F425455

General Info

Members Datasets Scaffolds Average Seq Length
370 236 740 286

Family's Representative Sequence

Representative Sequence 3300033179|Ga0307507_10137612|Ga0307507_101376122
Length 269
Sequence VTRDVDHGTAKLMPDVDRRRAWLLTVDGAPQSYVDLDAPTHLEFEYARRLGHVLDTVAEPGRALDVLHLGGGALTLPRYLAATRPGSRQDVIEADRGLLDLVVEQLPLPAHAGIALHCADARAWVEAAAPDSADVVLADVFGGSRVPAHLTSVAYARAVERTLRDGGVYLANLADAAPFAFLRSQLATFATAFEELAVLRGRRFGNAVLLASHRPLDTATLTRRTASDAFPARVEHGAALQDFIGAAEPVHDENAVPSPEPPDGAFGIG

Samples

Sample ID Description Type Environment
1 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
5 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
7 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
8 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
9 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
10 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
11 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
12 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
13 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
14 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
15 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
16 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
18 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
19 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
20 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
21 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
22 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
23 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
24 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
25 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
26 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
27 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
28 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
29 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
30 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
31 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
32 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
33 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
34 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
35 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
36 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
37 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
38 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
39 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
40 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
41 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
42 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
43 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
44 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
45 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
46 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
47 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
48 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
49 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
50 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
51 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
52 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
53 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
54 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
55 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
56 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
57 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
58 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
59 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
60 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
61 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
62 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
63 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
64 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
65 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
66 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
