F425663

General Info

Members Datasets Scaffolds Average Seq Length
371 196 742 89

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_102366353|Ga0070713_1023663531
Length 93
Sequence MPRERWFGATGRRVPEIAVEGELELDDALVLDDASDQAQLRDAHAVGRPVVVRASTAQQVQQALSHPEVAAALVPSDRRELVDLDLTELTYGS

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
105 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
108 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
126 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
129 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
130 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
131 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
132 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
133 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
134 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
138 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
139 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
140 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
141 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
150 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
151 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
152 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
155 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
156 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
182 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
191 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.77
Metatranscriptomes 3.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.62
Nodule 0
Rhizoplane 13.21
Rhizosphere 84.64
Stem 0
Stem Tuber 0
Unclassified 16.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_102366353 3300005436 Bacteria 514
2 rootH1_10049005 3300003323 Bacteria 1132
3 Ga0070658_10015597 3300005327 Bacteria 6076
4 Ga0070676_11333621 3300005328 Bacteria 549
5 Ga0070683_100056519 3300005329 Bacteria 3644
6 Ga0070683_100287994 3300005329 Unclassified 1562
7 Ga0070680_100029538 3300005336 Bacteria 4403
8 Ga0070682_100337621 3300005337 Archaea 1119
9 Ga0070682_101266897 3300005337 Unclassified 625
10 Ga0070660_100008711 3300005339 Bacteria 7102
11 Ga0070660_100039231 3300005339 Bacteria 3599
12 Ga0070661_100010897 3300005344 Bacteria 6331
13 Ga0070661_100015673 3300005344 Bacteria 5350
14 Ga0070661_101406620 3300005344 Bacteria 587
15 Ga0070674_100632447 3300005356 Bacteria 908
16 Ga0070674_100898059 3300005356 Bacteria 771
17 Ga0070659_100065298 3300005366 Bacteria 2882
18 Ga0070667_101203389 3300005367 Bacteria 709
19 Ga0070709_10042912 3300005434 Bacteria 2795
20 Ga0070714_100015329 3300005435 Bacteria 6167
21 Ga0070714_100566550 3300005435 Unclassified 1089
22 Ga0070714_102327347 3300005435 Bacteria 521
23 Ga0070714_102450911 3300005435 Bacteria 507
24 Ga0070713_100099039 3300005436 Bacteria 2521
25 Ga0070713_100258021 3300005436 Bacteria 1592
26 Ga0070713_100640169 3300005436 Bacteria 1012
27 Ga0070710_10085971 3300005437 Bacteria 1846
28 Ga0070710_10306282 3300005437 Bacteria 1038
29 Ga0070711_100005702 3300005439 Bacteria 7465
30 Ga0070711_101116345 3300005439 Bacteria 680
31 Ga0070708_100137883 3300005445 Bacteria 2261
32 Ga0070708_100861639 3300005445 Bacteria 851
33 Ga0070708_102225667 3300005445 Bacteria 506
34 Ga0070663_100370666 3300005455 Bacteria 1164
35 Ga0070663_101641088 3300005455 Unclassified 574
36 Ga0070678_100210207 3300005456 Bacteria 1612
37 Ga0070678_100640843 3300005456 Unclassified 952
38 Ga0070678_100753756 3300005456 Bacteria 881
39 Ga0070662_101096076 3300005457 Bacteria 683
40 Ga0070681_10191896 3300005458 Bacteria 1962
41 Ga0070681_10339269 3300005458 Bacteria 1412
42 Ga0070681_10536922 3300005458 Archaea 1083
