F425488

General Info

Members Datasets Scaffolds Average Seq Length
370 220 365 153

Family's Representative Sequence

Representative Sequence 3300042015|Ga0439462_0001886|Ga0439462_0001886_271_804
Length 177
Sequence MRAPIAGSSRSARPIAIDIQRQEIAVSETRELSLTRYIAALPERVWDVMVNRQEEWWCPAPWRAEIDHQDRRAGGRCEMTFYGPDGEVMPQNGVYLAFDEGRRFVSTDAAVLGEDGDFEPAGPMMIGFWEIEPEGSGTRYTARARHWTDEAYEQHKAMGFEAGWGACADQLKALCEA

Samples

Sample ID Description Type Environment
1 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
2 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
3 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
4 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
5 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
6 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
130 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
137 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
150 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
151 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
152 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
153 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
154 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
157 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
158 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
159 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
160 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
163 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
164 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
165 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
166 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
167 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
172 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
173 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
174 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
185 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
197 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
198 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
201 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
202 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
203 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
206 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
207 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
208 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
209 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
210 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
211 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
212 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
213 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
214 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
215 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
216 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
217 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
218 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
219 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
220 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.65
Metatranscriptomes 0
Isolates 1.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.3
Nodule 0.27
Rhizoplane 2.43
Rhizosphere 71.08
Stem 0
Stem Tuber 0
Unclassified 8.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000009 3300001904 Bacteria 35855
2 JGI24752J21851_1000197 3300001976 Bacteria 8392
3 JGI24740J21852_10025064 3300001979 Bacteria 2015
4 JGI24739J22299_10081643 3300001989 Bacteria 992
5 JGI24737J22298_10003516 3300001990 Bacteria 5526
6 JGI24750J21931_1000176 3300002070 Bacteria 10680
7 JGI24748J21848_1000026 3300002074 Bacteria 101640
8 JGI24738J21930_10001158 3300002075 Bacteria 7458
9 JGI24749J21850_1000317 3300002076 Bacteria 7403
10 JGI24034J26672_10000015 3300002239 Bacteria 137655
11 rootL2_10298450 3300003322 Unclassified 1020
12 Ga0055530_10007811 3300003791 Bacteria 4422
13 Ga0070658_10001203 3300005327 Bacteria 22172
14 Ga0070658_10002228 3300005327 Bacteria 16261
15 Ga0070658_10058645 3300005327 Bacteria 3133
16 Ga0070658_10696860 3300005327 Bacteria 881
17 Ga0070683_100021226 3300005329 Bacteria 5792
18 Ga0070683_100531683 3300005329 Bacteria 1124
19 Ga0070690_100000025 3300005330 Bacteria 69409
20 Ga0070670_100077576 3300005331 Bacteria 2854
21 Ga0070670_100463920 3300005331 Bacteria 1123
22 Ga0070666_10000015 3300005335 Bacteria 208372
23 Ga0070680_100002003 3300005336 Bacteria 15000
24 Ga0070682_101272058 3300005337 Bacteria 624
25 Ga0070660_100000741 3300005339 Bacteria 21612
26 Ga0070660_100558689 3300005339 Bacteria 955
27 Ga0070689_100026195 3300005340 Bacteria 4389
28 Ga0070687_100204675 3300005343 Bacteria 1198
29 Ga0070661_100014128 3300005344 Bacteria 5624
30 Ga0070661_100132071 3300005344 Bacteria 1876
31 Ga0070669_100000059 3300005353 Bacteria 108504
32 Ga0070671_100009469 3300005355 Bacteria 7820
33 Ga0070688_100000464 3300005365 Bacteria 20632
34 Ga0070659_100015741 3300005366 Bacteria 5666
35 Ga0070659_100063529 3300005366 Bacteria 2921
36 Ga0070659_100318705 3300005366 Bacteria 1299
37 Ga0070659_100634431 3300005366 Bacteria 920
38 Ga0070667_100017737 3300005367 Bacteria 5900
39 Ga0070663_100325828 3300005455 Bacteria 1236
40 Ga0070663_100369449 3300005455 Bacteria 1165
41 Ga0070662_100001578 3300005457 Bacteria 14081
42 Ga0070662_100008215 3300005457 Bacteria 6797
43 Ga0070662_100551467 3300005457 Bacteria 966
44 Ga0070681_10019875 3300005458 Bacteria 6728
45 Ga0070681_11476230 3300005458 Bacteria 604
46 Ga0070685_10000247 3300005466 Bacteria 35364
47 Ga0070679_100005847 3300005530 Bacteria 11414
48 Ga0070684_100107313 3300005535 Bacteria 2501