67 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
68 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
69 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
70 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
71 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
72 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
73 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
74 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
75 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
76 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
77 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
78 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
79 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
80 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
81 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
82 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
83 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
84 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
85 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
86 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
87 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
88 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
89 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
90 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
91 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
92 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
93 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
94 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
95 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
96 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
97 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
98 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
99 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
100 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
101 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
102 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
103 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
104 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
105 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
108 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
109 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
110 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
111 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
112 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
113 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
114 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
115 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
116 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
117 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
118 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
141 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
142 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
143 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
144 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
145 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
146 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
147 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
148 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
149 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
150 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
151 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
152 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
153 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
154 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
155 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
156 2643221548 Streptomyces sp. Root55 Isolate Unclassified
157 2643221578 Streptomyces sp. Root63 Isolate Unclassified
158 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
159 2643221647 Streptomyces sp. Root369 Isolate Unclassified
160 2643221670 Streptomyces sp. Root431 Isolate Unclassified
161 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
162 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
163 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
164 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
165 2643221714 Streptomyces sp. Root264 Isolate Unclassified
166 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
167 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
168 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
169 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
170 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
171 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
172 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
173 2808606448 Streptomyces sp. 193411 Isolate Unclassified
174 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
175 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
176 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
177 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
178 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
179 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
180 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
181 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
182 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
183 2862574272 Streptomyces sp. AcE210 Isolate Nodule
184 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
185 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
186 2867428634 Streptomyces sp. RP5T Isolate Unclassified
187 2867475112 Streptomyces sp. TM32 Isolate Unclassified
188 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
189 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
190 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
191 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
192 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
193 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
194 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
195 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
196 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
197 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
198 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
199 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
200 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
201 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
202 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
203 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
204 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
205 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
206 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
207 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
208 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
209 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
210 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
211 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
212 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
213 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
214 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
215 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
216 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
217 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
218 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
219 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
220 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
221 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
222 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
223 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
224 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
225 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
226 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
227 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
228 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
229 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
230 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
