteria 1521
151 Ga0075434_100774702 3300006871 Bacteria 976
152 Ga0075436_100077721 3300006914 Bacteria 2299
153 Ga0099795_10047179 3300007788 Bacteria 1555
154 Ga0105240_10251692 3300009093 Bacteria 2043
155 Ga0105245_10009284 3300009098 Bacteria 8576
156 Ga0105245_10175193 3300009098 Bacteria 2045
157 Ga0105245_10351720 3300009098 Bacteria 1460
158 Ga0105245_10432078 3300009098 Bacteria 1322
159 Ga0105247_10229236 3300009101 Bacteria 1261
160 Ga0114129_10318949 3300009147 Bacteria 2066
161 Ga0114129_10732540 3300009147 Bacteria 1267
162 Ga0114129_12117689 3300009147 Bacteria 678
163 Ga0105243_10070112 3300009148 Unclassified 2829
164 Ga0105242_10375705 3300009176 Bacteria 1320
165 Ga0105237_11547501 3300009545 Bacteria 670
166 Ga0105249_10004459 3300009553 Bacteria 12104
167 Ga0105249_10836809 3300009553 Bacteria 985
168 Ga0099796_10037991 3300010159 Bacteria 1613
169 Ga0105239_10152824 3300010375 Bacteria 2576
170 Ga0105246_10946556 3300011119 Bacteria 776
171 Ga0157315_1020656 3300012508 Unclassified 693
172 Ga0157371_10071007 3300013102 Unclassified 2465
173 Ga0157374_10030793 3300013296 Bacteria 4874
174 Ga0157374_10067678 3300013296 Bacteria 3358
175 Ga0157374_10105316 3300013296 Bacteria 2709
176 Ga0157374_10299310 3300013296 Bacteria 1591
177 Ga0157374_10419959 3300013296 Bacteria 1336
178 Ga0157374_10688584 3300013296 Bacteria 1035
179 Ga0157374_11227815 3300013296 Bacteria 771
180 Ga0157374_12547415 3300013296 Unclassified 539
181 Ga0157378_10012365 3300013297 Bacteria 7475
182 Ga0157378_10025513 3300013297 Bacteria 5203
183 Ga0157378_10155294 3300013297 Bacteria 2136
184 Ga0157378_10162041 3300013297 Bacteria 2092
185 Ga0157378_10328829 3300013297 Bacteria 1487
186 Ga0157378_10345324 3300013297 Bacteria 1452
187 Ga0157378_10443236 3300013297 Bacteria 1287
188 Ga0157378_10547737 3300013297 Bacteria 1162
189 Ga0157378_11064694 3300013297 Unclassified 845
190 Ga0163162_10019896 3300013306 Bacteria 6593
191 Ga0163162_10023572 3300013306 Bacteria 6076
192 Ga0163162_10227567 3300013306 Unclassified 1995
193 Ga0163162_10331768 3300013306 Bacteria 1654
194 Ga0163162_10380200 3300013306 Unclassified 1545
195 Ga0157372_10017387 3300013307 Bacteria 7718
196 Ga0157372_10070229 3300013307 Bacteria 3940
197 Ga0157372_10083095 3300013307 Bacteria 3627
198 Ga0157372_13020786 3300013307 Unclassified 538
199 Ga0157375_10047173 3300013308 Bacteria 4205
200 Ga0157375_10214446 3300013308 Bacteria 2083
201 Ga0157375_10283631 3300013308 Bacteria 1819
202 Ga0157375_10343919 3300013308 Bacteria 1657
203 Ga0163163_10086107 3300014325 Bacteria 3151
204 Ga0157377_10298988 3300014745 Unclassified 1061
205 Ga0157377_10575545 3300014745 Bacteria 799
206 Ga0157376_10075481 3300014969 Bacteria 2877
207 Ga0157376_10086960 3300014969 Unclassified 2696
208 Ga0157376_10548742 3300014969 Bacteria 1143
209 Ga0163161_10076654 3300017792 Bacteria 2454
210 Ga0207666_1005424 3300025271 Bacteria 1629
211 Ga0207673_1027407 3300025290 Bacteria 783
212 Ga0207697_10000300 3300025315 Bacteria 27618