43 Ga0070706_100477998 3300005467 Bacteria 1159
44 Ga0070699_101995717 3300005518 Bacteria 530
45 Ga0070679_100024523 3300005530 Bacteria 5911
46 Ga0070679_100351783 3300005530 Bacteria 1421
47 Ga0070679_101930385 3300005530 Bacteria 539
48 Ga0070684_100003158 3300005535 Bacteria 12307
49 Ga0070684_100077727 3300005535 Bacteria 2931
50 Ga0070684_100461200 3300005535 Bacteria 1175
51 Ga0068853_100055486 3300005539 Bacteria 3415
52 Ga0068853_102301934 3300005539 Bacteria 522
53 Ga0070693_100782588 3300005547 Bacteria 706
54 Ga0070693_101170622 3300005547 Bacteria 589
55 Ga0070665_100017276 3300005548 Bacteria 7239
56 Ga0070704_100017911 3300005549 Bacteria 4517
57 Ga0070704_100356392 3300005549 Bacteria 1236
58 Ga0068855_100006224 3300005563 Bacteria 14542
59 Ga0068855_100048141 3300005563 Bacteria 5033
60 Ga0068855_100103341 3300005563 Bacteria 3278
61 Ga0070664_101541566 3300005564 Bacteria 629
62 Ga0068857_100138114 3300005577 Bacteria 2202
63 Ga0068856_100024971 3300005614 Bacteria 5824
64 Ga0068856_100352576 3300005614 Bacteria 1490
65 Ga0068856_100518879 3300005614 Unclassified 1213
66 Ga0068856_100599094 3300005614 Bacteria 1123
67 Ga0068852_100896152 3300005616 Bacteria 904
68 Ga0068852_101449385 3300005616 Unclassified 709
69 Ga0068852_101682660 3300005616 Bacteria 657
70 Ga0081455_10448026 3300005937 Bacteria 883
71 Ga0081539_10188732 3300005985 Bacteria 961
72 Ga0081539_10263381 3300005985 Unclassified 759
73 Ga0070717_10260087 3300006028 Bacteria 1535
74 Ga0070717_10503180 3300006028 Bacteria 1095
75 Ga0075368_10312778 3300006042 Unclassified 679
76 Ga0070716_100562669 3300006173 Bacteria 852
77 Ga0070716_100785433 3300006173 Bacteria 736
78 Ga0070712_100040454 3300006175 Bacteria 3196
79 Ga0070712_100473859 3300006175 Bacteria 1046
80 Ga0070712_100875054 3300006175 Unclassified 774
81 Ga0070712_101855708 3300006175 Unclassified 528
82 Ga0075367_10156517 3300006178 Bacteria 1416
83 Ga0097621_100988119 3300006237 Bacteria 787
84 Ga0097621_101420543 3300006237 Bacteria 657
85 Ga0097621_101440025 3300006237 Bacteria 653
86 Ga0075431_100251883 3300006847 Unclassified 1794
87 Ga0075431_100720853 3300006847 Unclassified 974
88 Ga0075433_10000356 3300006852 Bacteria 28714
89 Ga0075433_10374557 3300006852 Bacteria 1257
90 Ga0075436_100007261 3300006914 Bacteria 7581
91 Ga0075435_100020400 3300007076 Bacteria 5078
92 Ga0075435_100197786 3300007076 Bacteria 1703
93 Ga0105240_10019185 3300009093 Bacteria 9142
94 Ga0105245_10403836 3300009098 Unclassified 1366
95 Ga0105245_11302099 3300009098 Bacteria 776
96 Ga0114129_10022755 3300009147 Bacteria 8887
97 Ga0105242_10352607 3300009176 Bacteria 1359
98 Ga0105242_10765301 3300009176 Unclassified 952
99 Ga0105237_10160817 3300009545 Bacteria 2244
100 Ga0105238_10077628 3300009551 Bacteria 3312
101 Ga0105239_10037552 3300010375 Bacteria 5308
102 Ga0105239_10045872 3300010375 Bacteria 4789
103 Ga0157338_1045960 3300012515 Unclassified 611
104 Ga0157373_11231888 3300013100 Archaea 565
105 Ga0157370_10112773 3300013104 Bacteria 2541
106 Ga0157369_10120013 3300013105 Bacteria 2790
107 Ga0157369_10180981 3300013105 Bacteria 2218
108 Ga0157369_12459284 3300013105 Bacteria 527
109 Ga0157374_10213872 3300013296 Bacteria 1891
110 Ga0157372_10135417 3300013307 Bacteria 2836
111 Ga0157372_10388621 3300013307 Bacteria 1626
112 Ga0157372_10929912 3300013307 Unclassified 1008
113 Ga0157372_10949960 3300013307 Unclassified 996
114 Ga0157380_10001800 3300014326 Bacteria 14145
115 Ga0197907_10660291 3300020069 Unclassified 1124
116 Ga0197907_11142398 3300020069 Bacteria 950
117 Ga0206356_10508183 3300020070 Bacteria 5139
118 Ga0206356_11088180 3300020070 Bacteria 3964