231 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
232 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
233 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
234 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
235 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
236 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.68
Metatranscriptomes 0.27
Isolates 24.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.51
Nodule 0.81
Rhizoplane 1.08
Rhizosphere 77.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307507_10137612 3300033179 Bacteria 1885
2 rootH2_10059764 3300003320 Bacteria 2078
3 Ga0006562J51391_1111508 3300003578 Bacteria 5830
4 Ga0068853_100231115 3300005539 Bacteria 1692
5 Ga0081455_10139303 3300005937 Bacteria 1886
6 Ga0105245_10077597 3300009098 Bacteria 3029
7 Ga0105243_10100370 3300009148 Bacteria 2401
8 Ga0105246_10001871 3300011119 Bacteria 12680
9 Ga0182008_10002988 3300014497 Bacteria 10409
10 Ga0182006_1027384 3300015261 Bacteria 2327
11 Ga0182007_10005791 3300015262 Bacteria 5373
12 Ga0183367_1006 3300015688 Bacteria 648044
13 Ga0209758_1015130 3300025297 Bacteria 4025
14 Ga0207426_1001546 3300025302 Bacteria 18702
15 Ga0207426_1005322 3300025302 Bacteria 5920
16 Ga0207426_1006174 3300025302 Bacteria 5272
17 Ga0207426_1033154 3300025302 Bacteria 1667
18 Ga0207647_10028430 3300025904 Bacteria 3631
19 Ga0207639_10177075 3300026041 Bacteria 1811
20 Ga0307517_10014630 3300028786 Bacteria 10516
21 Ga0307511_10003022 3300030521 Bacteria 17391
22 Ga0307511_10053925 3300030521 Bacteria 3179
23 Ga0307512_10035240 3300030522 Bacteria 4268
24 Ga0307513_10002405 3300031456 Bacteria 25920
25 Ga0307513_10061946 3300031456 Bacteria 3956
26 Ga0307509_10033603 3300031507 Bacteria 5645
27 Ga0307509_10038037 3300031507 Bacteria 5253
28 Ga0307509_10147101 3300031507 Bacteria 2279
29 Ga0307508_10003430 3300031616 Bacteria 16033
30 Ga0307508_10025904 3300031616 Bacteria 5317
31 Ga0307508_10143348 3300031616 Bacteria 1993
32 Ga0307514_10008060 3300031649 Bacteria 9013
33 Ga0307516_10110318 3300031730 Bacteria 2555
34 Ga0307516_10111499 3300031730 Bacteria 2537
35 Ga0307413_10219174 3300031824 Bacteria 1388
36 Ga0307518_10024619 3300031838 Bacteria 4338
37 Ga0307518_10076538 3300031838 Bacteria 2419
38 Ga0307507_10019863 3300033179 Bacteria 7548
39 Ga0307507_10045280 3300033179 Bacteria 4331
40 Ga0307507_10059135 3300033179 Bacteria 3591
41 Ga0307510_10023556 3300033180 Bacteria 7135
42 Ga0307510_10028971 3300033180 Bacteria 6310
43 Ga0307510_10181661 3300033180 Bacteria 1665
44 Ga0395900_0163043 3300037418 Bacteria 2273
45 Ga0395898_0005149 3300037466 Bacteria 14147
46 Ga0395898_0276743 3300037466 Bacteria 1601
47 Ga0395905_0137507 3300037471 Bacteria 2299
48 Ga0439439_0011391 3300041406 Bacteria 2139
49 Ga0451837_1543921 3300041494 Bacteria 3634
50 Ga0451847_0337088 3300041503 Bacteria 1179
51 Ga0451853_2061174 3300041512 Bacteria 4226
52 Ga0439433_0009928 3300041999 Bacteria 2078
53 Ga0439448_0001917 3300042005 Bacteria 5539
54 Ga0439432_017291 3300042006 Bacteria 2421
55 Ga0439450_023479 3300042008 Bacteria 1339
56 Ga0439455_0005107 3300042012 Bacteria 2646
57 Ga0439457_000108 3300042014 Bacteria 19635
58 Ga0439457_001632 3300042014 Bacteria 6680
59 Ga0450894_000174 3300042131 Bacteria 11456
60 Ga0450898_000186 3300042134 Bacteria 6558
61 Ga0450899_000019 3300042135 Bacteria 11891
62 Ga0450900_000877 3300042136 Bacteria 2673
63 Ga0450903_000134 3300042138 Bacteria 16193
64 Ga0450906_006697 3300042145 Bacteria 2307
65 Ga0439458_0000826 3300042157 Bacteria 7975
66 Ga0466969_0035258 3300044656 Bacteria 2530
67 Ga0466969_0041659 3300044656 Bacteria 2296
68 Ga0466972_0001015 3300044658 Bacteria 13449
69 Ga0466972_0010980 3300044658 Bacteria 4547
70 Ga0466972_0011005 3300044658 Bacteria 4541
71 Ga0466972_0097764 3300044658 Bacteria 1390
72 Ga0466965_0001465 3300044683 Bacteria 9537
73 Ga0466966_0049243 3300044684 Bacteria 2684
74 Ga0466966_0163986 3300044684 Bacteria 1352
75 Ga0466961_0022463 3300044693 Bacteria 4058