49 Ga0070684_100108044 3300005535 Bacteria 2493
50 Ga0068853_100005757 3300005539 Bacteria 9757
51 Ga0068853_100076581 3300005539 Bacteria 2921
52 Ga0068853_100147412 3300005539 Bacteria 2116
53 Ga0068853_100761159 3300005539 Bacteria 926
54 Ga0070686_100000006 3300005544 Bacteria 243316
55 Ga0070665_100000217 3300005548 Bacteria 97947
56 Ga0068855_100009179 3300005563 Bacteria 11943
57 Ga0068855_100011302 3300005563 Bacteria 10781
58 Ga0068855_100030767 3300005563 Bacteria 6418
59 Ga0068855_100041798 3300005563 Bacteria 5432
60 Ga0068855_101438267 3300005563 Unclassified 709
61 Ga0070664_100332004 3300005564 Bacteria 1380
62 Ga0070664_100513444 3300005564 Bacteria 1105
63 Ga0070664_100799867 3300005564 Bacteria 881
64 Ga0068857_100208642 3300005577 Bacteria 1782
65 Ga0068857_100661879 3300005577 Bacteria 990
66 Ga0068857_101006177 3300005577 Bacteria 802
67 Ga0068854_100003369 3300005578 Bacteria 9958
68 Ga0068854_100086347 3300005578 Bacteria 2325
69 Ga0068856_100008906 3300005614 Bacteria 9764
70 Ga0068856_100040516 3300005614 Bacteria 4576
71 Ga0068852_100000205 3300005616 Bacteria 40110
72 Ga0068852_100029056 3300005616 Bacteria 4535
73 Ga0068852_100403302 3300005616 Bacteria 1345
74 Ga0068852_100516616 3300005616 Bacteria 1191
75 Ga0068852_100548836 3300005616 Bacteria 1156
76 Ga0068859_100000937 3300005617 Bacteria 29957
77 Ga0068864_100433460 3300005618 Unclassified 1254
78 Ga0068861_100006465 3300005719 Bacteria 7984
79 Ga0068851_10036935 3300005834 Bacteria 2448
80 Ga0068863_100000108 3300005841 Bacteria 87921
81 Ga0068858_100002534 3300005842 Bacteria 18415
82 Ga0068860_100000050 3300005843 Bacteria 208372
83 Ga0068860_100065345 3300005843 Bacteria 3455
84 Ga0068862_100000062 3300005844 Bacteria 126792
85 Ga0075365_10159696 3300006038 Bacteria 1570
86 Ga0075368_10000156 3300006042 Bacteria 18343
87 Ga0075363_100000402 3300006048 Bacteria 13283
88 Ga0075363_100085386 3300006048 Bacteria 1731
89 Ga0075364_10054346 3300006051 Bacteria 2619
90 Ga0075364_10193621 3300006051 Bacteria 1377
91 Ga0075364_10228043 3300006051 Bacteria 1265
92 Ga0075364_10819061 3300006051 Bacteria 634
93 Ga0075362_10000041 3300006177 Bacteria 45834
94 Ga0075362_10014097 3300006177 Bacteria 3219
95 Ga0075367_10120660 3300006178 Bacteria 1615
96 Ga0075367_10350245 3300006178 Bacteria 932
97 Ga0075369_10000366 3300006186 Bacteria 13518
98 Ga0075369_10088820 3300006186 Bacteria 1377
99 Ga0075369_10615503 3300006186 Bacteria 520
100 Ga0075366_10001024 3300006195 Bacteria 13705
101 Ga0075366_10188593 3300006195 Bacteria 1253
102 Ga0097621_101501292 3300006237 Bacteria 639
103 Ga0075370_10000003 3300006353 Bacteria 133163
104 Ga0075370_10023014 3300006353 Bacteria 3428
105 Ga0075370_10073705 3300006353 Bacteria 1956
106 Ga0075370_10492467 3300006353 Bacteria 739
107 Ga0097620_100000937 3300006931 Bacteria 29957
108 Ga0079104_1069284 3300006946 Bacteria 744
109 Ga0105240_10021718 3300009093 Bacteria 8531
110 Ga0105240_10452590 3300009093 Bacteria 1436
111 Ga0105247_10016358 3300009101 Bacteria 4443
112 Ga0114129_10216008 3300009147 Bacteria 2590
113 Ga0105241_10027250 3300009174 Bacteria 4255
114 Ga0105248_10044429 3300009177 Bacteria 4982
115 Ga0105237_10527231 3300009545 Bacteria 1188
116 Ga0105237_10931338 3300009545 Bacteria 876
117 Ga0105238_10097652 3300009551 Bacteria 2923
118 Ga0105238_11303919 3300009551 Unclassified 752
119 Ga0105249_10000034 3300009553 Bacteria 208378
120 Ga0105239_11605756 3300010375 Unclassified 752
121 Ga0105246_10002313 3300011119 Bacteria 11509
122 Ga0157373_10188086 3300013100 Bacteria 1455
123 Ga0157373_10408707 3300013100 Bacteria 973
124 Ga0157371_10149979 3300013102 Bacteria 1662
125 Ga0157371_10204918 3300013102 Bacteria 1415
126 Ga0157370_10004761 3300013104 Bacteria 15446
127 Ga0157370_10306634 3300013104 Bacteria 1465
128 Ga0157369_10004367 3300013105 Bacteria 16691
129 Ga0157369_10140815 3300013105 Bacteria 2552
130 Ga0157369_10210563 3300013105 Bacteria 2038
131 Ga0163162_10131264 3300013306 Bacteria 2614
132 Ga0157372_10005172 3300013307 Bacteria 13876
133 Ga0157372_10114966 3300013307 Bacteria 3085
134 Ga0157372_10511347 3300013307 Unclassified 1400
135 Ga0157372_11742731 3300013307 Bacteria 716
136 Ga0157375_11240619 3300013308 Bacteria 875
137 Ga0163163_10041149 3300014325 Bacteria 4518
138 Ga0157380_10000231 3300014326 Bacteria 33437
139 Ga0157380_10085151 3300014326 Bacteria 2594
140 Ga0157380_10758886 3300014326 Bacteria 982
141 Ga0157379_10005954 3300014968 Bacteria 10505
142 Ga0163161_10000051 3300017792 Bacteria 122360
143 Ga0163161_10012196 3300017792 Bacteria 5961
144 Ga0207672_1000434 3300025223 Bacteria 5298
145 Ga0209050_1000370 3300025298 Bacteria 85916
146 Ga0209257_1048963 3300025304 Bacteria 1206
147 Ga0207656_10008226 3300025321 Bacteria 3828
148 Ga0207710_10016504 3300025900 Bacteria 3125
149 Ga0207680_10000007 3300025903 Bacteria 623574
150 Ga0207647_10001146 3300025904 Bacteria 20388
151 Ga0207705_10000004 3300025909 Bacteria 705756
152 Ga0207705_10837155 3300025909 Bacteria 714
153 Ga0207654_10032034 3300025911 Bacteria 2900
154 Ga0207654_10247458 3300025911 Bacteria 1194
155 Ga0207707_10012769 3300025912 Bacteria 7306
156 Ga0207695_10005863 3300025913 Bacteria 16124
157 Ga0207695_10082081 3300025913 Bacteria 3260
158 Ga0207671_10000658 3300025914 Bacteria 45037
159 Ga0207660_10042182 3300025917 Bacteria 3201
160 Ga0207660_10759442 3300025917 Bacteria 791
161 Ga0207662_10364101 3300025918 Bacteria 973
162 Ga0207657_10001916 3300025919 Bacteria 22462
163 Ga0207649_10072456 3300025920 Bacteria 2204
164 Ga0207649_10163266 3300025920 Bacteria 1545
165 Ga0207652_10084814 3300025921 Bacteria 2775
