F425470

General Info

Members Datasets Scaffolds Average Seq Length
370 191 740 128

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0255425|Ga0373925_0255425_75_515
Length 146
Sequence MQIAKSNQHLAFSIWQSAMNPCRAIAAVSLFYDALVGVVMLTGRPLLSRLFEVSLPTPPIHADLNGVFLLSIAAGYLIPYRDPQSAGGRAYLWIMGPLLKGAGAVTFVLDYVFRHSPRSFLLFALSDGALALITLFVLVTSSRADA

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
141 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
142 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
143 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
186 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
189 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
190 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.08
Nodule 0
Rhizoplane 5.41
Rhizosphere 93.51
Stem 0
Stem Tuber 0
Unclassified 35.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0255425 3300037068 Bacteria 1407
2 Ga0070676_10130322 3300005328 Unclassified 1589
3 Ga0070676_11576319 3300005328 Unclassified 507
4 Ga0070690_100201920 3300005330 Unclassified 1384
5 Ga0070670_100029392 3300005331 Bacteria 4731
6 Ga0070670_100810934 3300005331 Bacteria 846
7 Ga0070677_10046293 3300005333 Bacteria 1739
8 Ga0068869_100108660 3300005334 Bacteria 2107
9 Ga0068869_100187501 3300005334 Bacteria 1625
10 Ga0070666_10009034 3300005335 Bacteria 6209
11 Ga0070666_10285359 3300005335 Unclassified 1174
12 Ga0070666_11219492 3300005335 Bacteria 560
13 Ga0070680_101026359 3300005336 Unclassified 712
14 Ga0068868_100318695 3300005338 Unclassified 1324
15 Ga0068868_100985301 3300005338 Unclassified 770
16 Ga0068868_101417410 3300005338 Unclassified 648
17 Ga0070689_100773696 3300005340 Bacteria 843
18 Ga0070691_10005087 3300005341 Bacteria 5974
19 Ga0070687_100088181 3300005343 Bacteria 1710
20 Ga0070687_100899012 3300005343 Unclassified 635
21 Ga0070692_10974389 3300005345 Bacteria 591
22 Ga0070668_101423135 3300005347 Bacteria 632
23 Ga0070669_100012610 3300005353 Bacteria 5998
24 Ga0070675_100164583 3300005354 Bacteria 1909
25 Ga0070675_100169924 3300005354 Bacteria 1879
26 Ga0070675_100565950 3300005354 Bacteria 1029
27 Ga0070675_100787345 3300005354 Unclassified 869
28 Ga0070675_101123324 3300005354 Unclassified 723
29 Ga0070671_100452560 3300005355 Unclassified 1102
30 Ga0070674_100165611 3300005356 Unclassified 1681
31 Ga0070673_100033003 3300005364 Bacteria 3904
32 Ga0070688_100468702 3300005365 Bacteria 945
33 Ga0070667_100004804 3300005367 Bacteria 11320
34 Ga0070701_10011130 3300005438 Bacteria 4007
35 Ga0070701_10240918 3300005438 Unclassified 1088
36 Ga0070700_100001436 3300005441 Bacteria 11849
37 Ga0070694_100004951 3300005444 Bacteria 8034
38 Ga0070694_100006469 3300005444 Bacteria 7114
39 Ga0070694_100101081 3300005444 Unclassified 2040
40 Ga0070694_100302091 3300005444 Unclassified 1227
41 Ga0070708_100017953 3300005445 Bacteria 5915
42 Ga0070708_100235114 3300005445 Bacteria 1720
43 Ga0070678_101202657 3300005456 Bacteria 703
44 Ga0070662_100078671 3300005457 Unclassified 2450
45 Ga0070681_10523696 3300005458 Unclassified 1099
46 Ga0068867_100019106 3300005459 Bacteria 4880
47 Ga0068867_101228590 3300005459 Unclassified 689
48 Ga0070685_10457943 3300005466 Bacteria 895
49 Ga0070706_100607469 3300005467 Unclassified 1016
50 Ga0070707_100460932 3300005468 Bacteria 1232
51 Ga0070707_100743156 3300005468 Unclassified 944
52 Ga0070707_100988280 3300005468 Unclassified 807
53 Ga0070707_101235203 3300005468 Unclassified 713
54 Ga0070707_101592145 3300005468 Unclassified 620
55 Ga0070698_100108043 3300005471 Bacteria 2750
56 Ga0070698_100263767 3300005471 Bacteria 1655
57 Ga0070698_100547119 3300005471 Bacteria 1097