213 Ga0207697_10005467 3300025315 Bacteria 5902
214 Ga0207697_10031055 3300025315 Bacteria 2186
215 Ga0207697_10044665 3300025315 Bacteria 1823
216 Ga0207697_10104398 3300025315 Bacteria 1210
217 Ga0207692_10144424 3300025898 Unclassified 1356
218 Ga0207688_10040874 3300025901 Bacteria 2577
219 Ga0207688_10055409 3300025901 Bacteria 2225
220 Ga0207688_10128908 3300025901 Bacteria 1482
221 Ga0207647_10390023 3300025904 Unclassified 785
222 Ga0207685_10070263 3300025905 Unclassified 1417
223 Ga0207685_10130282 3300025905 Unclassified 1115
224 Ga0207699_10039844 3300025906 Bacteria 2703
225 Ga0207699_10231529 3300025906 Bacteria 1266
226 Ga0207699_10747462 3300025906 Unclassified 717
227 Ga0207645_10004134 3300025907 Bacteria 10796
228 Ga0207645_10018969 3300025907 Unclassified 4517
229 Ga0207645_10049635 3300025907 Bacteria 2679
230 Ga0207645_10741795 3300025907 Unclassified 668
231 Ga0207705_10191275 3300025909 Bacteria 1548
232 Ga0207684_10212670 3300025910 Unclassified 1668
233 Ga0207684_10316862 3300025910 Bacteria 1344
234 Ga0207684_10333642 3300025910 Bacteria 1306
235 Ga0207684_10389300 3300025910 Unclassified 1199
236 Ga0207684_10895490 3300025910 Bacteria 746
237 Ga0207695_10491438 3300025913 Bacteria 1109
238 Ga0207693_10040257 3300025915 Unclassified 3681
239 Ga0207693_10051669 3300025915 Bacteria 3225
240 Ga0207693_10073756 3300025915 Unclassified 2672
241 Ga0207693_10317808 3300025915 Unclassified 1219
242 Ga0207693_10383247 3300025915 Bacteria 1100
243 Ga0207693_10533370 3300025915 Bacteria 916
244 Ga0207693_11347182 3300025915 Unclassified 532
245 Ga0207663_10043433 3300025916 Bacteria 2752
246 Ga0207663_10407385 3300025916 Bacteria 1041
247 Ga0207663_11049599 3300025916 Unclassified 654
248 Ga0207663_11225193 3300025916 Bacteria 604
249 Ga0207662_10000538 3300025918 Bacteria 16805
250 Ga0207657_10284963 3300025919 Bacteria 1311
251 Ga0207646_10002870 3300025922 Bacteria 20003
252 Ga0207646_10045740 3300025922 Bacteria 3928
253 Ga0207646_10197725 3300025922 Unclassified 1816
254 Ga0207646_10431706 3300025922 Bacteria 1189
255 Ga0207681_10023499 3300025923 Bacteria 3944
256 Ga0207681_10028946 3300025923 Bacteria 3592
257 Ga0207681_10073840 3300025923 Unclassified 2387
258 Ga0207650_10439809 3300025925 Bacteria 1084
259 Ga0207650_11683679 3300025925 Bacteria 538
260 Ga0207659_10009169 3300025926 Bacteria 6179
261 Ga0207659_10052676 3300025926 Bacteria 2900
262 Ga0207659_10411703 3300025926 Bacteria 1133
263 Ga0207687_10079509 3300025927 Unclassified 2364
264 Ga0207687_10548142 3300025927 Bacteria 970
265 Ga0207700_11147155 3300025928 Bacteria 694
266 Ga0207664_10326773 3300025929 Bacteria 1354
267 Ga0207664_10341959 3300025929 Unclassified 1323
268 Ga0207664_10350099 3300025929 Bacteria 1307
269 Ga0207644_10023279 3300025931 Bacteria 4241
270 Ga0207644_10234048 3300025931 Bacteria 1461
271 Ga0207690_10248047 3300025932 Bacteria 1374
272 Ga0207706_10009742 3300025933 Bacteria 8817
273 Ga0207706_10024263 3300025933 Bacteria 5436
274 Ga0207706_11101971 3300025933 Unclassified 663