166 Ga0207681_10000089 3300025923 Bacteria 79526
167 Ga0207694_10009761 3300025924 Bacteria 7243
168 Ga0207694_10017245 3300025924 Bacteria 5457
169 Ga0207644_10004047 3300025931 Bacteria 9509
170 Ga0207644_11508341 3300025931 Bacteria 564
171 Ga0207690_10004464 3300025932 Bacteria 8261
172 Ga0207690_10095964 3300025932 Bacteria 2107
173 Ga0207690_10313679 3300025932 Bacteria 1231
174 Ga0207706_10000384 3300025933 Bacteria 48339
175 Ga0207706_10037741 3300025933 Bacteria 4288
176 Ga0207706_10140233 3300025933 Bacteria 2127
177 Ga0207706_10519201 3300025933 Bacteria 1027
178 Ga0207706_11055147 3300025933 Bacteria 681
179 Ga0207691_10898722 3300025940 Bacteria 741
180 Ga0207711_10002957 3300025941 Bacteria 14862
181 Ga0207661_10014331 3300025944 Bacteria 5808
182 Ga0207661_10340444 3300025944 Bacteria 1351
183 Ga0207661_10990666 3300025944 Bacteria 774
184 Ga0207679_10017889 3300025945 Bacteria 4738
185 Ga0207679_10311998 3300025945 Unclassified 1359
186 Ga0207667_10014309 3300025949 Bacteria 9048
187 Ga0207667_10021370 3300025949 Bacteria 7172
188 Ga0207667_10060493 3300025949 Bacteria 3964
189 Ga0207667_10138732 3300025949 Bacteria 2503
190 Ga0207712_10000004 3300025961 Bacteria 614655
191 Ga0207640_10001408 3300025981 Bacteria 12992
192 Ga0207640_10024224 3300025981 Bacteria 3660
193 Ga0207640_10126561 3300025981 Bacteria 1840
194 Ga0207658_10002005 3300025986 Bacteria 15177
195 Ga0207703_10006943 3300026035 Bacteria 9011
196 Ga0207639_10002992 3300026041 Bacteria 11373
197 Ga0207639_10085885 3300026041 Bacteria 2504
198 Ga0207639_10140060 3300026041 Bacteria 2014
199 Ga0207639_10279032 3300026041 Bacteria 1469
200 Ga0207678_10014214 3300026067 Bacteria 6998
201 Ga0207678_10076235 3300026067 Bacteria 2872
202 Ga0207702_10001915 3300026078 Bacteria 20339
203 Ga0207702_10018124 3300026078 Bacteria 5825
204 Ga0207702_10067260 3300026078 Bacteria 3075
205 Ga0207641_10000428 3300026088 Bacteria 48639
206 Ga0207676_10001679 3300026095 Bacteria 16324
207 Ga0207674_10105160 3300026116 Bacteria 2801
208 Ga0207674_10577519 3300026116 Bacteria 1086
209 Ga0207675_100000449 3300026118 Bacteria 39979
210 Ga0207698_10000058 3300026142 Bacteria 78048
211 Ga0207698_10042439 3300026142 Bacteria 3398
212 Ga0207698_10330920 3300026142 Bacteria 1431
213 Ga0207698_10714371 3300026142 Bacteria 998
214 Ga0207698_10825683 3300026142 Bacteria 931
215 Ga0209371_1061019 3300027312 Bacteria 693
216 Ga0209813_10000064 3300027866 Bacteria 43230
217 Ga0209974_10009566 3300027876 Bacteria 3290
218 Ga0268266_10000225 3300028379 Bacteria 98082
219 Ga0268265_10000086 3300028380 Bacteria 119049
220 Ga0268264_10000003 3300028381 Bacteria 1141976
221 Ga0268256_1068203 3300030500 Bacteria 693
222 Ga0307408_100033511 3300031548 Bacteria 3589
223 Ga0307408_100613162 3300031548 Bacteria 968
224 Ga0307408_101385907 3300031548 Bacteria 661
225 Ga0307508_10034993 3300031616 Bacteria 4527
226 Ga0307516_10107574 3300031730 Bacteria 2597
227 Ga0307405_10001562 3300031731 Bacteria 9710
228 Ga0307405_10015498 3300031731 Bacteria 4131
229 Ga0307413_10049509 3300031824 Bacteria 2518
230 Ga0307413_10677496 3300031824 Bacteria 854
231 Ga0307410_10017152 3300031852 Bacteria 4339
232 Ga0307410_10089066 3300031852 Bacteria 2186
233 Ga0307406_10030873 3300031901 Bacteria 3258
234 Ga0307406_11396497 3300031901 Bacteria 614
235 Ga0307407_10096951 3300031903 Bacteria 1821
236 Ga0307416_100056211 3300032002 Bacteria 3174
237 Ga0307416_100087745 3300032002 Bacteria 2657
238 Ga0307414_10230273 3300032004 Bacteria 1527
239 Ga0307414_10804538 3300032004 Bacteria 857
240 Ga0307411_10055456 3300032005 Bacteria 2607
241 Ga0307411_10189205 3300032005 Bacteria 1570
242 Ga0307415_100017801 3300032126 Bacteria 4270
243 Ga0307415_100900475 3300032126 Bacteria 815
244 Ga0373962_0319383 3300035242 Unclassified 555
245 Ga0395905_0209163 3300037471 Bacteria 1828
246 Ga0451837_0775267 3300041494 Bacteria 626
247 Ga0451841_0385646 3300041498 Bacteria 697
248 Ga0451849_0159861 3300041505 Bacteria 541
249 Ga0451849_0753026 3300041505 Bacteria 665
250 Ga0451853_0292995 3300041512 Bacteria 680
251 Ga0451853_1673892 3300041512 Bacteria 974
252 Ga0451853_2494175 3300041512 Bacteria 1618
253 Ga0439462_0001886 3300042015 Bacteria 4767
254 Ga0495627_000217 3300046453 Bacteria 62536
255 Ga0495638_0107174 3300046460 Bacteria 1664
256 Ga0495650_0028107 3300046471 Bacteria 2588
257 Ga0495650_0241622 3300046471 Bacteria 616
258 Ga0495639_0035726 3300046475 Bacteria 2224
259 Ga0495639_0320893 3300046475 Bacteria 774
260 Ga0495596_0000133 3300046500 Bacteria 51283
261 Ga0495596_0000472 3300046500 Bacteria 25455
262 Ga0495607_0023453 3300046501 Bacteria 3863
263 Ga0495607_0121106 3300046501 Bacteria 1373
264 Ga0495583_0106776 3300046506 Bacteria 1190
265 Ga0495606_0039686 3300046507 Bacteria 3169
266 Ga0495606_0046892 3300046507 Bacteria 2853
267 Ga0495610_0000030 3300046512 Bacteria 265950
268 Ga0495610_0000269 3300046512 Bacteria 54194
269 Ga0495610_0005287 3300046512 Bacteria 9233
270 Ga0495620_0017234 3300046515 Bacteria 3607
271 Ga0495620_0022429 3300046515 Bacteria 3040
272 Ga0495632_0006048 3300046519 Bacteria 7856
273 Ga0495632_0092302 3300046519 Bacteria 1434
274 Ga0495643_0000207 3300046522 Bacteria 90642
275 Ga0495643_0048221 3300046522 Bacteria 2303
276 Ga0495643_0073216 3300046522 Bacteria 1795
277 Ga0495643_0119837 3300046522 Bacteria 1330
278 Ga0495654_0022927 3300046530 Bacteria 3237
279 Ga0495598_0028452 3300046537 Bacteria 1550
280 Ga0495609_0002701 3300046538 Bacteria 10706
281 Ga0495668_0214345 3300046616 Bacteria 1054
282 Ga0495625_0019830 3300046660 Bacteria 5204
283 Ga0495625_0148883 3300046660 Bacteria 1575