58 Ga0070698_100927334 3300005471 Unclassified 817
59 Ga0070698_102029730 3300005471 Unclassified 528
60 Ga0070699_100069221 3300005518 Unclassified 3067
61 Ga0070697_100064324 3300005536 Bacteria 2996
62 Ga0070697_101173782 3300005536 Bacteria 684
63 Ga0068853_101861712 3300005539 Unclassified 583
64 Ga0070672_100018484 3300005543 Bacteria 5040
65 Ga0070695_100001234 3300005545 Bacteria 14051
66 Ga0070695_100004058 3300005545 Bacteria 8568
67 Ga0070695_101019747 3300005545 Bacteria 674
68 Ga0070696_100002600 3300005546 Bacteria 11964
69 Ga0070696_100177067 3300005546 Bacteria 1580
70 Ga0070665_100001061 3300005548 Bacteria 34294
71 Ga0070665_100004732 3300005548 Bacteria 14164
72 Ga0070665_101694137 3300005548 Unclassified 639
73 Ga0070704_100006025 3300005549 Bacteria 7109
74 Ga0070704_100137813 3300005549 Unclassified 1901
75 Ga0070704_100427829 3300005549 Unclassified 1135
76 Ga0068857_100513040 3300005577 Archaea 1126
77 Ga0068857_100538650 3300005577 Unclassified 1099
78 Ga0068854_100049189 3300005578 Bacteria 3011
79 Ga0070702_100000903 3300005615 Bacteria 11573
80 Ga0068852_101302260 3300005616 Unclassified 748
81 Ga0068859_100503468 3300005617 Bacteria 1306
82 Ga0068864_100104476 3300005618 Bacteria 2516
83 Ga0068864_100207367 3300005618 Bacteria 1803
84 Ga0068864_100734518 3300005618 Unclassified 967
85 Ga0068864_101197106 3300005618 Unclassified 758
86 Ga0068866_10189730 3300005718 Bacteria 1220
87 Ga0068861_100002043 3300005719 Bacteria 13074
88 Ga0068861_100103018 3300005719 Bacteria 2274
89 Ga0068861_101112807 3300005719 Bacteria 760
90 Ga0068861_101886963 3300005719 Unclassified 594
91 Ga0068851_11008867 3300005834 Unclassified 525
92 Ga0068863_100018975 3300005841 Bacteria 6582
93 Ga0068863_100061546 3300005841 Bacteria 3550
94 Ga0068863_100651961 3300005841 Bacteria 1044
95 Ga0068863_101502703 3300005841 Unclassified 682
96 Ga0068858_100009845 3300005842 Bacteria 9089
97 Ga0068858_100035288 3300005842 Bacteria 4639
98 Ga0068858_100141449 3300005842 Unclassified 2259
99 Ga0068858_100479927 3300005842 Bacteria 1200
100 Ga0068858_100610394 3300005842 Unclassified 1059
101 Ga0068860_100102098 3300005843 Bacteria 2736
102 Ga0068860_100161958 3300005843 Unclassified 2157
103 Ga0068860_100244432 3300005843 Unclassified 1746
104 Ga0068860_101177628 3300005843 Unclassified 786
105 Ga0068862_100018200 3300005844 Bacteria 5849
106 Ga0068862_100067033 3300005844 Bacteria 3093
107 Ga0075365_10013871 3300006038 Bacteria 4834
108 Ga0070715_10312399 3300006163 Bacteria 845
109 Ga0070716_100414685 3300006173 Bacteria 972
110 Ga0097621_100559443 3300006237 Unclassified 1042
111 Ga0097621_100674528 3300006237 Bacteria 950
112 Ga0068871_100626862 3300006358 Unclassified 980
113 Ga0075428_100217313 3300006844 Bacteria 2064
114 Ga0075428_101199004 3300006844 Bacteria 800
115 Ga0075433_10422388 3300006852 Bacteria 1176
116 Ga0075433_10466605 3300006852 Unclassified 1112
117 Ga0075433_10582490 3300006852 Unclassified 983
118 Ga0075434_101555904 3300006871 Unclassified 670
119 Ga0075429_100371190 3300006880 Bacteria 1253
120 Ga0068865_100011764 3300006881 Bacteria 5482
121 Ga0068865_100142916 3300006881 Bacteria 1806
122 Ga0068865_101640270 3300006881 Unclassified 579
123 Ga0075436_100311254 3300006914 Unclassified 1130
124 Ga0075436_100338971 3300006914 Bacteria 1082
125 Ga0097620_100503436 3300006931 Bacteria 1306
126 Ga0075435_100236572 3300007076 Unclassified 1552
127 Ga0075435_101004424 3300007076 Bacteria 728
128 Ga0105251_10094289 3300009011 Unclassified 1372
129 Ga0111539_10035269 3300009094 Bacteria 6058
130 Ga0105245_10005079 3300009098 Bacteria 11571
131 Ga0105245_10484529 3300009098 Bacteria 1251