275 Ga0207670_10333798 3300025936 Bacteria 1196
276 Ga0207669_10023250 3300025937 Bacteria 3308
277 Ga0207669_10833688 3300025937 Bacteria 766
278 Ga0207665_10049223 3300025939 Bacteria 2831
279 Ga0207665_10075955 3300025939 Bacteria 2302
280 Ga0207665_10124373 3300025939 Bacteria 1825
281 Ga0207665_10248591 3300025939 Bacteria 1313
282 Ga0207691_10006368 3300025940 Bacteria 11406
283 Ga0207691_10292137 3300025940 Bacteria 1401
284 Ga0207679_10501224 3300025945 Bacteria 1083
285 Ga0207651_10035887 3300025960 Bacteria 3230
286 Ga0207651_10179255 3300025960 Bacteria 1679
287 Ga0207651_10403044 3300025960 Bacteria 1164
288 Ga0207712_10051634 3300025961 Unclassified 2877
289 Ga0207668_10015919 3300025972 Bacteria 4682
290 Ga0207668_10219733 3300025972 Unclassified 1525
291 Ga0207668_10784051 3300025972 Unclassified 843
292 Ga0207658_10004974 3300025986 Bacteria 9161
293 Ga0207658_10694028 3300025986 Bacteria 919
294 Ga0207677_10616164 3300026023 Unclassified 954
295 Ga0207677_10644823 3300026023 Unclassified 934
296 Ga0207641_10004002 3300026088 Bacteria 12858
297 Ga0207641_10324426 3300026088 Bacteria 1461
298 Ga0207648_10223120 3300026089 Bacteria 1675
299 Ga0207648_11276671 3300026089 Unclassified 690
300 Ga0207675_102050939 3300026118 Bacteria 589
301 Ga0207683_10051810 3300026121 Bacteria 3596
302 Ga0207683_10162059 3300026121 Bacteria 2022
303 Ga0210002_1029997 3300027617 Bacteria 902
304 Ga0268266_10440006 3300028379 Bacteria 1238
305 Ga0268266_10652786 3300028379 Bacteria 1012
306 Ga0268266_12209219 3300028379 Unclassified 522
307 Ga0268265_10123836 3300028380 Unclassified 2135
308 Ga0268265_10246100 3300028380 Bacteria 1581
309 Ga0268264_10029008 3300028381 Bacteria 4530
310 Ga0373945_0116255 3300035116 Unclassified 1060
311 Ga0373943_0087614 3300035170 Bacteria 1607
312 Ga0373943_0381026 3300035170 Bacteria 812
313 Ga0373946_0035737 3300035171 Bacteria 2012
314 Ga0373946_0511440 3300035171 Bacteria 617
315 Ga0373962_0290064 3300035242 Bacteria 578
316 Ga0373935_0628899 3300035692 Unclassified 786
317 Ga0373933_0567987 3300035724 Bacteria 744
318 Ga0373947_0060532 3300035725 Bacteria 2299
319 Ga0373947_0663956 3300035725 Unclassified 711
320 Ga0373925_0067866 3300037068 Bacteria 2691
321 Ga0373925_0296490 3300037068 Bacteria 1305
322 Ga0373925_0340905 3300037068 Unclassified 1216
323 Ga0395899_0099927 3300037312 Bacteria 2095
324 Ga0395900_0022420 3300037418 Bacteria 6458
325 Ga0395900_0079020 3300037418 Bacteria 3380
326 Ga0395900_1016201 3300037418 Unclassified 749
327 Ga0395898_0014438 3300037466 Bacteria 8112
328 Ga0395898_0135838 3300037466 Bacteria 2355
329 Ga0395905_0051649 3300037471 Bacteria 3851
330 Ga0395905_1428891 3300037471 Unclassified 596
331 Ga0395901_0128272 3300038443 Bacteria 2666
332 Ga0395901_0157460 3300038443 Bacteria 2385
333 Ga0395901_0660600 3300038443 Bacteria 1047
334 Ga0395901_0744258 3300038443 Unclassified 974
335 Ga0395901_1031364 3300038443 Bacteria 797
336 Ga0395901_1120913 3300038443 Unclassified 756