119 Ga0206356_11316511 3300020070 Bacteria 1660
120 Ga0206350_10376281 3300020080 Bacteria 980
121 Ga0206354_10440141 3300020081 Bacteria 2464
122 Ga0206354_11443952 3300020081 Bacteria 3732
123 Ga0206354_11501598 3300020081 Bacteria 4154
124 Ga0206353_10431665 3300020082 Bacteria 11624
125 Ga0206353_10862134 3300020082 Bacteria 11133
126 Ga0224712_10028512 3300022467 Bacteria 1996
127 Ga0207692_10095262 3300025898 Bacteria 1623
128 Ga0207692_10336055 3300025898 Bacteria 928
129 Ga0207692_10990920 3300025898 Unclassified 555
130 Ga0207692_11132107 3300025898 Archaea 519
131 Ga0207699_10014405 3300025906 Bacteria 4076
132 Ga0207705_10006903 3300025909 Bacteria 8387
133 Ga0207705_10008914 3300025909 Bacteria 7304
134 Ga0207707_10113931 3300025912 Bacteria 2363
135 Ga0207707_10564644 3300025912 Unclassified 966
136 Ga0207695_10030128 3300025913 Bacteria 5978
137 Ga0207671_10089722 3300025914 Bacteria 2314
138 Ga0207693_10049477 3300025915 Bacteria 3300
139 Ga0207693_10846884 3300025915 Bacteria 703
140 Ga0207693_11144045 3300025915 Unclassified 589
141 Ga0207657_10000166 3300025919 Bacteria 67098
142 Ga0207657_10001116 3300025919 Bacteria 28490
143 Ga0207649_10091398 3300025920 Bacteria 1993
144 Ga0207649_10226941 3300025920 Unclassified 1333
145 Ga0207652_10042372 3300025921 Bacteria 3874
146 Ga0207652_10066517 3300025921 Bacteria 3124
147 Ga0207652_10123507 3300025921 Bacteria 2305
148 Ga0207694_10312296 3300025924 Bacteria 1296
149 Ga0207687_10282501 3300025927 Unclassified 1331
150 Ga0207687_10383464 3300025927 Bacteria 1152
151 Ga0207700_10063258 3300025928 Bacteria 2813
152 Ga0207700_10398559 3300025928 Bacteria 1206
153 Ga0207700_10982929 3300025928 Bacteria 755
154 Ga0207700_11255420 3300025928 Bacteria 661
155 Ga0207700_11511370 3300025928 Bacteria 596
156 Ga0207664_10029557 3300025929 Bacteria 4175
157 Ga0207664_10389959 3300025929 Unclassified 1237
158 Ga0207664_10816482 3300025929 Bacteria 839
159 Ga0207664_11571786 3300025929 Bacteria 580
160 Ga0207690_10275244 3300025932 Bacteria 1309
161 Ga0207706_10047135 3300025933 Bacteria 3814
162 Ga0207686_10099195 3300025934 Bacteria 1941
163 Ga0207704_10201878 3300025938 Bacteria 1456
164 Ga0207661_10013264 3300025944 Bacteria 6017
165 Ga0207667_10099847 3300025949 Bacteria 2994
166 Ga0207667_10541230 3300025949 Unclassified 1178
167 Ga0207667_10566984 3300025949 Bacteria 1147
168 Ga0207651_10571803 3300025960 Bacteria 985
169 Ga0207712_10124246 3300025961 Bacteria 1957
170 Ga0207668_10531145 3300025972 Bacteria 1016
171 Ga0207640_11191058 3300025981 Unclassified 677
172 Ga0207658_10696613 3300025986 Unclassified 918
173 Ga0207677_10636412 3300026023 Bacteria 940
174 Ga0207677_12081575 3300026023 Bacteria 528
175 Ga0207639_10672280 3300026041 Bacteria 959
176 Ga0207678_10142565 3300026067 Bacteria 2045
177 Ga0207678_11181182 3300026067 Unclassified 677
178 Ga0207678_11257017 3300026067 Unclassified 655
179 Ga0207702_10154510 3300026078 Bacteria 2090
180 Ga0207702_10181153 3300026078 Bacteria 1940
181 Ga0207702_10534978 3300026078 Bacteria 1145
182 Ga0207702_12526459 3300026078 Unclassified 500
183 Ga0207674_10005383 3300026116 Bacteria 15230
184 Ga0207674_10041293 3300026116 Bacteria 4771
185 Ga0207675_100007490 3300026118 Bacteria 10313
186 Ga0207683_10570778 3300026121 Unclassified 1046
187 Ga0207683_10609931 3300026121 Bacteria 1010
188 Ga0207683_11420250 3300026121 Bacteria 641
189 Ga0207698_11063556 3300026142 Bacteria 821
190 Ga0209813_10242167 3300027866 Unclassified 682
191 Ga0207428_10141954 3300027907 Bacteria 1832
192 Ga0268266_10029666 3300028379 Bacteria 4648
193 Ga0268265_11554657 3300028380 Bacteria 666
194 Ga0265337_1027110 3300028556 Bacteria 1730