132 Ga0105245_11231537 3300009098 Bacteria 797
133 Ga0105247_10204439 3300009101 Bacteria 1329
134 Ga0105247_10377113 3300009101 Bacteria 1005
135 Ga0105247_10472220 3300009101 Bacteria 909
136 Ga0105247_10768958 3300009101 Unclassified 732
137 Ga0105247_11525446 3300009101 Bacteria 546
138 Ga0114129_10000997 3300009147 Bacteria 36967
139 Ga0114129_10001174 3300009147 Bacteria 34722
140 Ga0114129_10006898 3300009147 Bacteria 16156
141 Ga0114129_10029070 3300009147 Bacteria 7829
142 Ga0114129_10072542 3300009147 Bacteria 4799
143 Ga0114129_11053153 3300009147 Bacteria 1021
144 Ga0114129_11070925 3300009147 Bacteria 1011
145 Ga0105243_10058536 3300009148 Bacteria 3071
146 Ga0105243_12871488 3300009148 Unclassified 522
147 Ga0105241_10345344 3300009174 Unclassified 1291
148 Ga0105242_10027735 3300009176 Unclassified 4501
149 Ga0105242_10180587 3300009176 Unclassified 1862
150 Ga0105242_10344186 3300009176 Unclassified 1375
151 Ga0105248_10008748 3300009177 Bacteria 11118
152 Ga0105248_10010435 3300009177 Bacteria 10231
153 Ga0105248_10128205 3300009177 Unclassified 2862
154 Ga0105248_10178644 3300009177 Bacteria 2392
155 Ga0105248_11091387 3300009177 Bacteria 902
156 Ga0105248_11339666 3300009177 Bacteria 810
157 Ga0105237_10367721 3300009545 Bacteria 1443
158 Ga0105238_11960559 3300009551 Unclassified 619
159 Ga0105249_10478385 3300009553 Unclassified 1288
160 Ga0105249_11585879 3300009553 Unclassified 727
161 Ga0105239_10401041 3300010375 Bacteria 1552
162 Ga0105246_10253816 3300011119 Unclassified 1397
163 Ga0157373_11403540 3300013100 Unclassified 531
164 Ga0157374_10040573 3300013296 Unclassified 4287
165 Ga0157378_10103235 3300013297 Bacteria 2605
166 Ga0163162_10010220 3300013306 Bacteria 9118
167 Ga0163162_10046273 3300013306 Unclassified 4360
168 Ga0157372_11565224 3300013307 Archaea 759
169 Ga0157375_10068651 3300013308 Bacteria 3548
170 Ga0157375_10291873 3300013308 Bacteria 1794
171 Ga0163163_10053402 3300014325 Bacteria 3988
172 Ga0163163_10271800 3300014325 Bacteria 1746
173 Ga0163163_11112557 3300014325 Bacteria 853
174 Ga0163163_11268723 3300014325 Bacteria 799
175 Ga0157380_10071909 3300014326 Unclassified 2800
176 Ga0157380_10296323 3300014326 Unclassified 1487
177 Ga0157377_10124016 3300014745 Unclassified 1569
178 Ga0157379_10007047 3300014968 Bacteria 9715
179 Ga0157379_10012700 3300014968 Bacteria 7361
180 Ga0157379_10137660 3300014968 Bacteria 2200
181 Ga0157379_10492489 3300014968 Bacteria 1135
182 Ga0157376_10013855 3300014969 Bacteria 6029
183 Ga0157376_10080908 3300014969 Bacteria 2788
184 Ga0163161_10486721 3300017792 Unclassified 1002
185 Ga0207642_10057650 3300025899 Bacteria 1788
186 Ga0207642_10864153 3300025899 Bacteria 578
187 Ga0207710_10015803 3300025900 Bacteria 3192
188 Ga0207688_10267464 3300025901 Bacteria 1039
189 Ga0207680_10005122 3300025903 Bacteria 6248
190 Ga0207680_10075533 3300025903 Unclassified 2102
191 Ga0207680_10406933 3300025903 Unclassified 962
192 Ga0207685_10165018 3300025905 Bacteria 1014
193 Ga0207645_10000810 3300025907 Bacteria 26162
194 Ga0207643_10047149 3300025908 Bacteria 2437
195 Ga0207684_10300158 3300025910 Unclassified 1385
196 Ga0207684_11180983 3300025910 Bacteria 634
197 Ga0207654_10315868 3300025911 Unclassified 1066
198 Ga0207671_10350058 3300025914 Bacteria 1171
199 Ga0207662_10097257 3300025918 Bacteria 1820
200 Ga0207662_10462715 3300025918 Unclassified 869
201 Ga0207646_10179264 3300025922 Bacteria 1913
202 Ga0207646_10385469 3300025922 Unclassified 1266
203 Ga0207646_10861655 3300025922 Unclassified 805
204 Ga0207681_10027959 3300025923 Bacteria 3651
205 Ga0207681_10315368 3300025923 Bacteria 1242
206 Ga0207681_11455255 3300025923 Bacteria 575