337 Ga0451807_2229684 3300041486 Bacteria 594
338 Ga0439451_095569 3300042009 Unclassified 600
339 Ga0450889_037203 3300042144 Bacteria 581
340 Ga0451576_0055796 3300045051 Bacteria 4132
341 Ga0451576_2121496 3300045051 Bacteria 578
342 Ga0495584_0082083 3300046491 Bacteria 1623
343 Ga0495659_0323966 3300046664 Bacteria 655
344 Ga0495658_0746174 3300046683 Bacteria 627
345 Ga0496101_0356385 3300048904 Unclassified 1150
346 Ga0496102_0119449 3300048905 Bacteria 2461
347 Ga0496102_0146593 3300048905 Bacteria 2216
348 Ga0496103_0842928 3300048906 Bacteria 577
349 Ga0496104_0057733 3300048907 Unclassified 3673
350 Ga0496104_0350836 3300048907 Bacteria 1388
351 Ga0496104_1003530 3300048907 Bacteria 739
352 Ga0496105_0096566 3300048908 Bacteria 2441
353 Ga0496105_1228097 3300048908 Bacteria 551
354 Ga0496107_0081247 3300048910 Unclassified 2364
355 Ga0496107_0083913 3300048910 Bacteria 2324
356 Ga0496109_0562332 3300048912 Bacteria 1076
357 Ga0496111_1305945 3300048914 Bacteria 511
358 Ga0496112_0040617 3300048915 Bacteria 4549
359 Ga0496112_0081552 3300048915 Unclassified 3199
360 Ga0496112_0096130 3300048915 Bacteria 2933
361 Ga0496113_0790916 3300048916 Bacteria 754
362 Ga0496114_0206325 3300048917 Bacteria 1723
363 Ga0496114_0259026 3300048917 Bacteria 1531
364 Ga0496115_0292374 3300048918 Bacteria 1336
365 Ga0496115_0345061 3300048918 Unclassified 1215
366 Ga0496115_1014094 3300048918 Bacteria 634
367 nmdc:mga05p37_717290_c1 3300050507 Bacteria 1108
368 nmdc:mga05p37_96103_c1 3300050507 Bacteria 3650
369 nmdc:mga0rr50_1149704_c1 3300050513 Unclassified 660
370 nmdc:mga08x19_68163_c1 3300050514 Bacteria 2315
371 nmdc:mga08x19_719294_c1 3300050514 Bacteria 709
372 Ga0395899_0303580
373 JGI24035J26624_1007305
374 JGI25405J52794_10000076
375 JGI25405J52794_10007676
376 JGI25405J52794_10067173
377 Ga0065704_10039782
378 Ga0065704_10084849
379 Ga0065712_10006191
380 Ga0065712_10009043
381 Ga0065712_10013268
382 Ga0065712_10112111
383 Ga0065712_10125422
384 Ga0065712_10157472
385 Ga0065715_10002403
386 Ga0065715_10074734
387 Ga0065715_10093205
388 Ga0065715_10114904
389 Ga0065707_10024551
390 Ga0070676_10001748
391 Ga0070676_10115255
392 Ga0070676_10123505
393 Ga0070690_100160425
394 Ga0070670_100975418
395 Ga0070666_10122306
396 Ga0070666_10157677
397 Ga0070666_10904028
398 Ga0068868_100011494
399 Ga0070660_100608116
400 Ga0070689_100574245
401 Ga0070687_100000356
402 Ga0070661_101676657
403 Ga0070661_101691693
404 Ga0070668_100058976
405 Ga0070668_100069310
406 Ga0070668_100216801
407 Ga0070668_101497279
408 Ga0070669_100029629
409 Ga0070669_100547383
410 Ga0070675_100007595
411 Ga0070675_100084661
412 Ga0070675_100169779
413 Ga0070675_100715059
414 Ga0070671_100019197
415 Ga0070671_100217116
416 Ga0070674_100083109
417 Ga0070673_100069160
418 Ga0070673_100134183
419 Ga0070673_100404762
420 Ga0070673_100412293
421 Ga0070688_100364585
422 Ga0070688_100608680
423 Ga0070659_100051371
424 Ga0070667_100022315
425 Ga0070667_100061745
426 Ga0070667_101429728
427 Ga0070709_10024292
428 Ga0070709_10132770