195 Ga0265336_10219930 3300028666 Bacteria 564
196 Ga0265338_10148666 3300028800 Bacteria 1823
197 Ga0265338_10193250 3300028800 Bacteria 1541
198 Ga0265340_10144728 3300031247 Unclassified 1086
199 Ga0265327_10060004 3300031251 Bacteria 1946
200 Ga0265327_10484401 3300031251 Bacteria 533
201 Ga0373931_0877423 3300035691 Bacteria 602
202 Ga0373937_1789334 3300036401 Bacteria 561
203 Ga0395899_0110277 3300037312 Bacteria 1979
204 Ga0395899_0175305 3300037312 Bacteria 1508
205 Ga0395899_0210766 3300037312 Unclassified 1350
206 Ga0395900_0024186 3300037418 Bacteria 6219
207 Ga0395900_0024787 3300037418 Bacteria 6140
208 Ga0395900_0223426 3300037418 Bacteria 1897
209 Ga0395900_0437194 3300037418 Bacteria 1267
210 Ga0395900_0823703 3300037418 Bacteria 855
211 Ga0395900_0832410 3300037418 Unclassified 849
212 Ga0395900_1163947 3300037418 Bacteria 687
213 Ga0395898_0007203 3300037466 Bacteria 11807
214 Ga0395898_0021194 3300037466 Bacteria 6593
215 Ga0395898_0261032 3300037466 Bacteria 1652
216 Ga0395898_0672905 3300037466 Archaea 977
217 Ga0395898_1371792 3300037466 Bacteria 635
218 Ga0395905_0063591 3300037471 Bacteria 3452
219 Ga0395905_0172595 3300037471 Archaea 2031
220 Ga0395905_0283657 3300037471 Bacteria 1542
221 Ga0395905_0337394 3300037471 Bacteria 1398
222 Ga0395905_0455982 3300037471 Unclassified 1177
223 Ga0395905_0592102 3300037471 Archaea 1011
224 Ga0395901_0040750 3300038443 Bacteria 4810
225 Ga0395901_0098669 3300038443 Bacteria 3062
226 Ga0395901_0280897 3300038443 Bacteria 1730
227 Ga0395901_0299584 3300038443 Bacteria 1667
228 Ga0395901_0357501 3300038443 Bacteria 1506
229 Ga0395901_0359867 3300038443 Unclassified 1501
230 Ga0395901_0456208 3300038443 Bacteria 1307
231 Ga0395901_0633521 3300038443 Unclassified 1075
232 Ga0395901_0788085 3300038443 Bacteria 940
233 Ga0395901_0928936 3300038443 Bacteria 850
234 Ga0395901_1433448 3300038443 Unclassified 648
235 Ga0395901_1723049 3300038443 Bacteria 577
236 Ga0451839_0947915 3300041496 Unclassified 564
237 Ga0466961_0027495 3300044693 Bacteria 3658
238 Ga0466963_0026946 3300044694 Unclassified 3676
239 Ga0466963_0097050 3300044694 Bacteria 2013
240 Ga0466963_0564243 3300044694 Bacteria 804
241 Ga0466971_0001008 3300044719 Bacteria 11637
242 Ga0466957_0010628 3300044842 Bacteria 5292
243 Ga0466957_0021081 3300044842 Bacteria 3838
244 Ga0466957_0241173 3300044842 Bacteria 1199
245 Ga0466960_0522679 3300044901 Bacteria 697
246 Ga0466959_0007636 3300045049 Bacteria 7603
247 Ga0466959_0229298 3300045049 Bacteria 1286
248 Ga0466958_1017672 3300045836 Archaea 541
249 Ga0466967_0015306 3300045976 Bacteria 6009
250 Ga0466967_0043586 3300045976 Bacteria 3885
251 Ga0466967_0205972 3300045976 Archaea 1864
252 Ga0466967_0430778 3300045976 Bacteria 1287
253 Ga0466967_1575290 3300045976 Bacteria 654
254 Ga0495617_233833 3300046452 Bacteria 569
255 Ga0495627_156153 3300046453 Bacteria 636
256 Ga0495603_0004063 3300046455 Bacteria 8708
257 Ga0495582_0044030 3300046473 Unclassified 2458
258 Ga0495605_0155216 3300046474 Bacteria 1019
259 Ga0495584_0132143 3300046491 Unclassified 1266
260 Ga0495584_0166629 3300046491 Bacteria 1120
261 Ga0495584_0186483 3300046491 Bacteria 1054
262 Ga0495585_0549316 3300046492 Unclassified 546
263 Ga0495594_0103757 3300046499 Bacteria 1600
264 Ga0495596_0149877 3300046500 Viruses 906
265 Ga0495618_0667351 3300046514 Bacteria 614
266 Ga0495628_0038960 3300046516 Bacteria 3803
267 Ga0495630_0229045 3300046517 Bacteria 1420
268 Ga0495631_0133887 3300046518 Unclassified 1065
269 Ga0495663_0037336 3300046525 Viruses 1465
270 Ga0495642_0029899 3300046528 Unclassified 2178
271 Ga0495665_0664687 3300046531 Bacteria 518
272 Ga0495609_0113277 3300046538 Unclassified 1170