207 Ga0207694_10621670 3300025924 Bacteria 909
208 Ga0207659_10142400 3300025926 Bacteria 1862
209 Ga0207659_10147302 3300025926 Bacteria 1835
210 Ga0207659_10385047 3300025926 Bacteria 1170
211 Ga0207687_10203693 3300025927 Unclassified 1548
212 Ga0207644_10141759 3300025931 Unclassified 1851
213 Ga0207644_11115962 3300025931 Unclassified 663
214 Ga0207706_10205634 3300025933 Bacteria 1726
215 Ga0207686_10013629 3300025934 Unclassified 4501
216 Ga0207686_10091313 3300025934 Unclassified 2011
217 Ga0207686_10216852 3300025934 Bacteria 1379
218 Ga0207709_10123042 3300025935 Unclassified 1755
219 Ga0207709_10549522 3300025935 Bacteria 908
220 Ga0207670_10276843 3300025936 Unclassified 1306
221 Ga0207670_11092634 3300025936 Bacteria 673
222 Ga0207669_10308618 3300025937 Bacteria 1206
223 Ga0207704_10007222 3300025938 Bacteria 5231
224 Ga0207704_10101936 3300025938 Bacteria 1916
225 Ga0207704_10340762 3300025938 Bacteria 1164
226 Ga0207704_11308798 3300025938 Bacteria 620
227 Ga0207665_10468012 3300025939 Bacteria 970
228 Ga0207691_10021134 3300025940 Bacteria 6150
229 Ga0207691_10493236 3300025940 Bacteria 1040
230 Ga0207711_10020325 3300025941 Bacteria 5535
231 Ga0207711_10023187 3300025941 Bacteria 5195
232 Ga0207711_10061844 3300025941 Unclassified 3229
233 Ga0207711_10191507 3300025941 Bacteria 1864
234 Ga0207711_10686325 3300025941 Bacteria 955
235 Ga0207711_10765303 3300025941 Bacteria 900
236 Ga0207711_11384833 3300025941 Unclassified 646
237 Ga0207711_11728981 3300025941 Bacteria 569
238 Ga0207689_10050567 3300025942 Bacteria 3426
239 Ga0207689_10061154 3300025942 Bacteria 3097
240 Ga0207689_10151209 3300025942 Unclassified 1913
241 Ga0207689_10845381 3300025942 Unclassified 772
242 Ga0207679_10504311 3300025945 Unclassified 1080
243 Ga0207679_10786924 3300025945 Unclassified 867
244 Ga0207712_10535268 3300025961 Bacteria 1006
245 Ga0207668_10224771 3300025972 Bacteria 1510
246 Ga0207668_10872780 3300025972 Archaea 800
247 Ga0207668_11712648 3300025972 Bacteria 567
248 Ga0207640_10036086 3300025981 Unclassified 3100
249 Ga0207658_10015837 3300025986 Bacteria 5177
250 Ga0207677_10422809 3300026023 Bacteria 1135
251 Ga0207677_10819481 3300026023 Unclassified 834
252 Ga0207703_10100803 3300026035 Bacteria 2447
253 Ga0207703_10448536 3300026035 Bacteria 1205
254 Ga0207703_10591461 3300026035 Bacteria 1049
255 Ga0207703_10912967 3300026035 Unclassified 841
256 Ga0207639_10223833 3300026041 Unclassified 1627
257 Ga0207708_10001213 3300026075 Bacteria 19467
258 Ga0207708_10132021 3300026075 Bacteria 1953
259 Ga0207641_10013084 3300026088 Bacteria 6804
260 Ga0207641_10055957 3300026088 Bacteria 3351
261 Ga0207641_10478049 3300026088 Bacteria 1207
262 Ga0207641_12239284 3300026088 Unclassified 546
263 Ga0207648_10028418 3300026089 Bacteria 4958
264 Ga0207648_10907806 3300026089 Unclassified 823
265 Ga0207676_10024536 3300026095 Bacteria 4463
266 Ga0207676_10287071 3300026095 Bacteria 1496
267 Ga0207676_10578683 3300026095 Bacteria 1076
268 Ga0207676_11137918 3300026095 Unclassified 772
269 Ga0207676_11610735 3300026095 Unclassified 647
270 Ga0207674_10297292 3300026116 Unclassified 1563
271 Ga0207674_11483190 3300026116 Unclassified 647
272 Ga0207675_100003176 3300026118 Bacteria 16117
273 Ga0207675_100178540 3300026118 Bacteria 2032
274 Ga0207675_101136210 3300026118 Bacteria 801
275 Ga0207675_101879680 3300026118 Unclassified 617
276 Ga0207683_10666191 3300026121 Bacteria 964
277 Ga0207428_10005777 3300027907 Bacteria 11484
278 Ga0207428_10149891 3300027907 Unclassified 1776
279 Ga0268266_10009795 3300028379 Bacteria 8429
280 Ga0268266_10014454 3300028379 Bacteria 6786
281 Ga0268265_10151309 3300028380 Unclassified 1958