76 Ga0466961_0076566 3300044693 Bacteria 2120
77 Ga0466961_0077837 3300044693 Bacteria 2100
78 Ga0466963_0000522 3300044694 Bacteria 17993
79 Ga0466963_0001178 3300044694 Bacteria 13732
80 Ga0466964_0002703 3300044706 Bacteria 6358
81 Ga0466971_0001322 3300044719 Bacteria 10363
82 Ga0466971_0008252 3300044719 Bacteria 4544
83 Ga0466971_0010922 3300044719 Bacteria 3972
84 Ga0466968_0074834 3300044735 Bacteria 1479
85 Ga0466970_0003830 3300044765 Bacteria 7365
86 Ga0466970_0005017 3300044765 Bacteria 6542
87 Ga0466970_0106294 3300044765 Bacteria 1531
88 Ga0466957_0050995 3300044842 Bacteria 2518
89 Ga0466957_0111882 3300044842 Bacteria 1732
90 Ga0466960_0011094 3300044901 Bacteria 3756
91 Ga0466959_0003774 3300045049 Bacteria 10037
92 Ga0466967_0070769 3300045976 Bacteria 3121
93 Ga0466967_0457085 3300045976 Bacteria 1248
94 Ga0495617_009797 3300046452 Bacteria 3286
95 Ga0495627_018272 3300046453 Bacteria 2368
96 Ga0495592_0003075 3300046454 Bacteria 11902
97 Ga0495603_0001268 3300046455 Bacteria 14708
98 Ga0495603_0004231 3300046455 Bacteria 8544
99 Ga0495603_0009213 3300046455 Bacteria 5965
100 Ga0495603_0032157 3300046455 Bacteria 3157
101 Ga0495603_0036136 3300046455 Bacteria 2965
102 Ga0495590_0022640 3300046457 Bacteria 2222
103 Ga0495629_0003455 3300046459 Bacteria 11942
104 Ga0495629_0007322 3300046459 Bacteria 8133
105 Ga0495629_0009302 3300046459 Bacteria 7191
106 Ga0495629_0017475 3300046459 Bacteria 5139
107 Ga0495629_0064558 3300046459 Bacteria 2556
108 Ga0495638_0124623 3300046460 Bacteria 1519
109 Ga0495651_0004617 3300046462 Bacteria 10529
110 Ga0495653_0069433 3300046463 Bacteria 2640
111 Ga0495653_0208425 3300046463 Bacteria 1322
112 Ga0495662_0001009 3300046476 Bacteria 13804
113 Ga0495662_0011196 3300046476 Bacteria 4384
114 Ga0495662_0062872 3300046476 Bacteria 1793
115 Ga0495664_0012118 3300046477 Bacteria 4877
116 Ga0495594_0000495 3300046499 Bacteria 20094
117 Ga0495594_0033210 3300046499 Bacteria 2804
118 Ga0495594_0035893 3300046499 Bacteria 2702
119 Ga0495594_0058503 3300046499 Bacteria 2130
120 Ga0495583_0020627 3300046506 Bacteria 3407
121 Ga0495583_0065433 3300046506 Bacteria 1610
122 Ga0495606_0007008 3300046507 Bacteria 10229
123 Ga0495616_0006020 3300046513 Bacteria 7392
124 Ga0495620_0008629 3300046515 Bacteria 5464
125 Ga0495620_0018935 3300046515 Bacteria 3400
126 Ga0495620_0101736 3300046515 Bacteria 1145
127 Ga0495628_0268941 3300046516 Bacteria 1268
128 Ga0495630_0061651 3300046517 Bacteria 2816
129 Ga0495630_0357364 3300046517 Bacteria 1118
130 Ga0495666_0014423 3300046526 Bacteria 3934
131 Ga0495652_0061931 3300046529 Bacteria 3157
132 Ga0495652_0332867 3300046529 Bacteria 1093
133 Ga0495640_0022161 3300046533 Bacteria 4649
134 Ga0495587_0008930 3300046536 Bacteria 6432
135 Ga0495587_0157107 3300046536 Bacteria 1295
136 Ga0495609_0096523 3300046538 Bacteria 1282
137 Ga0495645_0045355 3300046543 Bacteria 3207
138 Ga0495645_0054534 3300046543 Bacteria 2904
139 Ga0495622_0005208 3300046557 Bacteria 6028
140 Ga0495622_0005729 3300046557 Bacteria 5757
141 Ga0495622_0140013 3300046557 Bacteria 1099
142 Ga0495668_0029628 3300046616 Bacteria 3091
143 Ga0495634_0001721 3300046642 Bacteria 18959
144 Ga0495634_0039107 3300046642 Bacteria 3231
145 Ga0495611_0006080 3300046648 Bacteria 5151
146 Ga0495611_0017933 3300046648 Bacteria 3032
147 Ga0495625_0014680 3300046660 Bacteria 6239
148 Ga0495625_0165883 3300046660 Bacteria 1477
149 Ga0495635_0020659 3300046663 Bacteria 4586
150 Ga0495635_0110999 3300046663 Bacteria 1873
151 Ga0495635_0120719 3300046663 Bacteria 1788
152 Ga0495588_0002157 3300046674 Bacteria 8416
153 Ga0495588_0002383 3300046674 Bacteria 8045
154 Ga0495588_0137985 3300046674 Bacteria 1287
155 Ga0495657_0004717 3300046675 Bacteria 10866
156 Ga0495657_0028465 3300046675 Bacteria 3930
157 Ga0495657_0036390 3300046675 Bacteria 3402
158 Ga0495623_0039044 3300046679 Bacteria 3035
159 Ga0495646_0006252 3300046680 Bacteria 7551
160 Ga0495646_0127400 3300046680 Bacteria 1436
161 Ga0495658_0030635 3300046683 Bacteria 2923