429 Ga0070714_100081830
430 Ga0070713_100382409
431 Ga0070713_100875040
432 Ga0070713_100878641
433 Ga0070713_101111995
434 Ga0070711_100030844
435 Ga0070711_100534007
436 Ga0070711_101049452
437 Ga0070705_100191650
438 Ga0070708_100042690
439 Ga0070708_100053898
440 Ga0070708_100107801
441 Ga0070708_100123799
442 Ga0070708_100356288
443 Ga0070708_100490377
444 Ga0070708_100950559
445 Ga0070678_100070333
446 Ga0070678_100141372
447 Ga0070662_100003266
448 Ga0070662_100170301
449 Ga0070662_101640045
450 Ga0068867_101694223
451 Ga0070685_10063847
452 Ga0070685_10183051
453 Ga0070706_100034594
454 Ga0070706_100264348
455 Ga0070706_100532362
456 Ga0070706_100547050
457 Ga0070706_100688700
458 Ga0070707_100002660
459 Ga0070707_100068520
460 Ga0070707_100134881
461 Ga0070707_100228049
462 Ga0070707_100288977
463 Ga0070707_100960203
464 Ga0070707_101479042
465 Ga0070698_100008629
466 Ga0070699_100057688
467 Ga0070684_100572392
468 Ga0070684_100745745
469 Ga0070697_100003890
470 Ga0070697_100021832
471 Ga0070697_100067959
472 Ga0070697_100446219
473 Ga0070697_100483360
474 Ga0070697_100501179
475 Ga0070696_100420883
476 Ga0070693_100191535
477 Ga0070665_100143656
478 Ga0068857_100656852
479 Ga0068856_100782086
480 Ga0068856_101481261
481 Ga0068861_100041839
482 Ga0068861_100404830
483 Ga0068863_100005260
484 Ga0068863_100194671
485 Ga0068863_101547043
486 Ga0068863_102182552
487 Ga0068858_101368038
488 Ga0068860_100031825
489 Ga0068862_100056102
490 Ga0068862_100648762
491 Ga0081455_10000920
492 Ga0081455_10004503
493 Ga0081455_10008179
494 Ga0081455_10015032
495 Ga0081455_10044957
496 Ga0081455_10591179
497 Ga0081538_10053415
498 Ga0081540_1000223
499 Ga0081539_10000671
500 Ga0081539_10040389
501 Ga0081539_10127427
502 Ga0070717_10012975
503 Ga0070717_10307844
504 Ga0070717_10437498
505 Ga0070715_10035083
506 Ga0070715_10944740
507 Ga0070716_100248916
508 Ga0070716_100720363
509 Ga0070716_100923992
510 Ga0070712_100022562
511 Ga0070712_100032858
512 Ga0070712_100038640
513 Ga0070712_100065539
514 Ga0070712_100439363
515 Ga0070712_100886127
516 Ga0070712_101497317
517 Ga0070712_101687058
518 Ga0097621_101682001
519 Ga0068871_100308676
520 Ga0075428_100627737
521 Ga0075434_100340133
522 Ga0075434_100774702
523 Ga0075436_100077721
524 Ga0099795_10047179
525 Ga0105240_10251692
526 Ga0105245_10009284
527 Ga0105245_10175193
528 Ga0105245_10351720
529 Ga0105245_10432078
530 Ga0105247_10229236
531 Ga0114129_10318949
532 Ga0114129_10732540
533 Ga0114129_12117689
534 Ga0105243_10070112
535 Ga0105242_10375705
536 Ga0105237_11547501
537 Ga0105249_10004459
538 Ga0105249_10836809
539 Ga0099796_10037991
540 Ga0105239_10152824
541 Ga0105246_10946556
542 Ga0157315_1020656
543 Ga0157371_10071007
544 Ga0157374_10030793
545 Ga0157374_10067678
546 Ga0157374_10105316
547 Ga0157374_10299310
548 Ga0157374_10419959
549 Ga0157374_10688584
550 Ga0157374_11227815
551 Ga0157374_12547415
552 Ga0157378_10012365
553 Ga0157378_10025513
554 Ga0157378_10155294
555 Ga0157378_10162041
556 Ga0157378_10328829