282 Ga0268265_10422874 3300028380 Bacteria 1237
283 Ga0268264_10219486 3300028381 Unclassified 1750
284 Ga0268264_10341000 3300028381 Bacteria 1423
285 Ga0268264_11060249 3300028381 Bacteria 818
286 Ga0268264_11256623 3300028381 Unclassified 750
287 Ga0373944_0009441 3300035089 Unclassified 2647
288 Ga0373944_0138460 3300035089 Bacteria 851
289 Ga0373943_1006150 3300035170 Unclassified 500
290 Ga0373946_0080826 3300035171 Bacteria 1423
291 Ga0373924_0032599 3300035410 Bacteria 2100
292 Ga0373933_0835091 3300035724 Unclassified 606
293 Ga0373947_0335760 3300035725 Bacteria 1012
294 Ga0373937_0289309 3300036401 Bacteria 1548
295 Ga0373937_0421482 3300036401 Bacteria 1267
296 Ga0395901_0792017 3300038443 Bacteria 938
297 Ga0466964_0298985 3300044706 Unclassified 811
298 Ga0495653_0938543 3300046463 Unclassified 514
299 Ga0495582_0795556 3300046473 Unclassified 547
300 Ga0495639_0210142 3300046475 Bacteria 955
301 Ga0495639_0312634 3300046475 Unclassified 785
302 Ga0495594_0646387 3300046499 Unclassified 599
303 Ga0495640_0243992 3300046533 Bacteria 1127
304 Ga0495586_0163939 3300046535 Bacteria 1254
305 Ga0495645_0001942 3300046543 Bacteria 14030
306 Ga0495633_0560872 3300046558 Bacteria 514
307 Ga0495667_0337022 3300046559 Unclassified 954
308 Ga0495635_0201479 3300046663 Bacteria 1350
309 Ga0495588_0699714 3300046674 Unclassified 530
310 Ga0495647_0089969 3300046681 Bacteria 1257
311 Ga0495658_0135560 3300046683 Unclassified 1502
312 Ga0495658_0863344 3300046683 Bacteria 579
313 Ga0495669_0244314 3300046684 Bacteria 862
314 Ga0495613_0228652 3300046689 Bacteria 1304
315 Ga0495613_0732997 3300046689 Unclassified 649
316 Ga0495600_0327299 3300046809 Bacteria 963
317 Ga0496104_0746923 3300048907 Unclassified 885
318 Ga0496104_1113490 3300048907 Bacteria 693
319 Ga0496105_0796257 3300048908 Bacteria 719
320 Ga0496106_0446449 3300048909 Bacteria 1039
321 Ga0496107_0314385 3300048910 Unclassified 1166
322 Ga0496108_0065691 3300048911 Bacteria 3058
323 Ga0496108_1463845 3300048911 Bacteria 569
324 Ga0496109_0059193 3300048912 Bacteria 3500
325 Ga0496109_0130880 3300048912 Bacteria 2342
326 Ga0496109_0812269 3300048912 Bacteria 873
327 Ga0496111_0442632 3300048914 Bacteria 959
328 Ga0496112_0008593 3300048915 Bacteria 9153
329 Ga0496112_0110800 3300048915 Bacteria 2715
330 Ga0496112_0320648 3300048915 Bacteria 1494
331 Ga0496113_0281278 3300048916 Unclassified 1330
332 Ga0496113_0314412 3300048916 Bacteria 1255
333 Ga0496114_0428840 3300048917 Bacteria 1171
334 Ga0496114_0506261 3300048917 Unclassified 1068
335 Ga0496114_0681763 3300048917 Unclassified 902
336 Ga0496114_0750644 3300048917 Bacteria 853
337 Ga0501067_0062594 3300049583 Bacteria 2060
338 Ga0501069_0118284 3300049585 Unclassified 1512
339 nmdc:mga0yw44_5613_c1 3300050492 Bacteria 5963
340 nmdc:mga05p37_107352_c1 3300050507 Bacteria 3435
341 nmdc:mga05p37_112065_c1 3300050507 Bacteria 3355
342 nmdc:mga05p37_114448_c1 3300050507 Bacteria 3316
343 nmdc:mga05p37_19157_c1 3300050507 Bacteria 8278
344 nmdc:mga05p37_331401_c1 3300050507 Bacteria 1798
345 nmdc:mga05p37_443711_c1 3300050507 Unclassified 1504
346 nmdc:mga05p37_642279_c1 3300050507 Bacteria 1190
347 nmdc:mga09592_308969_c1 3300050508 Bacteria 1370
348 nmdc:mga08y16_23064_c1 3300050511 Bacteria 6571
349 nmdc:mga08y16_97330_c1 3300050511 Unclassified 3065
350 nmdc:mga0n895_139218_c1 3300050512 Bacteria 2455
351 nmdc:mga0n895_1509369_c1 3300050512 Bacteria 638
352 nmdc:mga0rr50_202858_c1 3300050513 Unclassified 1630
353 nmdc:mga0rr50_557725_c1 3300050513 Bacteria 976
354 nmdc:mga08x19_19193_c1 3300050514 Bacteria 4194
355 nmdc:mga08x19_427243_c1 3300050514 Bacteria 931