273 Ga0495609_0138062 3300046538 Bacteria 1041
274 Ga0495645_0677750 3300046543 Bacteria 628
275 Ga0495622_0416624 3300046557 Unclassified 578
276 Ga0495667_0248607 3300046559 Bacteria 1132
277 Ga0495656_0051754 3300046615 Bacteria 1759
278 Ga0495656_0359682 3300046615 Bacteria 756
279 Ga0495634_0842732 3300046642 Bacteria 521
280 Ga0495659_0046934 3300046664 Bacteria 1561
281 Ga0495659_0099813 3300046664 Archaea 1123
282 Ga0495661_0237838 3300046665 Unclassified 936
283 Ga0495588_0555957 3300046674 Unclassified 601
284 Ga0495657_0340002 3300046675 Bacteria 890
285 Ga0495599_0711983 3300046678 Bacteria 578
286 Ga0495647_0391301 3300046681 Bacteria 637
287 Ga0495658_0205600 3300046683 Unclassified 1228
288 Ga0495670_0461123 3300046691 Bacteria 689
289 Ga0495589_0116587 3300046794 Unclassified 1287
290 Ga0495636_0533508 3300047318 Unclassified 570
291 Ga0495674_1117868 3300047319 Bacteria 599
292 Ga0496100_0000294 3300048903 Bacteria 24866
293 Ga0496101_0003814 3300048904 Bacteria 9419
294 Ga0496101_0334754 3300048904 Bacteria 1188
295 Ga0496101_0576639 3300048904 Bacteria 890
296 Ga0496101_0802610 3300048904 Bacteria 742
297 Ga0496102_0002204 3300048905 Bacteria 16729
298 Ga0496102_0014221 3300048905 Bacteria 6915
299 Ga0496103_0033743 3300048906 Bacteria 3127
300 Ga0496103_0095859 3300048906 Unclassified 1875
301 Ga0496104_0001783 3300048907 Bacteria 18638
302 Ga0496104_0028387 3300048907 Bacteria 5186
303 Ga0496105_0006423 3300048908 Bacteria 9035
304 Ga0496105_0040362 3300048908 Bacteria 3848
305 Ga0496105_0354647 3300048908 Bacteria 1171
306 Ga0496106_0000725 3300048909 Bacteria 23756
307 Ga0496107_0000973 3300048910 Bacteria 17022
308 Ga0496107_0998247 3300048910 Bacteria 607
309 Ga0496108_0001201 3300048911 Bacteria 20295
310 Ga0496108_0041291 3300048911 Bacteria 3851
311 Ga0496108_0062179 3300048911 Bacteria 3144
312 Ga0496109_0002830 3300048912 Bacteria 14540
313 Ga0496109_0009769 3300048912 Bacteria 8190
314 Ga0496109_0035315 3300048912 Bacteria 4509
315 Ga0496109_0105590 3300048912 Bacteria 2616
316 Ga0496109_0385379 3300048912 Unclassified 1324
317 Ga0496109_1598504 3300048912 Bacteria 586
318 Ga0496110_0020480 3300048913 Bacteria 5586
319 Ga0496110_0079911 3300048913 Bacteria 2913
320 Ga0496110_0171245 3300048913 Bacteria 1970
321 Ga0496110_0417826 3300048913 Bacteria 1223
322 Ga0496110_0674056 3300048913 Unclassified 935
323 Ga0496111_0006881 3300048914 Bacteria 7419
324 Ga0496111_0075813 3300048914 Bacteria 2451
325 Ga0496111_0096018 3300048914 Bacteria 2175
326 Ga0496111_0285144 3300048914 Bacteria 1225
327 Ga0496111_0330777 3300048914 Bacteria 1128
328 Ga0496111_1282538 3300048914 Bacteria 517
329 Ga0496112_0016003 3300048915 Bacteria 7013
330 Ga0496112_0047849 3300048915 Bacteria 4195
331 Ga0496112_0287997 3300048915 Bacteria 1589
332 Ga0496113_0103918 3300048916 Bacteria 2204
333 Ga0496113_0129404 3300048916 Bacteria 1980
334 Ga0496113_0407693 3300048916 Bacteria 1091
335 Ga0496114_0000447 3300048917 Bacteria 30276
336 Ga0496114_0087087 3300048917 Bacteria 2648
337 Ga0496114_1544081 3300048917 Bacteria 552
338 Ga0496115_0000276 3300048918 Bacteria 45046
339 Ga0496115_0284197 3300048918 Bacteria 1358
340 Ga0496115_1133728 3300048918 Bacteria 591
341 Ga0501038_0837794 3300049574 Bacteria 682
342 Ga0501048_0841050 3300049582 Bacteria 660
343 Ga0501070_0147971 3300049586 Bacteria 1938
344 Ga0501070_0160426 3300049586 Bacteria 1854
345 Ga0501070_0796644 3300049586 Archaea 742
346 Ga0501072_1601439 3300049588 Bacteria 502
347 Ga0501079_0135424 3300049741 Bacteria 1918
348 Ga0501080_0156733 3300049742 Bacteria 2103
349 Ga0501080_0334775 3300049742 Bacteria 1368
350 Ga0501044_1013698 3300049823 Unclassified 702