557 Ga0157378_10345324
558 Ga0157378_10443236
559 Ga0157378_10547737
560 Ga0157378_11064694
561 Ga0163162_10019896
562 Ga0163162_10023572
563 Ga0163162_10227567
564 Ga0163162_10331768
565 Ga0163162_10380200
566 Ga0157372_10017387
567 Ga0157372_10070229
568 Ga0157372_10083095
569 Ga0157372_13020786
570 Ga0157375_10047173
571 Ga0157375_10214446
572 Ga0157375_10283631
573 Ga0157375_10343919
574 Ga0163163_10086107
575 Ga0157377_10298988
576 Ga0157377_10575545
577 Ga0157376_10075481
578 Ga0157376_10086960
579 Ga0157376_10548742
580 Ga0163161_10076654
581 Ga0207666_1005424
582 Ga0207673_1027407
583 Ga0207697_10000300
584 Ga0207697_10005467
585 Ga0207697_10031055
586 Ga0207697_10044665
587 Ga0207697_10104398
588 Ga0207692_10144424
589 Ga0207688_10040874
590 Ga0207688_10055409
591 Ga0207688_10128908
592 Ga0207647_10390023
593 Ga0207685_10070263
594 Ga0207685_10130282
595 Ga0207699_10039844
596 Ga0207699_10231529
597 Ga0207699_10747462
598 Ga0207645_10004134
599 Ga0207645_10018969
600 Ga0207645_10049635
601 Ga0207645_10741795
602 Ga0207705_10191275
603 Ga0207684_10212670
604 Ga0207684_10316862
605 Ga0207684_10333642
606 Ga0207684_10389300
607 Ga0207684_10895490
608 Ga0207695_10491438
609 Ga0207693_10040257
610 Ga0207693_10051669
611 Ga0207693_10073756
612 Ga0207693_10317808
613 Ga0207693_10383247
614 Ga0207693_10533370
615 Ga0207693_11347182
616 Ga0207663_10043433
617 Ga0207663_10407385
618 Ga0207663_11049599
619 Ga0207663_11225193
620 Ga0207662_10000538
621 Ga0207657_10284963
622 Ga0207646_10002870
623 Ga0207646_10045740
624 Ga0207646_10197725
625 Ga0207646_10431706
626 Ga0207681_10023499
627 Ga0207681_10028946
628 Ga0207681_10073840
629 Ga0207650_10439809
630 Ga0207650_11683679
631 Ga0207659_10009169
632 Ga0207659_10052676
633 Ga0207659_10411703
634 Ga0207687_10079509
635 Ga0207687_10548142
636 Ga0207700_11147155
637 Ga0207664_10326773
638 Ga0207664_10341959
639 Ga0207664_10350099
640 Ga0207644_10023279
641 Ga0207644_10234048
642 Ga0207690_10248047
643 Ga0207706_10009742
644 Ga0207706_10024263
645 Ga0207706_11101971
646 Ga0207670_10333798
647 Ga0207669_10023250
648 Ga0207669_10833688
649 Ga0207665_10049223
650 Ga0207665_10075955
651 Ga0207665_10124373
652 Ga0207665_10248591
653 Ga0207691_10006368
654 Ga0207691_10292137
655 Ga0207679_10501224
656 Ga0207651_10035887
657 Ga0207651_10179255
658 Ga0207651_10403044
659 Ga0207712_10051634
660 Ga0207668_10015919
661 Ga0207668_10219733
662 Ga0207668_10784051
663 Ga0207658_10004974
664 Ga0207658_10694028
665 Ga0207677_10616164
666 Ga0207677_10644823
667 Ga0207641_10004002
668 Ga0207641_10324426
669 Ga0207648_10223120
670 Ga0207648_11276671
671 Ga0207675_102050939
672 Ga0207683_10051810
673 Ga0207683_10162059
674 Ga0210002_1029997
675 Ga0268266_10440006
676 Ga0268266_10652786
677 Ga0268266_12209219
678 Ga0268265_10123836
679 Ga0268265_10246100
680 Ga0268264_10029008
681 Ga0373945_0116255
682 Ga0373943_0087614
683 Ga0373943_0381026
684 Ga0373946_0035737
685 Ga0373946_0511440
686 Ga0373962_0290064
687 Ga0373935_0628899