356 nmdc:mga08x19_841104_c1 3300050514 Bacteria 652
357 nmdc:mga08x19_94311_c1 3300050514 Bacteria 1979
358 nmdc:mga0a205_361855_c1 3300050515 Bacteria 1317
359 nmdc:mga0a205_473157_c1 3300050515 Unclassified 1112
360 nmdc:mga0a205_949368_c1 3300050515 Bacteria 707
361 Ga0495601_0034531 3300053077 Bacteria 3156
362 Ga0495601_0457997 3300053077 Unclassified 825
363 Ga0495595_0071178 3300053084 Bacteria 1644
364 Ga0495619_0018640 3300053085 Bacteria 4404
365 Ga0495619_0058086 3300053085 Unclassified 2567
366 Ga0495619_0403154 3300053085 Unclassified 944
367 Ga0500566_0417463 3300053094 Unclassified 596
368 Ga0500658_0100062 3300053134 Unclassified 1264
369 Ga0587066_018342 3300059490 Unclassified 1126
370 Ga0530510_0293001 3300061734 Bacteria 1217
371 Ga0373925_0255425
372 Ga0070676_10130322
373 Ga0070676_11576319
374 Ga0070690_100201920
375 Ga0070670_100029392
376 Ga0070670_100810934
377 Ga0070677_10046293
378 Ga0068869_100108660
379 Ga0068869_100187501
380 Ga0070666_10009034
381 Ga0070666_10285359
382 Ga0070666_11219492
383 Ga0070680_101026359
384 Ga0068868_100318695
385 Ga0068868_100985301
386 Ga0068868_101417410
387 Ga0070689_100773696
388 Ga0070691_10005087
389 Ga0070687_100088181
390 Ga0070687_100899012
391 Ga0070692_10974389
392 Ga0070668_101423135
393 Ga0070669_100012610
394 Ga0070675_100164583
395 Ga0070675_100169924
396 Ga0070675_100565950
397 Ga0070675_100787345
398 Ga0070675_101123324
399 Ga0070671_100452560
400 Ga0070674_100165611
401 Ga0070673_100033003
402 Ga0070688_100468702
403 Ga0070667_100004804
404 Ga0070701_10011130
405 Ga0070701_10240918
406 Ga0070700_100001436
407 Ga0070694_100004951
408 Ga0070694_100006469
409 Ga0070694_100101081
410 Ga0070694_100302091
411 Ga0070708_100017953
412 Ga0070708_100235114
413 Ga0070678_101202657
414 Ga0070662_100078671
415 Ga0070681_10523696
416 Ga0068867_100019106
417 Ga0068867_101228590
418 Ga0070685_10457943
419 Ga0070706_100607469
420 Ga0070707_100460932
421 Ga0070707_100743156
422 Ga0070707_100988280
423 Ga0070707_101235203
424 Ga0070707_101592145
425 Ga0070698_100108043
426 Ga0070698_100263767
427 Ga0070698_100547119
428 Ga0070698_100927334
429 Ga0070698_102029730
430 Ga0070699_100069221
431 Ga0070697_100064324
432 Ga0070697_101173782
433 Ga0068853_101861712
434 Ga0070672_100018484
435 Ga0070695_100001234
436 Ga0070695_100004058
437 Ga0070695_101019747
438 Ga0070696_100002600
439 Ga0070696_100177067
440 Ga0070665_100001061
441 Ga0070665_100004732
442 Ga0070665_101694137
443 Ga0070704_100006025
444 Ga0070704_100137813
445 Ga0070704_100427829
446 Ga0068857_100513040
447 Ga0068857_100538650
448 Ga0068854_100049189
449 Ga0070702_100000903
450 Ga0068852_101302260
451 Ga0068859_100503468
452 Ga0068864_100104476
453 Ga0068864_100207367
454 Ga0068864_100734518
455 Ga0068864_101197106
456 Ga0068866_10189730
457 Ga0068861_100002043
458 Ga0068861_100103018
459 Ga0068861_101112807
460 Ga0068861_101886963
461 Ga0068851_11008867
462 Ga0068863_100018975
463 Ga0068863_100061546
464 Ga0068863_100651961
465 Ga0068863_101502703
466 Ga0068858_100009845
467 Ga0068858_100035288
468 Ga0068858_100141449
469 Ga0068858_100479927
470 Ga0068858_100610394
471 Ga0068860_100102098
472 Ga0068860_100161958
473 Ga0068860_100244432
474 Ga0068860_101177628
475 Ga0068862_100018200
476 Ga0068862_100067033
477 Ga0075365_10013871
478 Ga0070715_10312399
479 Ga0070716_100414685
480 Ga0097621_100559443
481 Ga0097621_100674528
482 Ga0068871_100626862
483 Ga0075428_100217313
484 Ga0075428_101199004
485 Ga0075433_10422388
486 Ga0075433_10466605
487 Ga0075433_10582490
488 Ga0075434_101555904
489 Ga0075429_100371190
490 Ga0068865_100011764
491 Ga0068865_100142916
492 Ga0068865_101640270
493 Ga0075436_100311254