162 Ga0495613_0001444 3300046689 Bacteria 18157
163 Ga0495613_0003960 3300046689 Bacteria 11095
164 Ga0495613_0011065 3300046689 Bacteria 6698
165 Ga0495624_0032157 3300046690 Bacteria 3403
166 Ga0495624_0108298 3300046690 Bacteria 1709
167 Ga0495670_0111324 3300046691 Bacteria 1417
168 Ga0495649_0041212 3300046694 Bacteria 2526
169 Ga0495649_0211141 3300046694 Bacteria 1006
170 Ga0495589_0008240 3300046794 Bacteria 5444
171 Ga0495589_0023267 3300046794 Bacteria 3158
172 Ga0495600_0008034 3300046809 Bacteria 6467
173 Ga0495581_0009385 3300047315 Bacteria 5661
174 Ga0495581_0184217 3300047315 Bacteria 1221
175 Ga0495604_0004174 3300047317 Bacteria 11456
176 Ga0495636_0002083 3300047318 Bacteria 7684
177 Ga0495636_0005132 3300047318 Bacteria 5140
178 Ga0495636_0013736 3300047318 Bacteria 3214
179 Ga0495636_0095506 3300047318 Bacteria 1295
180 Ga0495674_0037861 3300047319 Bacteria 4333
181 Ga0495674_0245227 3300047319 Bacteria 1475
182 Ga0495676_0007630 3300047321 Bacteria 9922
183 Ga0495676_0011637 3300047321 Bacteria 7938
184 Ga0495676_0012282 3300047321 Bacteria 7716
185 Ga0495676_0017920 3300047321 Bacteria 6250
186 Ga0495676_0046181 3300047321 Bacteria 3537
187 Ga0495676_0060878 3300047321 Bacteria 2956
188 Ga0495676_0084929 3300047321 Bacteria 2386
189 Ga0495680_0007427 3300047322 Bacteria 10051
190 Ga0495687_003658 3300047443 Bacteria 10950
191 Ga0495687_013413 3300047443 Bacteria 4279
192 Ga0495675_0002761 3300047444 Bacteria 10526
193 Ga0495677_0016602 3300047445 Bacteria 2672
194 Ga0495677_0103916 3300047445 Bacteria 1077
195 Ga0495685_002590 3300047447 Bacteria 5696
196 Ga0495685_028222 3300047447 Bacteria 1930
197 Ga0495685_042705 3300047447 Bacteria 1547
198 Ga0495681_0000354 3300047470 Bacteria 35817
199 Ga0495684_0123911 3300047471 Bacteria 1945
200 Ga0495593_0001423 3300047673 Bacteria 14034
201 Ga0495593_0019534 3300047673 Bacteria 3798
202 Ga0495602_0055544 3300048088 Bacteria 3487
203 Ga0495614_0002926 3300048089 Bacteria 7605
204 Ga0495614_0007632 3300048089 Bacteria 4810
205 Ga0495614_0011156 3300048089 Bacteria 3955
206 Ga0495614_0035467 3300048089 Bacteria 2143
207 Ga0496106_0441614 3300048909 Bacteria 1045
208 Ga0496108_0394229 3300048911 Bacteria 1209
209 Ga0496110_0152904 3300048913 Bacteria 2090
210 Ga0501031_0064158 3300049568 Bacteria 2392
211 Ga0501032_0004558 3300049569 Bacteria 10426
212 Ga0501032_0136838 3300049569 Bacteria 1614
213 Ga0501032_0160986 3300049569 Bacteria 1474
214 Ga0501033_0001126 3300049570 Bacteria 24221
215 Ga0501033_0005191 3300049570 Bacteria 10348
216 Ga0501033_0008111 3300049570 Bacteria 8137
217 Ga0501033_0075397 3300049570 Bacteria 2475
218 Ga0501033_0377232 3300049570 Bacteria 991
219 Ga0501034_0001336 3300049571 Bacteria 33314
220 Ga0501034_0033549 3300049571 Bacteria 5207
221 Ga0501034_0102418 3300049571 Bacteria 2856
222 Ga0501036_0004813 3300049572 Bacteria 10914
223 Ga0501036_0021775 3300049572 Bacteria 5388
224 Ga0501036_0080547 3300049572 Bacteria 2752
225 Ga0501036_0232394 3300049572 Bacteria 1547
226 Ga0501037_0003888 3300049573 Bacteria 10838
227 Ga0501037_0036867 3300049573 Bacteria 3604
228 Ga0501037_0047234 3300049573 Bacteria 3156
229 Ga0501038_0004786 3300049574 Bacteria 12578
230 Ga0501038_0024675 3300049574 Bacteria 5360
231 Ga0501038_0082827 3300049574 Bacteria 2701
232 Ga0501038_0095388 3300049574 Bacteria 2485
233 Ga0501038_0164912 3300049574 Bacteria 1798
234 Ga0501039_0001764 3300049575 Bacteria 15963
235 Ga0501042_0002150 3300049578 Bacteria 11986
236 Ga0501043_0002657 3300049579 Bacteria 15031
237 Ga0501043_0073677 3300049579 Bacteria 2682
238 Ga0501043_0078939 3300049579 Bacteria 2586
239 Ga0501043_0141065 3300049579 Bacteria 1887
240 Ga0501046_0108894 3300049580 Bacteria 2118
241 Ga0501046_0192813 3300049580 Bacteria 1519
242 Ga0501047_0012838 3300049581 Bacteria 7936
243 Ga0501047_0067222 3300049581 Bacteria 3454
244 Ga0501047_0077045 3300049581 Bacteria 3208
245 Ga0501047_0160464 3300049581 Bacteria 2120
246 Ga0501047_0243475 3300049581 Bacteria 1648