284 Ga0495670_0142301 3300046691 Bacteria 1255
285 Ga0495671_0070828 3300046692 Bacteria 1713
286 Ga0495681_0000011 3300047470 Bacteria 201843
287 Ga0495626_0004679 3300048091 Bacteria 8305
288 Ga0496100_0307900 3300048903 Unclassified 1187
289 Ga0496101_0273600 3300048904 Bacteria 1319
290 Ga0496103_0007410 3300048906 Bacteria 6538
291 Ga0496104_0169101 3300048907 Bacteria 2096
292 Ga0496104_1395518 3300048907 Bacteria 603
293 Ga0496105_0029257 3300048908 Bacteria 4509
294 Ga0496105_0156907 3300048908 Bacteria 1869
295 Ga0496106_0082870 3300048909 Bacteria 2466
296 Ga0496107_0009533 3300048910 Bacteria 6737
297 Ga0496116_0000028 3300048919 Bacteria 424086
298 Ga0496116_0017279 3300048919 Bacteria 5609
299 Ga0496117_0019418 3300048920 Bacteria 5582
300 Ga0496119_0091033 3300048922 Bacteria 1733
301 Ga0496120_0090251 3300048923 Bacteria 1639
302 Ga0496121_0000861 3300048924 Bacteria 54871
303 Ga0496121_0272333 3300048924 Bacteria 1163
304 Ga0496122_0006585 3300048925 Bacteria 13256
305 Ga0496122_0028719 3300048925 Bacteria 4709
306 Ga0496122_0233235 3300048925 Bacteria 1044
307 Ga0496123_0000542 3300048926 Bacteria 64858
308 Ga0496123_0000705 3300048926 Bacteria 54647
309 Ga0496123_0129817 3300048926 Bacteria 1399
310 Ga0496124_0006222 3300048927 Bacteria 13076
311 Ga0496124_0017119 3300048927 Bacteria 6851
312 Ga0496125_0109492 3300048928 Bacteria 2005
313 Ga0496125_0171739 3300048928 Bacteria 1456
314 Ga0496125_0174888 3300048928 Bacteria 1438
315 Ga0496126_0000079 3300048929 Bacteria 222463
316 Ga0496126_0054651 3300048929 Bacteria 3615
317 Ga0496126_0519465 3300048929 Bacteria 949
318 Ga0501034_0055048 3300049571 Bacteria 4004
319 Ga0501034_0269749 3300049571 Bacteria 1643
320 Ga0501047_0195851 3300049581 Bacteria 1883
321 Ga0501047_0835671 3300049581 Bacteria 735
322 Ga0501035_0163152 3300049822 Bacteria 1928
323 Ga0501044_0002114 3300049823 Bacteria 22843
324 Ga0501044_0170763 3300049823 Bacteria 2146
325 Ga0501044_0425095 3300049823 Bacteria 1238
326 nmdc:mga03683_192_c1 3300050489 Bacteria 20102
327 nmdc:mga03683_503_c1 3300050489 Bacteria 11183
328 nmdc:mga03n38_11951_c1 3300050490 Bacteria 3251
329 nmdc:mga03n38_32051_c1 3300050490 Bacteria 2223
330 nmdc:mga00v17_10846_c1 3300050491 Bacteria 4993
331 nmdc:mga00v17_118898_c1 3300050491 Bacteria 1682
332 nmdc:mga00v17_26017_c1 3300050491 Bacteria 3405
333 nmdc:mga0yw44_247187_c1 3300050492 Bacteria 1187
334 nmdc:mga0yw44_593254_c1 3300050492 Bacteria 753
335 nmdc:mga0k408_32254_c1 3300050493 Bacteria 2993
336 nmdc:mga06z11_230_c1 3300050494 Bacteria 21729
337 nmdc:mga06z11_293239_c1 3300050494 Bacteria 966
338 nmdc:mga04h51_397_c1 3300050495 Bacteria 10573
339 nmdc:mga07m45_40334_c1 3300050496 Bacteria 2612
340 nmdc:mga07m45_53863_c2 3300050496 Bacteria 1836
341 nmdc:mga07m45_55_c1 3300050496 Bacteria 47453
342 nmdc:mga07m45_6_c1 3300050496 Bacteria 260521
343 nmdc:mga07m45_886_c1 3300050496 Bacteria 12563
344 nmdc:mga05p37_484824_c1 3300050507 Bacteria 1423
345 nmdc:mga0sz30_165650_c2 3300050516 Bacteria 651
346 nmdc:mga0sz30_535_c1 3300050516 Bacteria 14126
347 nmdc:mga0sz30_546_c1 3300050516 Bacteria 14048
348 Ga0500643_022358 3300053087 Bacteria 2036
349 Ga0500643_178595 3300053087 Bacteria 569
350 Ga0500644_0249235 3300053088 Bacteria 748
351 Ga0500566_0262494 3300053094 Bacteria 833
352 Ga0500566_0263838 3300053094 Bacteria 830
353 Ga0500594_0027447 3300053118 Bacteria 1474
354 Ga0500594_0233400 3300053118 Bacteria 610
355 Ga0500607_000007 3300053121 Bacteria 134097
356 Ga0500608_000156 3300053122 Bacteria 28195
357 Ga0500559_0001181 3300053136 Bacteria 15619
358 Ga0500559_0031143 3300053136 Bacteria 2288
359 Ga0500564_001739 3300053138 Bacteria 7699
360 Ga0500588_0027573 3300053146 Bacteria 1601
361 Ga0500616_0021082 3300053153 Bacteria 3658
362 Ga0500622_0000145 3300053156 Bacteria 75417
363 Ga0500567_002196 3300053723 Bacteria 8268
364 Ga0500625_000021 3300053729 Bacteria 83503
365 Ga0500645_002010 3300053730 Bacteria 9526

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046507 Ga0495606_0046892 Ga0495606_0046892_2456_2842 128
2 3300048928 Ga0496125_0171739 Ga0496125_0171739_1052_1438 128
3 3300046506 Ga0495583_0106776 Ga0495583_0106776_14_412 132
4 3300025917 Ga0207660_10759442 Ga0207660_107594422 134
5 3300048923 Ga0496120_0090251 Ga0496120_0090251_40_456 138
6 3300005535 Ga0070684_100108044 Ga0070684_1001080444 142
7 3300005616 Ga0068852_100548836 Ga0068852_1005488362 142
8 3300013308 Ga0157375_11240619 Ga0157375_112406192 142
9 3300025944 Ga0207661_10340444 Ga0207661_103404442 142
10 3300026142 Ga0207698_10825683 Ga0207698_108256832 142
11 3300046475 Ga0495639_0320893 Ga0495639_0320893_300_761 142
12 3300048907 Ga0496104_1395518 Ga0496104_1395518_127_588 142
13 3300048908 Ga0496105_0156907 Ga0496105_0156907_81_542 142
14 3300013102 Ga0157371_10204918 Ga0157371_102049182 143
15 3300013105 Ga0157369_10140815 Ga0157369_101408152 143
16 3300013307 Ga0157372_11742731 Ga0157372_117427311 143
17 3300025933 Ga0207706_11055147 Ga0207706_110551471 144
18 3300041505 Ga0451849_0159861 Ga0451849_0159861_16_450 144
19 iso_pu_bacteria 8054302542 8054305865 144
20 3300006237 Ga0097621_101501292 Ga0097621_1015012921 145
21 iso_pu_bacteria 2510917021 2511125753 145
22 iso_pu_bacteria 2643221588 2643949860 145
23 iso_pu_bacteria 2882806704 2882807495 145
24 3300005327 Ga0070658_10001203 Ga0070658_1000120318 146
25 3300005457 Ga0070662_100008215 Ga0070662_1000082156 146
26 3300005458 Ga0070681_11476230 Ga0070681_114762302 146
27 3300005539 Ga0068853_100147412 Ga0068853_1001474122 146
28 3300005539 Ga0068853_100761159 Ga0068853_1007611592 146
29 3300005563 Ga0068855_100009179 Ga0068855_1000091794 146