494 Ga0075436_100338971
495 Ga0097620_100503436
496 Ga0075435_100236572
497 Ga0075435_101004424
498 Ga0105251_10094289
499 Ga0111539_10035269
500 Ga0105245_10005079
501 Ga0105245_10484529
502 Ga0105245_11231537
503 Ga0105247_10204439
504 Ga0105247_10377113
505 Ga0105247_10472220
506 Ga0105247_10768958
507 Ga0105247_11525446
508 Ga0114129_10000997
509 Ga0114129_10001174
510 Ga0114129_10006898
511 Ga0114129_10029070
512 Ga0114129_10072542
513 Ga0114129_11053153
514 Ga0114129_11070925
515 Ga0105243_10058536
516 Ga0105243_12871488
517 Ga0105241_10345344
518 Ga0105242_10027735
519 Ga0105242_10180587
520 Ga0105242_10344186
521 Ga0105248_10008748
522 Ga0105248_10010435
523 Ga0105248_10128205
524 Ga0105248_10178644
525 Ga0105248_11091387
526 Ga0105248_11339666
527 Ga0105237_10367721
528 Ga0105238_11960559
529 Ga0105249_10478385
530 Ga0105249_11585879
531 Ga0105239_10401041
532 Ga0105246_10253816
533 Ga0157373_11403540
534 Ga0157374_10040573
535 Ga0157378_10103235
536 Ga0163162_10010220
537 Ga0163162_10046273
538 Ga0157372_11565224
539 Ga0157375_10068651
540 Ga0157375_10291873
541 Ga0163163_10053402
542 Ga0163163_10271800
543 Ga0163163_11112557
544 Ga0163163_11268723
545 Ga0157380_10071909
546 Ga0157380_10296323
547 Ga0157377_10124016
548 Ga0157379_10007047
549 Ga0157379_10012700
550 Ga0157379_10137660
551 Ga0157379_10492489
552 Ga0157376_10013855
553 Ga0157376_10080908
554 Ga0163161_10486721
555 Ga0207642_10057650
556 Ga0207642_10864153
557 Ga0207710_10015803
558 Ga0207688_10267464
559 Ga0207680_10005122
560 Ga0207680_10075533
561 Ga0207680_10406933
562 Ga0207685_10165018
563 Ga0207645_10000810
564 Ga0207643_10047149
565 Ga0207684_10300158
566 Ga0207684_11180983
567 Ga0207654_10315868
568 Ga0207671_10350058
569 Ga0207662_10097257
570 Ga0207662_10462715
571 Ga0207646_10179264
572 Ga0207646_10385469
573 Ga0207646_10861655
574 Ga0207681_10027959
575 Ga0207681_10315368
576 Ga0207681_11455255
577 Ga0207694_10621670
578 Ga0207659_10142400
579 Ga0207659_10147302
580 Ga0207659_10385047
581 Ga0207687_10203693
582 Ga0207644_10141759
583 Ga0207644_11115962
584 Ga0207706_10205634
585 Ga0207686_10013629
586 Ga0207686_10091313
587 Ga0207686_10216852
588 Ga0207709_10123042
589 Ga0207709_10549522
590 Ga0207670_10276843
591 Ga0207670_11092634
592 Ga0207669_10308618
593 Ga0207704_10007222
594 Ga0207704_10101936
595 Ga0207704_10340762
596 Ga0207704_11308798
597 Ga0207665_10468012
598 Ga0207691_10021134
599 Ga0207691_10493236
600 Ga0207711_10020325
601 Ga0207711_10023187
602 Ga0207711_10061844
603 Ga0207711_10191507
604 Ga0207711_10686325
605 Ga0207711_10765303
606 Ga0207711_11384833
607 Ga0207711_11728981
608 Ga0207689_10050567
609 Ga0207689_10061154
610 Ga0207689_10151209
611 Ga0207689_10845381
612 Ga0207679_10504311
613 Ga0207679_10786924
614 Ga0207712_10535268
615 Ga0207668_10224771
616 Ga0207668_10872780
617 Ga0207668_11712648
618 Ga0207640_10036086
619 Ga0207658_10015837
620 Ga0207677_10422809
621 Ga0207677_10819481
622 Ga0207703_10100803
623 Ga0207703_10448536
624 Ga0207703_10591461
625 Ga0207703_10912967
626 Ga0207639_10223833
627 Ga0207708_10001213
628 Ga0207708_10132021
629 Ga0207641_10013084
630 Ga0207641_10055957
631 Ga0207641_10478049
632 Ga0207641_12239284
633 Ga0207648_10028418
634 Ga0207648_10907806
635 Ga0207676_10024536
636 Ga0207676_10287071
637 Ga0207676_10578683
638 Ga0207676_11137918
639 Ga0207676_11610735
640 Ga0207674_10297292
641 Ga0207674_11483190
642 Ga0207675_100003176
643 Ga0207675_100178540
644 Ga0207675_101136210
645 Ga0207675_101879680
646 Ga0207683_10666191
647 Ga0207428_10005777
648 Ga0207428_10149891
649 Ga0268266_10009795
650 Ga0268266_10014454
651 Ga0268265_10151309
652 Ga0268265_10422874