351 nmdc:mga06z11_337347_c1 3300050494 Bacteria 901
352 nmdc:mga04h51_274671_c1 3300050495 Unclassified 681
353 nmdc:mga05p37_14818_c1 3300050507 Bacteria 9360
354 nmdc:mga06r32_241707_c1 3300050510 Unclassified 1793
355 nmdc:mga0n895_208748_c1 3300050512 Bacteria 1984
356 nmdc:mga0n895_45645_c1 3300050512 Bacteria 4276
357 nmdc:mga0rr50_516011_c1 3300050513 Bacteria 1017
358 nmdc:mga0rr50_89323_c1 3300050513 Bacteria 2396
359 nmdc:mga08x19_26230_c1 3300050514 Bacteria 3635
360 nmdc:mga0a205_161443_c1 3300050515 Bacteria 2138
361 nmdc:mga0a205_891110_c1 3300050515 Unclassified 737
362 Ga0495601_0010767 3300053077 Bacteria 5457
363 Ga0495601_1019590 3300053077 Bacteria 520
364 Ga0495655_0000847 3300053083 Bacteria 4769
365 Ga0495655_0034989 3300053083 Bacteria 1247
366 Ga0495595_0340558 3300053084 Bacteria 756
367 Ga0495619_0295117 3300053085 Bacteria 1123
368 Ga0500641_0395992 3300053096 Unclassified 544
369 Ga0501084_1656545 3300054114 Bacteria 535
370 Ga0466962_0003620 3300061719 Bacteria 7366
371 Ga0530510_0244650 3300061734 Bacteria 1336
372 Ga0070713_102366353
373 rootH1_10049005
374 Ga0070658_10015597
375 Ga0070676_11333621
376 Ga0070683_100056519
377 Ga0070683_100287994
378 Ga0070680_100029538
379 Ga0070682_100337621
380 Ga0070682_101266897
381 Ga0070660_100008711
382 Ga0070660_100039231
383 Ga0070661_100010897
384 Ga0070661_100015673
385 Ga0070661_101406620
386 Ga0070674_100632447
387 Ga0070674_100898059
388 Ga0070659_100065298
389 Ga0070667_101203389
390 Ga0070709_10042912
391 Ga0070714_100015329
392 Ga0070714_100566550
393 Ga0070714_102327347
394 Ga0070714_102450911
395 Ga0070713_100099039
396 Ga0070713_100258021
397 Ga0070713_100640169
398 Ga0070710_10085971
399 Ga0070710_10306282
400 Ga0070711_100005702
401 Ga0070711_101116345
402 Ga0070708_100137883
403 Ga0070708_100861639
404 Ga0070708_102225667
405 Ga0070663_100370666
406 Ga0070663_101641088
407 Ga0070678_100210207
408 Ga0070678_100640843
409 Ga0070678_100753756
410 Ga0070662_101096076
411 Ga0070681_10191896
412 Ga0070681_10339269
413 Ga0070681_10536922
414 Ga0070706_100477998
415 Ga0070699_101995717
416 Ga0070679_100024523
417 Ga0070679_100351783
418 Ga0070679_101930385
419 Ga0070684_100003158
420 Ga0070684_100077727
421 Ga0070684_100461200
422 Ga0068853_100055486
423 Ga0068853_102301934
424 Ga0070693_100782588
425 Ga0070693_101170622
426 Ga0070665_100017276
427 Ga0070704_100017911
428 Ga0070704_100356392
429 Ga0068855_100006224
430 Ga0068855_100048141
431 Ga0068855_100103341
432 Ga0070664_101541566
433 Ga0068857_100138114
434 Ga0068856_100024971
435 Ga0068856_100352576
436 Ga0068856_100518879
437 Ga0068856_100599094
438 Ga0068852_100896152
439 Ga0068852_101449385
440 Ga0068852_101682660
441 Ga0081455_10448026
442 Ga0081539_10188732
443 Ga0081539_10263381
444 Ga0070717_10260087
445 Ga0070717_10503180
446 Ga0075368_10312778
447 Ga0070716_100562669
448 Ga0070716_100785433
449 Ga0070712_100040454
450 Ga0070712_100473859
451 Ga0070712_100875054
452 Ga0070712_101855708
453 Ga0075367_10156517
454 Ga0097621_100988119
455 Ga0097621_101420543
456 Ga0097621_101440025
457 Ga0075431_100251883
458 Ga0075431_100720853
459 Ga0075433_10000356
460 Ga0075433_10374557
461 Ga0075436_100007261
462 Ga0075435_100020400
463 Ga0075435_100197786
464 Ga0105240_10019185
465 Ga0105245_10403836
466 Ga0105245_11302099
467 Ga0114129_10022755
468 Ga0105242_10352607
469 Ga0105242_10765301
470 Ga0105237_10160817
471 Ga0105238_10077628
472 Ga0105239_10037552
473 Ga0105239_10045872
474 Ga0157338_1045960
475 Ga0157373_11231888
476 Ga0157370_10112773
477 Ga0157369_10120013
478 Ga0157369_10180981
479 Ga0157369_12459284
480 Ga0157374_10213872
481 Ga0157372_10135417
482 Ga0157372_10388621
483 Ga0157372_10929912