30 3300005563 Ga0068855_100041798 Ga0068855_1000417984 146
31 3300005578 Ga0068854_100003369 Ga0068854_10000336910 146
32 3300005614 Ga0068856_100040516 Ga0068856_1000405162 146
33 3300005616 Ga0068852_100000205 Ga0068852_10000020527 146
34 3300005616 Ga0068852_100029056 Ga0068852_1000290564 146
35 3300005843 Ga0068860_100065345 Ga0068860_1000653454 146
36 3300009093 Ga0105240_10021718 Ga0105240_100217184 146
37 3300009545 Ga0105237_10527231 Ga0105237_105272313 146
38 3300009551 Ga0105238_10097652 Ga0105238_100976524 146
39 3300011119 Ga0105246_10002313 Ga0105246_1000231312 146
40 3300013100 Ga0157373_10408707 Ga0157373_104087072 146
41 3300025909 Ga0207705_10000004 Ga0207705_10000004125 146
42 3300025913 Ga0207695_10082081 Ga0207695_100820814 146
43 3300025924 Ga0207694_10009761 Ga0207694_1000976111 146
44 3300025933 Ga0207706_10037741 Ga0207706_100377418 146
45 3300025949 Ga0207667_10060493 Ga0207667_100604932 146
46 3300025981 Ga0207640_10001408 Ga0207640_100014087 146
47 3300026041 Ga0207639_10085885 Ga0207639_100858853 146
48 3300026078 Ga0207702_10018124 Ga0207702_100181247 146
49 3300026142 Ga0207698_10000058 Ga0207698_1000005866 146
50 3300026142 Ga0207698_10330920 Ga0207698_103309202 146
51 3300027876 Ga0209974_10009566 Ga0209974_100095665 146
52 3300031616 Ga0307508_10034993 Ga0307508_100349933 146
53 3300031730 Ga0307516_10107574 Ga0307516_101075743 146
54 3300041512 Ga0451853_0292995 Ga0451853_0292995_100_540 146
55 3300006038 Ga0075365_10159696 Ga0075365_101596961 147
56 3300006042 Ga0075368_10000156 Ga0075368_1000015614 147
57 3300006048 Ga0075363_100085386 Ga0075363_1000853864 147
58 3300006051 Ga0075364_10193621 Ga0075364_101936211 147
59 3300006051 Ga0075364_10819061 Ga0075364_108190612 147
60 3300006177 Ga0075362_10014097 Ga0075362_100140973 147
61 3300006178 Ga0075367_10120660 Ga0075367_101206602 147
62 3300006186 Ga0075369_10088820 Ga0075369_100888203 147
63 3300006186 Ga0075369_10615503 Ga0075369_106155031 147
64 3300006353 Ga0075370_10492467 Ga0075370_104924672 147
65 3300027866 Ga0209813_10000064 Ga0209813_1000006425 147
66 3300032004 Ga0307414_10230273 Ga0307414_102302732 147
67 3300032004 Ga0307414_10804538 Ga0307414_108045382 147
68 3300050489 nmdc:mga03683_503_c1 nmdc:mga03683_503_c1_3392_3835 147
69 3300050490 nmdc:mga03n38_11951_c1 nmdc:mga03n38_11951_c1_758_1201 147
70 3300050491 nmdc:mga00v17_10846_c1 nmdc:mga00v17_10846_c1_167_610 147
71 3300050491 nmdc:mga00v17_118898_c1 nmdc:mga00v17_118898_c1_915_1358 147
72 3300050492 nmdc:mga0yw44_247187_c1 nmdc:mga0yw44_247187_c1_360_803 147
73 3300050492 nmdc:mga0yw44_593254_c1 nmdc:mga0yw44_593254_c1_162_605 147
74 3300050494 nmdc:mga06z11_230_c1 nmdc:mga06z11_230_c1_5437_5880 147
75 3300050495 nmdc:mga04h51_397_c1 nmdc:mga04h51_397_c1_2693_3136 147
76 3300050496 nmdc:mga07m45_55_c1 nmdc:mga07m45_55_c1_40165_40608 147
77 3300050516 nmdc:mga0sz30_165650_c2 nmdc:mga0sz30_165650_c2_30_473 147
78 3300050516 nmdc:mga0sz30_546_c1 nmdc:mga0sz30_546_c1_13427_13870 147
79 iso_pu_bacteria 2818991438 2819553094 147
80 3300003322 rootL2_10298450 rootL2_102984501 148
81 3300005327 Ga0070658_10696860 Ga0070658_106968602 148
82 3300005366 Ga0070659_100634431 Ga0070659_1006344312 148
83 3300025909 Ga0207705_10837155 Ga0207705_108371551 148
84 3300049822 Ga0501035_0163152 Ga0501035_0163152_1131_1577 148
85 3300049823 Ga0501044_0425095 Ga0501044_0425095_219_665 148
86 3300053118 Ga0500594_0233400 Ga0500594_0233400_75_527 148
87 3300053153 Ga0500616_0021082 Ga0500616_0021082_1181_1627 148
88 3300006195 Ga0075366_10001024 Ga0075366_100010248 149
89 3300006195 Ga0075366_10188593 Ga0075366_101885933 149
90 3300006353 Ga0075370_10023014 Ga0075370_100230143 149
91 3300006946 Ga0079104_1069284 Ga0079104_10692841 149
92 3300009147 Ga0114129_10216008 Ga0114129_102160084 149
93 3300025304 Ga0209257_1048963 Ga0209257_10489631 149
94 3300031548 Ga0307408_100033511 Ga0307408_1000335115 149
95 3300031548 Ga0307408_101385907 Ga0307408_1013859072 149
96 3300031731 Ga0307405_10001562 Ga0307405_1000156211 149
97 3300031731 Ga0307405_10015498 Ga0307405_100154984 149
98 3300031824 Ga0307413_10049509 Ga0307413_100495092 149
99 3300031852 Ga0307410_10017152 Ga0307410_100171527 149
100 3300031852 Ga0307410_10089066 Ga0307410_100890663 149
101 3300031903 Ga0307407_10096951 Ga0307407_100969514 149
102 3300032002 Ga0307416_100056211 Ga0307416_1000562113 149
103 3300032002 Ga0307416_100087745 Ga0307416_1000877451 149
104 3300032005 Ga0307411_10055456 Ga0307411_100554564 149
105 3300032126 Ga0307415_100017801 Ga0307415_1000178014 149
106 3300037471 Ga0395905_0209163 Ga0395905_0209163_944_1393 149
107 3300046453 Ga0495627_000217 Ga0495627_000217_10613_11062 149
108 3300046460 Ga0495638_0107174 Ga0495638_0107174_569_1018 149
109 3300046471 Ga0495650_0028107 Ga0495650_0028107_2032_2481 149
110 3300046500 Ga0495596_0000133 Ga0495596_0000133_5816_6265 149
111 3300046501 Ga0495607_0023453 Ga0495607_0023453_2630_3079 149
112 3300046501 Ga0495607_0121106 Ga0495607_0121106_485_934 149
113 3300046507 Ga0495606_0039686 Ga0495606_0039686_995_1444 149
114 3300046512 Ga0495610_0000030 Ga0495610_0000030_106064_106513 149
115 3300046512 Ga0495610_0000269 Ga0495610_0000269_49591_50040 149
116 3300046515 Ga0495620_0017234 Ga0495620_0017234_1905_2354 149
117 3300046515 Ga0495620_0022429 Ga0495620_0022429_2226_2675 149
118 3300046519 Ga0495632_0006048 Ga0495632_0006048_5880_6329 149
119 3300046519 Ga0495632_0092302 Ga0495632_0092302_441_890 149
120 3300046522 Ga0495643_0000207 Ga0495643_0000207_44759_45208 149
121 3300046522 Ga0495643_0048221 Ga0495643_0048221_654_1103 149
122 3300046522 Ga0495643_0073216 Ga0495643_0073216_1131_1580 149