653 Ga0268264_10219486
654 Ga0268264_10341000
655 Ga0268264_11060249
656 Ga0268264_11256623
657 Ga0373944_0009441
658 Ga0373944_0138460
659 Ga0373943_1006150
660 Ga0373946_0080826
661 Ga0373924_0032599
662 Ga0373933_0835091
663 Ga0373947_0335760
664 Ga0373937_0289309
665 Ga0373937_0421482
666 Ga0395901_0792017
667 Ga0466964_0298985
668 Ga0495653_0938543
669 Ga0495582_0795556
670 Ga0495639_0210142
671 Ga0495639_0312634
672 Ga0495594_0646387
673 Ga0495640_0243992
674 Ga0495586_0163939
675 Ga0495645_0001942
676 Ga0495633_0560872
677 Ga0495667_0337022
678 Ga0495635_0201479
679 Ga0495588_0699714
680 Ga0495647_0089969
681 Ga0495658_0135560
682 Ga0495658_0863344
683 Ga0495669_0244314
684 Ga0495613_0228652
685 Ga0495613_0732997
686 Ga0495600_0327299
687 Ga0496104_0746923
688 Ga0496104_1113490
689 Ga0496105_0796257
690 Ga0496106_0446449
691 Ga0496107_0314385
692 Ga0496108_0065691
693 Ga0496108_1463845
694 Ga0496109_0059193
695 Ga0496109_0130880
696 Ga0496109_0812269
697 Ga0496111_0442632
698 Ga0496112_0008593
699 Ga0496112_0110800
700 Ga0496112_0320648
701 Ga0496113_0281278
702 Ga0496113_0314412
703 Ga0496114_0428840
704 Ga0496114_0506261
705 Ga0496114_0681763
706 Ga0496114_0750644
707 Ga0501067_0062594
708 Ga0501069_0118284
709 nmdc:mga0yw44_5613_c1
710 nmdc:mga05p37_107352_c1
711 nmdc:mga05p37_112065_c1
712 nmdc:mga05p37_114448_c1
713 nmdc:mga05p37_19157_c1
714 nmdc:mga05p37_331401_c1
715 nmdc:mga05p37_443711_c1
716 nmdc:mga05p37_642279_c1
717 nmdc:mga09592_308969_c1
718 nmdc:mga08y16_23064_c1
719 nmdc:mga08y16_97330_c1
720 nmdc:mga0n895_139218_c1
721 nmdc:mga0n895_1509369_c1
722 nmdc:mga0rr50_202858_c1
723 nmdc:mga0rr50_557725_c1
724 nmdc:mga08x19_19193_c1
725 nmdc:mga08x19_427243_c1
726 nmdc:mga08x19_841104_c1
727 nmdc:mga08x19_94311_c1
728 nmdc:mga0a205_361855_c1
729 nmdc:mga0a205_473157_c1
730 nmdc:mga0a205_949368_c1
731 Ga0495601_0034531
732 Ga0495601_0457997
733 Ga0495595_0071178
734 Ga0495619_0018640
735 Ga0495619_0058086
736 Ga0495619_0403154
737 Ga0500566_0417463
738 Ga0500658_0100062
739 Ga0587066_018342
740 Ga0530510_0293001

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6q6b-assembly1.cif.gz_A structure of the copper storage protein, ccsp, from streptomyces lividans loaded with 10 copper equivalents 0.6136 4 123
1yo7-assembly2.cif.gz_B re-engineering topology of the homodimeric rop protein into a single-chain 4-helix bundle 0.5707 1 120
1yo7-assembly2.cif.gz_B re-engineering topology of the homodimeric rop protein into a single-chain 4-helix bundle 0.5475 1 120
6q6b-assembly1.cif.gz_A structure of the copper storage protein, ccsp, from streptomyces lividans loaded with 10 copper equivalents 0.5462 4 123
6qvh-assembly1.cif.gz_A streptomyces lividans ccsp mutant - h113a 0.5197 2 120
ID Description Score Start End Superfamily
af_F6NXK9_9_185_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8304 4 120 1.20.120.550
af_A0A0R0G5K6_1_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7771 2 120 1.20.120.550
af_C6SWX3_2_116_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.7722 4 120 1.20.1280.290
af_C6SWX3_2_116_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.7496 4 120 1.20.1280.290
af_F6NXK9_9_185_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7449 4 120 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A7W0LIB4-F1-model_v4 Uncharacterized protein 0.985 4 123 GO:0016020
AF-A0A7W0LIB4-F1-model_v4 Uncharacterized protein 0.9609 4 123 GO:0016020
AF-A0A2V8GQ63-F1-model_v4 Uncharacterized protein 0.9563 1 130 GO:0016020
AF-A0A7V5ZGJ8-F1-model_v4 Uncharacterized protein 0.9485 3 122 GO:0016020
AF-A0A2V8GQ63-F1-model_v4 Uncharacterized protein 0.9348 1 130 GO:0016020

Map