484 Ga0157372_10949960
485 Ga0157380_10001800
486 Ga0197907_10660291
487 Ga0197907_11142398
488 Ga0206356_10508183
489 Ga0206356_11088180
490 Ga0206356_11316511
491 Ga0206350_10376281
492 Ga0206354_10440141
493 Ga0206354_11443952
494 Ga0206354_11501598
495 Ga0206353_10431665
496 Ga0206353_10862134
497 Ga0224712_10028512
498 Ga0207692_10095262
499 Ga0207692_10336055
500 Ga0207692_10990920
501 Ga0207692_11132107
502 Ga0207699_10014405
503 Ga0207705_10006903
504 Ga0207705_10008914
505 Ga0207707_10113931
506 Ga0207707_10564644
507 Ga0207695_10030128
508 Ga0207671_10089722
509 Ga0207693_10049477
510 Ga0207693_10846884
511 Ga0207693_11144045
512 Ga0207657_10000166
513 Ga0207657_10001116
514 Ga0207649_10091398
515 Ga0207649_10226941
516 Ga0207652_10042372
517 Ga0207652_10066517
518 Ga0207652_10123507
519 Ga0207694_10312296
520 Ga0207687_10282501
521 Ga0207687_10383464
522 Ga0207700_10063258
523 Ga0207700_10398559
524 Ga0207700_10982929
525 Ga0207700_11255420
526 Ga0207700_11511370
527 Ga0207664_10029557
528 Ga0207664_10389959
529 Ga0207664_10816482
530 Ga0207664_11571786
531 Ga0207690_10275244
532 Ga0207706_10047135
533 Ga0207686_10099195
534 Ga0207704_10201878
535 Ga0207661_10013264
536 Ga0207667_10099847
537 Ga0207667_10541230
538 Ga0207667_10566984
539 Ga0207651_10571803
540 Ga0207712_10124246
541 Ga0207668_10531145
542 Ga0207640_11191058
543 Ga0207658_10696613
544 Ga0207677_10636412
545 Ga0207677_12081575
546 Ga0207639_10672280
547 Ga0207678_10142565
548 Ga0207678_11181182
549 Ga0207678_11257017
550 Ga0207702_10154510
551 Ga0207702_10181153
552 Ga0207702_10534978
553 Ga0207702_12526459
554 Ga0207674_10005383
555 Ga0207674_10041293
556 Ga0207675_100007490
557 Ga0207683_10570778
558 Ga0207683_10609931
559 Ga0207683_11420250
560 Ga0207698_11063556
561 Ga0209813_10242167
562 Ga0207428_10141954
563 Ga0268266_10029666
564 Ga0268265_11554657
565 Ga0265337_1027110
566 Ga0265336_10219930
567 Ga0265338_10148666
568 Ga0265338_10193250
569 Ga0265340_10144728
570 Ga0265327_10060004
571 Ga0265327_10484401
572 Ga0373931_0877423
573 Ga0373937_1789334
574 Ga0395899_0110277
575 Ga0395899_0175305
576 Ga0395899_0210766
577 Ga0395900_0024186
578 Ga0395900_0024787
579 Ga0395900_0223426
580 Ga0395900_0437194
581 Ga0395900_0823703
582 Ga0395900_0832410
583 Ga0395900_1163947
584 Ga0395898_0007203
585 Ga0395898_0021194
586 Ga0395898_0261032
587 Ga0395898_0672905
588 Ga0395898_1371792
589 Ga0395905_0063591
590 Ga0395905_0172595
591 Ga0395905_0283657
592 Ga0395905_0337394
593 Ga0395905_0455982
594 Ga0395905_0592102
595 Ga0395901_0040750
596 Ga0395901_0098669
597 Ga0395901_0280897
598 Ga0395901_0299584
599 Ga0395901_0357501
600 Ga0395901_0359867
601 Ga0395901_0456208
602 Ga0395901_0633521
603 Ga0395901_0788085
604 Ga0395901_0928936
605 Ga0395901_1433448
606 Ga0395901_1723049
607 Ga0451839_0947915
608 Ga0466961_0027495
609 Ga0466963_0026946
610 Ga0466963_0097050
611 Ga0466963_0564243
612 Ga0466971_0001008
613 Ga0466957_0010628
614 Ga0466957_0021081
615 Ga0466957_0241173
616 Ga0466960_0522679
617 Ga0466959_0007636
618 Ga0466959_0229298
619 Ga0466958_1017672
620 Ga0466967_0015306
621 Ga0466967_0043586
622 Ga0466967_0205972
623 Ga0466967_0430778
624 Ga0466967_1575290
625 Ga0495617_233833
626 Ga0495627_156153
627 Ga0495603_0004063
628 Ga0495582_0044030
629 Ga0495605_0155216
630 Ga0495584_0132143
631 Ga0495584_0166629
632 Ga0495584_0186483
633 Ga0495585_0549316
634 Ga0495594_0103757
635 Ga0495596_0149877
636 Ga0495618_0667351
637 Ga0495628_0038960
638 Ga0495630_0229045
639 Ga0495631_0133887
640 Ga0495663_0037336
641 Ga0495642_0029899
642 Ga0495665_0664687
643 Ga0495609_0113277
644 Ga0495609_0138062
645 Ga0495645_0677750
646 Ga0495622_0416624
647 Ga0495667_0248607