247 Ga0501047_0304289 3300049581 Bacteria 1436
248 Ga0501048_0005204 3300049582 Bacteria 9911
249 Ga0501048_0038772 3300049582 Bacteria 3419
250 Ga0501048_0227337 3300049582 Bacteria 1324
251 Ga0501069_0027075 3300049585 Bacteria 3142
252 Ga0501070_0001722 3300049586 Bacteria 19349
253 Ga0501070_0163453 3300049586 Bacteria 1835
254 Ga0501070_0250932 3300049586 Bacteria 1447
255 Ga0501070_0265407 3300049586 Bacteria 1403
256 Ga0501074_0000779 3300049590 Bacteria 20132
257 Ga0501080_0069132 3300049742 Bacteria 3284
258 Ga0501035_0000861 3300049822 Bacteria 32362
259 Ga0501035_0074171 3300049822 Bacteria 3010
260 Ga0501035_0075486 3300049822 Bacteria 2981
261 Ga0501035_0087254 3300049822 Bacteria 2750
262 Ga0501035_0175859 3300049822 Bacteria 1846
263 Ga0501035_0185378 3300049822 Bacteria 1791
264 Ga0501044_0002961 3300049823 Bacteria 19311
265 Ga0501044_0005648 3300049823 Bacteria 13876
266 Ga0501044_0035346 3300049823 Bacteria 5233
267 Ga0501044_0054878 3300049823 Bacteria 4093
268 Ga0501044_0070371 3300049823 Bacteria 3558
269 Ga0501044_0094208 3300049823 Bacteria 3019
270 Ga0501044_0095236 3300049823 Bacteria 3000
271 nmdc:mga03n38_92431_c1 3300050490 Bacteria 1443
272 Ga0500610_0111049 3300053079 Bacteria 1410
273 Ga0495619_0037076 3300053085 Bacteria 3176
274 Ga0500583_0127562 3300053092 Bacteria 1261
275 Ga0500640_002135 3300053095 Bacteria 6409
276 Ga0500560_012027 3300053107 Bacteria 2228
277 Ga0500573_0078754 3300053140 Bacteria 1875
278 Ga0500573_0095925 3300053140 Bacteria 1672
279 Ga0500636_0233748 3300053177 Bacteria 949
280 Ga0466962_0003184 3300061719 Bacteria 7795
281 Ga0466962_0073455 3300061719 Bacteria 1634
282 2547407022 2547132111 Bacteria 8013147
283 2554258381 2554235005 Bacteria 6457341
284 2585299946 2582581312 Bacteria 7308206
285 2585311550 2582581313 Bacteria 10042643
286 2585315846 2582581314 Bacteria 11452267
287 2616697594 2616644814 Bacteria 11555299
288 2616906046 2616644941 Bacteria 8510691
289 2643765296 2643221548 Bacteria 8053412
290 2643898105 2643221578 Bacteria 9213798
291 2643944506 2643221587 Bacteria 7586415
292 2644264645 2643221647 Bacteria 10741251
293 2644385569 2643221670 Bacteria 6497041
294 2644409251 2643221673 Bacteria 9196637
295 2644431404 2643221677 Bacteria 7584031
296 2644436607 2643221678 Bacteria 9540101
297 2644462633 2643221682 Bacteria 6743283
298 2644625563 2643221714 Bacteria 9015452
299 2784588062 2784132148 Bacteria 8627943
300 2785343988 2784746763 Bacteria 9783172
301 2785368835 2784746768 Bacteria 10036182
302 2786670021 2786546132 Bacteria 10419719
303 2793982102 2791355406 Bacteria 11364898
304 2808841499 2808606359 Bacteria 9866990
305 2808920059 2808606375 Bacteria 9466072
306 2809231662 2808606448 Bacteria 8656184
307 2811848455 2808606982 Bacteria 7791042
308 2812358748 2811994879 Bacteria 9313447
309 2812481051 2811994917 Bacteria 7761064
310 2819693477 2818991463 Bacteria 7948711
311 2852641961 2852635781 Bacteria 8251373
312 2862184713 2862178590 Bacteria 8583590
313 2862287878 2862281513 Bacteria 9621493
314 2862387098 2862382967 Bacteria 10317375
315 2862511515 2862507626 Bacteria 9425308
316 2862579795 2862574272 Bacteria 10567477
317 2862707121 2862705112 Bacteria 6563286
318 2863405276 2863404153 Bacteria 9672205
319 2867434761 2867428634 Bacteria 9590268
320 2867475362 2867475112 Bacteria 6909112
321 2873156311 2873151551 Bacteria 8625867
322 2875393997 2875391855 Bacteria 7600475
323 2877681681 2877676314 Bacteria 9512378
324 2912720643 2912715099 Bacteria 9460473
325 2912724809 2912723979 Bacteria 8557534
326 2912760111 2912757875 Bacteria 7940295
327 2918504003 2918501144 Bacteria 8668083
328 2919473501 2919468124 Bacteria 9133025
329 2935394653 2935390628 Bacteria 7043367
330 2946050627 2946045630 Bacteria 8527308
331 2946067130 2946064051 Bacteria 8957905
332 2946075415 2946072368 Bacteria 8999607
333 2947230111 2947224130 Bacteria 9938529
334 2954003319 2954002825 Bacteria 9173742
335 2954386825 2954380949 Bacteria 10050426
336 2954676363 2954673503 Bacteria 9685905
337 2954687805 2954682443 Bacteria 9862841