123 3300046522 Ga0495643_0119837 Ga0495643_0119837_228_677 149
124 3300046530 Ga0495654_0022927 Ga0495654_0022927_2732_3181 149
125 3300046538 Ga0495609_0002701 Ga0495609_0002701_4657_5106 149
126 3300046660 Ga0495625_0019830 Ga0495625_0019830_166_615 149
127 3300046691 Ga0495670_0142301 Ga0495670_0142301_413_862 149
128 3300046692 Ga0495671_0070828 Ga0495671_0070828_322_771 149
129 3300047470 Ga0495681_0000011 Ga0495681_0000011_107658_108107 149
130 3300049571 Ga0501034_0055048 Ga0501034_0055048_60_509 149
131 3300049581 Ga0501047_0835671 Ga0501047_0835671_239_688 149
132 3300049823 Ga0501044_0002114 Ga0501044_0002114_8362_8811 149
133 3300050493 nmdc:mga0k408_32254_c1 nmdc:mga0k408_32254_c1_1645_2106 149
134 3300050496 nmdc:mga07m45_53863_c2 nmdc:mga07m45_53863_c2_158_607 149
135 3300050496 nmdc:mga07m45_886_c1 nmdc:mga07m45_886_c1_8334_8783 149
136 3300050507 nmdc:mga05p37_484824_c1 nmdc:mga05p37_484824_c1_561_1010 149
137 3300053087 Ga0500643_022358 Ga0500643_022358_642_1091 149
138 3300053087 Ga0500643_178595 Ga0500643_178595_12_461 149
139 3300053094 Ga0500566_0262494 Ga0500566_0262494_162_611 149
140 3300053094 Ga0500566_0263838 Ga0500566_0263838_198_647 149
141 3300053121 Ga0500607_000007 Ga0500607_000007_114859_115308 149
142 3300053136 Ga0500559_0001181 Ga0500559_0001181_10807_11256 149
143 3300053156 Ga0500622_0000145 Ga0500622_0000145_22656_23105 149
144 3300053730 Ga0500645_002010 Ga0500645_002010_5134_5583 149
145 3300005331 Ga0070670_100463920 Ga0070670_1004639202 150
146 3300005577 Ga0068857_100208642 Ga0068857_1002086423 150
147 3300006051 Ga0075364_10054346 Ga0075364_100543463 150
148 3300026116 Ga0207674_10577519 Ga0207674_105775191 150
149 3300003791 Ga0055530_10007811 Ga0055530_100078114 151
150 3300025298 Ga0209050_1000370 Ga0209050_100037022 151
151 3300027312 Ga0209371_1061019 Ga0209371_10610191 151
152 3300030500 Ga0268256_1068203 Ga0268256_10682031 151
153 3300031901 Ga0307406_11396497 Ga0307406_113964971 151
154 3300041494 Ga0451837_0775267 Ga0451837_0775267_51_506 151
155 3300041498 Ga0451841_0385646 Ga0451841_0385646_60_518 151
156 3300041505 Ga0451849_0753026 Ga0451849_0753026_180_647 151
157 3300046500 Ga0495596_0000472 Ga0495596_0000472_6166_6624 151
158 3300046512 Ga0495610_0005287 Ga0495610_0005287_811_1269 151
159 3300046616 Ga0495668_0214345 Ga0495668_0214345_126_584 151
160 3300048091 Ga0495626_0004679 Ga0495626_0004679_2726_3184 151
161 3300048919 Ga0496116_0000028 Ga0496116_0000028_124168_124626 151
162 3300048920 Ga0496117_0019418 Ga0496117_0019418_4352_4810 151
163 3300048924 Ga0496121_0000861 Ga0496121_0000861_48705_49163 151
164 3300048925 Ga0496122_0028719 Ga0496122_0028719_1280_1738 151
165 3300048925 Ga0496122_0233235 Ga0496122_0233235_30_488 151
166 3300048926 Ga0496123_0000705 Ga0496123_0000705_38445_38903 151
167 3300048927 Ga0496124_0006222 Ga0496124_0006222_8076_8534 151
168 3300048927 Ga0496124_0017119 Ga0496124_0017119_5338_5796 151
169 3300048928 Ga0496125_0109492 Ga0496125_0109492_86_544 151
170 3300048929 Ga0496126_0000079 Ga0496126_0000079_118193_118651 151
171 3300014326 Ga0157380_10758886 Ga0157380_107588861 152
172 3300025931 Ga0207644_11508341 Ga0207644_115083411 152
173 3300025940 Ga0207691_10898722 Ga0207691_108987221 152
174 3300041512 Ga0451853_1673892 Ga0451853_1673892_222_680 152
175 3300041512 Ga0451853_2494175 Ga0451853_2494175_168_626 152
176 3300042015 Ga0439462_0001886 Ga0439462_0001886_271_804 152
177 3300046471 Ga0495650_0241622 Ga0495650_0241622_25_483 152
178 3300046475 Ga0495639_0035726 Ga0495639_0035726_1012_1476 152
179 3300048926 Ga0496123_0129817 Ga0496123_0129817_504_962 152
180 3300053088 Ga0500644_0249235 Ga0500644_0249235_49_516 152
181 3300053118 Ga0500594_0027447 Ga0500594_0027447_574_1038 152
182 3300053122 Ga0500608_000156 Ga0500608_000156_21420_21884 152
183 3300053136 Ga0500559_0031143 Ga0500559_0031143_92_559 152
184 3300053138 Ga0500564_001739 Ga0500564_001739_2962_3426 152
185 3300053146 Ga0500588_0027573 Ga0500588_0027573_14_472 152
186 3300053723 Ga0500567_002196 Ga0500567_002196_1800_2264 152
187 3300053729 Ga0500625_000021 Ga0500625_000021_57739_58203 152
188 3300005329 Ga0070683_100531683 Ga0070683_1005316831 153
189 3300005337 Ga0070682_101272058 Ga0070682_1012720581 153
190 3300005366 Ga0070659_100015741 Ga0070659_1000157412 153
191 3300005455 Ga0070663_100325828 Ga0070663_1003258282 153
192 3300005457 Ga0070662_100551467 Ga0070662_1005514672 153
193 3300005564 Ga0070664_100799867 Ga0070664_1007998672 153
194 3300005577 Ga0068857_100661879 Ga0068857_1006618791 153
195 3300006048 Ga0075363_100000402 Ga0075363_10000040210 153
196 3300006051 Ga0075364_10228043 Ga0075364_102280433 153
197 3300006177 Ga0075362_10000041 Ga0075362_1000004133 153
198 3300006178 Ga0075367_10350245 Ga0075367_103502452 153
199 3300006186 Ga0075369_10000366 Ga0075369_1000036615 153
200 3300006353 Ga0075370_10000003 Ga0075370_10000003124 153
201 3300006353 Ga0075370_10073705 Ga0075370_100737052 153
202 3300014326 Ga0157380_10085151 Ga0157380_100851513 153
203 3300025933 Ga0207706_10519201 Ga0207706_105192012 153
204 3300025944 Ga0207661_10990666 Ga0207661_109906662 153
205 3300025945 Ga0207679_10017889 Ga0207679_100178899 153
206 3300026067 Ga0207678_10014214 Ga0207678_100142143 153
207 3300031548 Ga0307408_100613162 Ga0307408_1006131622 153
208 3300031824 Ga0307413_10677496 Ga0307413_106774961 153
209 3300031901 Ga0307406_10030873 Ga0307406_100308733 153
210 3300032005 Ga0307411_10189205 Ga0307411_101892052 153
211 3300032126 Ga0307415_100900475 Ga0307415_1009004752 153
212 3300035242 Ga0373962_0319383 Ga0373962_0319383_28_489 153