688 Ga0373933_0567987
689 Ga0373947_0060532
690 Ga0373947_0663956
691 Ga0373925_0067866
692 Ga0373925_0296490
693 Ga0373925_0340905
694 Ga0395899_0099927
695 Ga0395900_0022420
696 Ga0395900_0079020
697 Ga0395900_1016201
698 Ga0395898_0014438
699 Ga0395898_0135838
700 Ga0395905_0051649
701 Ga0395905_1428891
702 Ga0395901_0128272
703 Ga0395901_0157460
704 Ga0395901_0660600
705 Ga0395901_0744258
706 Ga0395901_1031364
707 Ga0395901_1120913
708 Ga0451807_2229684
709 Ga0439451_095569
710 Ga0450889_037203
711 Ga0451576_0055796
712 Ga0451576_2121496
713 Ga0495584_0082083
714 Ga0495659_0323966
715 Ga0495658_0746174
716 Ga0496101_0356385
717 Ga0496102_0119449
718 Ga0496102_0146593
719 Ga0496103_0842928
720 Ga0496104_0057733
721 Ga0496104_0350836
722 Ga0496104_1003530
723 Ga0496105_0096566
724 Ga0496105_1228097
725 Ga0496107_0081247
726 Ga0496107_0083913
727 Ga0496109_0562332
728 Ga0496111_1305945
729 Ga0496112_0040617
730 Ga0496112_0081552
731 Ga0496112_0096130
732 Ga0496113_0790916
733 Ga0496114_0206325
734 Ga0496114_0259026
735 Ga0496115_0292374
736 Ga0496115_0345061
737 Ga0496115_1014094
738 nmdc:mga05p37_717290_c1
739 nmdc:mga05p37_96103_c1
740 nmdc:mga0rr50_1149704_c1
741 nmdc:mga08x19_68163_c1
742 nmdc:mga08x19_719294_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

29

168

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5co4-assembly1.cif.gz_A structural insights into the 2-oh methylation of c/u34 on trna 0.9625 4 151
5co4-assembly1.cif.gz_B structural insights into the 2-oh methylation of c/u34 on trna 0.9518 4 151
4kdz-assembly1.cif.gz_A crystal structure of trna/rrna methyltransferase yibk from escherichia coli (target nysgrc-012599) 0.9327 5 150
6qkv-assembly1.cif.gz_B structure of yibk from p. aeruginosa 0.9289 5 150
7e3s-assembly1.cif.gz_B crystal structure of trml from shewanella oneidensis 0.9268 5 150
ID Description Score Start End Superfamily
5co4A00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9625 4 151 3.40.1280.10
af_C6TCU8_69_240_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9323 5 151 3.40.1280.10
5co4A00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9256 4 151 3.40.1280.10
4pzkB00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9244 5 151 3.40.1280.10
af_O50394_1_154_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9205 5 150 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A7W1CQC0-F1-model_v4 tRNA (Cytidine(34)-2'-O)-methyltransferase 0.9863 5 125 GO:0002130
GO:0003723
GO:0008173
AF-A0A2V5XRC7-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9784 5 152 GO:0002130
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-A0A7X7GV22-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9771 5 149 GO:0002130
GO:0003723
GO:0005737
GO:0008175
GO:0008757
AF-A0A1W9Q8E4-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9768 5 149 GO:0002130
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-A0A7V9V373-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9761 5 154 GO:0002130
GO:0003723
GO:0005737
GO:0008175
GO:0008757

Map