648 Ga0495656_0051754
649 Ga0495656_0359682
650 Ga0495634_0842732
651 Ga0495659_0046934
652 Ga0495659_0099813
653 Ga0495661_0237838
654 Ga0495588_0555957
655 Ga0495657_0340002
656 Ga0495599_0711983
657 Ga0495647_0391301
658 Ga0495658_0205600
659 Ga0495670_0461123
660 Ga0495589_0116587
661 Ga0495636_0533508
662 Ga0495674_1117868
663 Ga0496100_0000294
664 Ga0496101_0003814
665 Ga0496101_0334754
666 Ga0496101_0576639
667 Ga0496101_0802610
668 Ga0496102_0002204
669 Ga0496102_0014221
670 Ga0496103_0033743
671 Ga0496103_0095859
672 Ga0496104_0001783
673 Ga0496104_0028387
674 Ga0496105_0006423
675 Ga0496105_0040362
676 Ga0496105_0354647
677 Ga0496106_0000725
678 Ga0496107_0000973
679 Ga0496107_0998247
680 Ga0496108_0001201
681 Ga0496108_0041291
682 Ga0496108_0062179
683 Ga0496109_0002830
684 Ga0496109_0009769
685 Ga0496109_0035315
686 Ga0496109_0105590
687 Ga0496109_0385379
688 Ga0496109_1598504
689 Ga0496110_0020480
690 Ga0496110_0079911
691 Ga0496110_0171245
692 Ga0496110_0417826
693 Ga0496110_0674056
694 Ga0496111_0006881
695 Ga0496111_0075813
696 Ga0496111_0096018
697 Ga0496111_0285144
698 Ga0496111_0330777
699 Ga0496111_1282538
700 Ga0496112_0016003
701 Ga0496112_0047849
702 Ga0496112_0287997
703 Ga0496113_0103918
704 Ga0496113_0129404
705 Ga0496113_0407693
706 Ga0496114_0000447
707 Ga0496114_0087087
708 Ga0496114_1544081
709 Ga0496115_0000276
710 Ga0496115_0284197
711 Ga0496115_1133728
712 Ga0501038_0837794
713 Ga0501048_0841050
714 Ga0501070_0147971
715 Ga0501070_0160426
716 Ga0501070_0796644
717 Ga0501072_1601439
718 Ga0501079_0135424
719 Ga0501080_0156733
720 Ga0501080_0334775
721 Ga0501044_1013698
722 nmdc:mga06z11_337347_c1
723 nmdc:mga04h51_274671_c1
724 nmdc:mga05p37_14818_c1
725 nmdc:mga06r32_241707_c1
726 nmdc:mga0n895_208748_c1
727 nmdc:mga0n895_45645_c1
728 nmdc:mga0rr50_516011_c1
729 nmdc:mga0rr50_89323_c1
730 nmdc:mga08x19_26230_c1
731 nmdc:mga0a205_161443_c1
732 nmdc:mga0a205_891110_c1
733 Ga0495601_0010767
734 Ga0495601_1019590
735 Ga0495655_0000847
736 Ga0495655_0034989
737 Ga0495595_0340558
738 Ga0495619_0295117
739 Ga0500641_0395992
740 Ga0501084_1656545
741 Ga0466962_0003620
742 Ga0530510_0244650

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zcc-assembly1.cif.gz_D crystal structure of glycerophosphodiester phosphodiesterase from agrobacterium tumefaciens str.c58 0.7884 26 79
3qz6-assembly1.cif.gz_A the crystal structure of hpch/hpai aldolase from desulfitobacterium hafniense dcb-2 0.7548 36 74
6w6a-assembly1.cif.gz_B crystal structure of a pyridoxine 5'-phosphate synthease from stenotrophomonas maltophilia k279a 0.7445 37 74
3fa5-assembly1.cif.gz_B crystal structure of a duf849 family protein (pden_3495) from paracoccus denitrificans pd1222 at 1.90 a resolution 0.725 37 62
4xwu-assembly1.cif.gz_A structure of the imp dehydrogenase from ashbya gossypii 0.7239 38 74
ID Description Score Start End Superfamily
af_I6X5C5_6_344_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.827 26 76 3.20.20.70
af_P71847_8_353_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.797 29 77 3.20.20.70
5lsmB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7717 26 75 3.20.20.70
af_Q2FXK4_2_247_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.7695 37 78 3.20.20.190
af_O06179_1_371_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7665 26 77 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7W0JKF7-F1-model_v4 Uncharacterized protein 0.9763 14 89
AF-A0A7W0JKF7-F1-model_v4 Uncharacterized protein 0.94 14 89
AF-A0A538DEU2-F1-model_v4 Uncharacterized protein 0.931 14 89
AF-A0A7V9M8X5-F1-model_v4 Uncharacterized protein 0.9072 14 89
AF-A0A538CFP9-F1-model_v4 Uncharacterized protein 0.8958 30 89

Map