213 3300046537 Ga0495598_0028452 Ga0495598_0028452_463_924 153
214 3300046660 Ga0495625_0148883 Ga0495625_0148883_520_990 153
215 3300048925 Ga0496122_0006585 Ga0496122_0006585_6930_7400 153
216 3300048926 Ga0496123_0000542 Ga0496123_0000542_46606_47076 153
217 3300048929 Ga0496126_0054651 Ga0496126_0054651_1421_1891 153
218 3300048929 Ga0496126_0519465 Ga0496126_0519465_171_641 153
219 3300050489 nmdc:mga03683_192_c1 nmdc:mga03683_192_c1_19160_19621 153
220 3300050490 nmdc:mga03n38_32051_c1 nmdc:mga03n38_32051_c1_1329_1790 153
221 3300050491 nmdc:mga00v17_26017_c1 nmdc:mga00v17_26017_c1_186_647 153
222 3300050494 nmdc:mga06z11_293239_c1 nmdc:mga06z11_293239_c1_187_648 153
223 3300050496 nmdc:mga07m45_40334_c1 nmdc:mga07m45_40334_c1_890_1351 153
224 3300050496 nmdc:mga07m45_6_c1 nmdc:mga07m45_6_c1_19238_19699 153
225 3300050516 nmdc:mga0sz30_535_c1 nmdc:mga0sz30_535_c1_9160_9621 153
226 3300017792 Ga0163161_10012196 Ga0163161_100121968 154
227 3300001976 JGI24752J21851_1000197 JGI24752J21851_10001974 157
228 3300002070 JGI24750J21931_1000176 JGI24750J21931_100017611 157
229 3300002074 JGI24748J21848_1000026 JGI24748J21848_1000026111 157
230 3300002076 JGI24749J21850_1000317 JGI24749J21850_10003175 157
231 3300002239 JGI24034J26672_10000015 JGI24034J26672_1000001552 157
232 3300005327 Ga0070658_10002228 Ga0070658_1000222817 157
233 3300005329 Ga0070683_100021226 Ga0070683_1000212269 157
234 3300005330 Ga0070690_100000025 Ga0070690_10000002550 157
235 3300005331 Ga0070670_100077576 Ga0070670_1000775763 157
236 3300005335 Ga0070666_10000015 Ga0070666_10000015177 157
237 3300005336 Ga0070680_100002003 Ga0070680_10000200314 157
238 3300005339 Ga0070660_100000741 Ga0070660_10000074112 157
239 3300005339 Ga0070660_100558689 Ga0070660_1005586892 157
240 3300005340 Ga0070689_100026195 Ga0070689_1000261952 157
241 3300005343 Ga0070687_100204675 Ga0070687_1002046751 157
242 3300005344 Ga0070661_100014128 Ga0070661_1000141288 157
243 3300005353 Ga0070669_100000059 Ga0070669_10000005977 157
244 3300005355 Ga0070671_100009469 Ga0070671_10000946910 157
245 3300005365 Ga0070688_100000464 Ga0070688_1000004641 157
246 3300005366 Ga0070659_100063529 Ga0070659_1000635293 157
247 3300005367 Ga0070667_100017737 Ga0070667_1000177375 157
248 3300005457 Ga0070662_100001578 Ga0070662_1000015782 157
249 3300005458 Ga0070681_10019875 Ga0070681_100198758 157
250 3300005466 Ga0070685_10000247 Ga0070685_1000024728 157
251 3300005530 Ga0070679_100005847 Ga0070679_1000058471 157
252 3300005535 Ga0070684_100107313 Ga0070684_1001073132 157
253 3300005539 Ga0068853_100005757 Ga0068853_10000575712 157
254 3300005539 Ga0068853_100076581 Ga0068853_1000765815 157
255 3300005544 Ga0070686_100000006 Ga0070686_10000000676 157
256 3300005548 Ga0070665_100000217 Ga0070665_10000021763 157
257 3300005563 Ga0068855_100011302 Ga0068855_10001130215 157
258 3300005563 Ga0068855_100030767 Ga0068855_1000307677 157
259 3300005564 Ga0070664_100332004 Ga0070664_1003320042 157
260 3300005578 Ga0068854_100086347 Ga0068854_1000863472 157
261 3300005614 Ga0068856_100008906 Ga0068856_10000890614 157
262 3300005616 Ga0068852_100516616 Ga0068852_1005166161 157
263 3300005617 Ga0068859_100000937 Ga0068859_10000093710 157
264 3300005618 Ga0068864_100433460 Ga0068864_1004334601 157
265 3300005719 Ga0068861_100006465 Ga0068861_10000646510 157
266 3300005841 Ga0068863_100000108 Ga0068863_10000010850 157
267 3300005842 Ga0068858_100002534 Ga0068858_10000253411 157
268 3300005843 Ga0068860_100000050 Ga0068860_100000050178 157
269 3300005844 Ga0068862_100000062 Ga0068862_10000006251 157
270 3300006931 Ga0097620_100000937 Ga0097620_10000093728 157
271 3300009101 Ga0105247_10016358 Ga0105247_100163584 157
272 3300009174 Ga0105241_10027250 Ga0105241_100272502 157
273 3300009177 Ga0105248_10044429 Ga0105248_100444296 157
274 3300009553 Ga0105249_10000034 Ga0105249_1000003449 157
275 3300013100 Ga0157373_10188086 Ga0157373_101880862 157
276 3300013102 Ga0157371_10149979 Ga0157371_101499793 157
277 3300013104 Ga0157370_10004761 Ga0157370_100047616 157
278 3300013105 Ga0157369_10004367 Ga0157369_1000436714 157
279 3300013306 Ga0163162_10131264 Ga0163162_101312644 157
280 3300013307 Ga0157372_10005172 Ga0157372_1000517216 157
281 3300013307 Ga0157372_10114966 Ga0157372_101149663 157
282 3300014325 Ga0163163_10041149 Ga0163163_100411492 157
283 3300014326 Ga0157380_10000231 Ga0157380_1000023118 157
284 3300014968 Ga0157379_10005954 Ga0157379_1000595411 157
285 3300017792 Ga0163161_10000051 Ga0163161_10000051103 157
286 3300025223 Ga0207672_1000434 Ga0207672_10004344 157
287 3300025900 Ga0207710_10016504 Ga0207710_100165042 157
288 3300025903 Ga0207680_10000007 Ga0207680_10000007453 157
289 3300025911 Ga0207654_10247458 Ga0207654_102474582 157
290 3300025912 Ga0207707_10012769 Ga0207707_100127692 157
291 3300025917 Ga0207660_10042182 Ga0207660_100421824 157
292 3300025918 Ga0207662_10364101 Ga0207662_103641012 157
293 3300025919 Ga0207657_10001916 Ga0207657_1000191613 157
294 3300025920 Ga0207649_10072456 Ga0207649_100724563 157
295 3300025921 Ga0207652_10084814 Ga0207652_100848142 157
296 3300025923 Ga0207681_10000089 Ga0207681_1000008961 157
297 3300025931 Ga0207644_10004047 Ga0207644_100040473 157
298 3300025932 Ga0207690_10004464 Ga0207690_100044645 157
299 3300025932 Ga0207690_10313679 Ga0207690_103136792 157
300 3300025933 Ga0207706_10000384 Ga0207706_1000038428 157
301 3300025941 Ga0207711_10002957 Ga0207711_1000295715 157
302 3300025944 Ga0207661_10014331 Ga0207661_100143312 157
303 3300025949 Ga0207667_10014309 Ga0207667_1001430913 157
304 3300025949 Ga0207667_10021370 Ga0207667_100213702 157
305 3300025961 Ga0207712_10000004 Ga0207712_10000004441 157
306 3300025981 Ga0207640_10024224 Ga0207640_100242245 157
307 3300025986 Ga0207658_10002005 Ga0207658_1000200510 157
308 3300026035 Ga0207703_10006943 Ga0207703_100069437 157
309 3300026041 Ga0207639_10002992 Ga0207639_1000299216 157
310 3300026041 Ga0207639_10279032 Ga0207639_102790322 157
311 3300026078 Ga0207702_10067260 Ga0207702_100672605 157
312 3300026088 Ga0207641_10000428 Ga0207641_100004283 157
313 3300026095 Ga0207676_10001679 Ga0207676_100016792 157
314 3300026116 Ga0207674_10105160 Ga0207674_101051605 157
315 3300026118 Ga0207675_100000449 Ga0207675_10000044912 157
316 3300026142 Ga0207698_10042439 Ga0207698_100424393 157
317 3300028379 Ga0268266_10000225 Ga0268266_1000022550 157
318 3300028380 Ga0268265_10000086 Ga0268265_1000008693 157
319 3300028381 Ga0268264_10000003 Ga0268264_10000003455 157
320 3300048903 Ga0496100_0307900 Ga0496100_0307900_154_627 157
321 3300048904 Ga0496101_0273600 Ga0496101_0273600_181_654 157
322 3300048906 Ga0496103_0007410 Ga0496103_0007410_1644_2117 157
323 3300048907 Ga0496104_0169101 Ga0496104_0169101_446_919 157
324 3300048908 Ga0496105_0029257 Ga0496105_0029257_1931_2404 157
325 3300048909 Ga0496106_0082870 Ga0496106_0082870_1725_2198 157
326 3300048910 Ga0496107_0009533 Ga0496107_0009533_1809_2282 157
327 3300048919 Ga0496116_0017279 Ga0496116_0017279_5013_5486 157
328 3300048922 Ga0496119_0091033 Ga0496119_0091033_482_955 157
329 3300048924 Ga0496121_0272333 Ga0496121_0272333_282_755 157
330 3300048928 Ga0496125_0174888 Ga0496125_0174888_401_874 157
331 3300049571 Ga0501034_0269749 Ga0501034_0269749_497_970 157
332 3300049581 Ga0501047_0195851 Ga0501047_0195851_829_1302 157
333 3300049823 Ga0501044_0170763 Ga0501044_0170763_900_1373 157
334 3300001904 JGI24736J21556_1000009 JGI24736J21556_100000939 163
335 3300001979 JGI24740J21852_10025064 JGI24740J21852_100250642 163
336 3300001989 JGI24739J22299_10081643 JGI24739J22299_100816432 163
337 3300001990 JGI24737J22298_10003516 JGI24737J22298_100035168 163
338 3300002075 JGI24738J21930_10001158 JGI24738J21930_100011583 163
339 3300005327 Ga0070658_10058645 Ga0070658_100586454 163
340 3300005344 Ga0070661_100132071 Ga0070661_1001320712 163
341 3300005366 Ga0070659_100318705 Ga0070659_1003187052 163
342 3300005455 Ga0070663_100369449 Ga0070663_1003694492 163
343 3300005563 Ga0068855_101438267 Ga0068855_1014382672 163
344 3300005564 Ga0070664_100513444 Ga0070664_1005134442 163
345 3300005577 Ga0068857_101006177 Ga0068857_1010061772 163
346 3300005616 Ga0068852_100403302 Ga0068852_1004033022 163
347 3300005834 Ga0068851_10036935 Ga0068851_100369352 163
348 3300009093 Ga0105240_10452590 Ga0105240_104525902 163
349 3300009545 Ga0105237_10931338 Ga0105237_109313382 163
350 3300009551 Ga0105238_11303919 Ga0105238_113039192 163
351 3300010375 Ga0105239_11605756 Ga0105239_116057562 163
352 3300013104 Ga0157370_10306634 Ga0157370_103066342 163
353 3300013105 Ga0157369_10210563 Ga0157369_102105633 163
354 3300013307 Ga0157372_10511347 Ga0157372_105113472 163
355 3300025321 Ga0207656_10008226 Ga0207656_100082263 163
356 3300025904 Ga0207647_10001146 Ga0207647_1000114625 163
357 3300025911 Ga0207654_10032034 Ga0207654_100320345 163
358 3300025913 Ga0207695_10005863 Ga0207695_1000586319 163
359 3300025914 Ga0207671_10000658 Ga0207671_1000065819 163
360 3300025920 Ga0207649_10163266 Ga0207649_101632662 163
361 3300025924 Ga0207694_10017245 Ga0207694_100172458 163
362 3300025932 Ga0207690_10095964 Ga0207690_100959643 163
363 3300025933 Ga0207706_10140233 Ga0207706_101402333 163
364 3300025945 Ga0207679_10311998 Ga0207679_103119982 163
365 3300025949 Ga0207667_10138732 Ga0207667_101387323 163
366 3300025981 Ga0207640_10126561 Ga0207640_101265613 163
367 3300026041 Ga0207639_10140060 Ga0207639_101400603 163
368 3300026067 Ga0207678_10076235 Ga0207678_100762355 163
369 3300026078 Ga0207702_10001915 Ga0207702_1000191515 163
370 3300026142 Ga0207698_10714371 Ga0207698_107143712 163

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

39

176

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xfs-assembly1.cif.gz_B x-ray crystal structure of protein ne0264 from nitrosomonas europaea. northeast structural genomics consortium target ner5. 0.8756 1 154
1xfs-assembly1.cif.gz_A x-ray crystal structure of protein ne0264 from nitrosomonas europaea. northeast structural genomics consortium target ner5. 0.8703 1 154
1xfs-assembly1.cif.gz_B x-ray crystal structure of protein ne0264 from nitrosomonas europaea. northeast structural genomics consortium target ner5. 0.8544 1 154
3pu2-assembly8.cif.gz_H crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.8506 3 150
1xfs-assembly1.cif.gz_A x-ray crystal structure of protein ne0264 from nitrosomonas europaea. northeast structural genomics consortium target ner5. 0.8491 1 154
ID Description Score Start End Superfamily
3uidB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8359 3 154 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8232 6 152 3.30.530.20
2ldkA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8228 3 153 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8208 1 154 3.30.530.20
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8123 5 151 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A258IDF0-F1-model_v4 ATPase 0.9822 6 153
AF-A0A258XI89-F1-model_v4 ATPase 0.9822 6 152
AF-A0A7W6CGM2-F1-model_v4 Uncharacterized protein YndB with AHSA1/START domain 0.9773 6 152
AF-A0A1I5PLL8-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.9726 6 152
AF-A0A7Y5DMJ1-F1-model_v4 ATPase 0.9718 6 152

Feature Viewer

pLDDT pTM Quality
92.19 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map