338 2954697642 2954691527 Bacteria 10720516
339 2954704573 2954701450 Bacteria 10834262
340 2954716783 2954711539 Bacteria 10867210
341 2954726730 2954721474 Bacteria 10456478
342 2954735065 2954731030 Bacteria 10243860
343 2954745653 2954740390 Bacteria 10229294
344 2954753936 2954749733 Bacteria 10366972
345 2954764627 2954759201 Bacteria 9358192
346 2966603094 2966598605 Bacteria 7676064
347 2990060968 2990059506 Bacteria 9321252
348 2997452661 2997451912 Bacteria 8492419
349 2997607988 2997600082 Bacteria 9896405
350 3006394850 3006393351 Bacteria 6615579
351 3006426748 3006425503 Bacteria 6491253
352 3006486541 3006486233 Bacteria 8157040
353 3006487941 3006486233 Bacteria 8157040
354 3006496355 3006493962 Bacteria 8825450
355 8008487835 8008485437 Bacteria 7198341
356 8008559800 8008558824 Bacteria 10610750
357 8008579356 8008574985 Bacteria 7815457
358 8023631062 8023623736 Bacteria 8593882
359 8025482873 8025478263 Bacteria 8209203
360 8025526646 8025524527 Bacteria 7197316
361 8025533235 8025530807 Bacteria 8495698
362 8047898666 8047893842 Bacteria 11723082
363 8048136032 8048127548 Bacteria 11053136
364 8048360253 8048356638 Bacteria 11044339
365 8048375628 8048369669 Bacteria 11666822
366 8048382577 8048379754 Bacteria 11877923
367 8048413289 8048406513 Bacteria 8936924
368 8054162851 8054160619 Bacteria 7783213
369 8056451439 8056447290 Bacteria 7680491
370 8056672385 8056667051 Bacteria 6953971
371 Ga0307507_10137612
372 rootH2_10059764
373 Ga0006562J51391_1111508
374 Ga0068853_100231115
375 Ga0081455_10139303
376 Ga0105245_10077597
377 Ga0105243_10100370
378 Ga0105246_10001871
379 Ga0182008_10002988
380 Ga0182006_1027384
381 Ga0182007_10005791
382 Ga0183367_1006
383 Ga0209758_1015130
384 Ga0207426_1001546
385 Ga0207426_1005322
386 Ga0207426_1006174
387 Ga0207426_1033154
388 Ga0207647_10028430
389 Ga0207639_10177075
390 Ga0307517_10014630
391 Ga0307511_10003022
392 Ga0307511_10053925
393 Ga0307512_10035240
394 Ga0307513_10002405
395 Ga0307513_10061946
396 Ga0307509_10033603
397 Ga0307509_10038037
398 Ga0307509_10147101
399 Ga0307508_10003430
400 Ga0307508_10025904
401 Ga0307508_10143348
402 Ga0307514_10008060
403 Ga0307516_10110318
404 Ga0307516_10111499
405 Ga0307413_10219174
406 Ga0307518_10024619
407 Ga0307518_10076538
408 Ga0307507_10019863
409 Ga0307507_10045280
410 Ga0307507_10059135
411 Ga0307510_10023556
412 Ga0307510_10028971
413 Ga0307510_10181661
414 Ga0395900_0163043
415 Ga0395898_0005149
416 Ga0395898_0276743
417 Ga0395905_0137507
418 Ga0439439_0011391
419 Ga0451837_1543921
420 Ga0451847_0337088
421 Ga0451853_2061174
422 Ga0439433_0009928
423 Ga0439448_0001917
424 Ga0439432_017291
425 Ga0439450_023479
426 Ga0439455_0005107
427 Ga0439457_000108
428 Ga0439457_001632
429 Ga0450894_000174
430 Ga0450898_000186
431 Ga0450899_000019
432 Ga0450900_000877
433 Ga0450903_000134
434 Ga0450906_006697
435 Ga0439458_0000826
436 Ga0466969_0035258
437 Ga0466969_0041659
438 Ga0466972_0001015
439 Ga0466972_0010980
440 Ga0466972_0011005
441 Ga0466972_0097764
442 Ga0466965_0001465
443 Ga0466966_0049243
444 Ga0466966_0163986
445 Ga0466961_0022463
446 Ga0466961_0076566
447 Ga0466961_0077837
448 Ga0466963_0000522
449 Ga0466963_0001178
450 Ga0466964_0002703
451 Ga0466971_0001322
452 Ga0466971_0008252
453 Ga0466971_0010922
454 Ga0466968_0074834
455 Ga0466970_0003830
456 Ga0466970_0005017
457 Ga0466970_0106294
458 Ga0466957_0050995
459 Ga0466957_0111882
460 Ga0466960_0011094
461 Ga0466959_0003774
462 Ga0466967_0070769
463 Ga0466967_0457085
464 Ga0495617_009797
465 Ga0495627_018272
466 Ga0495592_0003075
467 Ga0495603_0001268
468 Ga0495603_0004231
469 Ga0495603_0009213
470 Ga0495603_0032157
471 Ga0495603_0036136
472 Ga0495590_0022640
473 Ga0495629_0003455
474 Ga0495629_0007322
475 Ga0495629_0009302
476 Ga0495629_0017475
477 Ga0495629_0064558
478 Ga0495638_0124623
479 Ga0495651_0004617
480 Ga0495653_0069433
481 Ga0495653_0208425
482 Ga0495662_0001009
483 Ga0495662_0011196
484 Ga0495662_0062872
485 Ga0495664_0012118
486 Ga0495594_0000495
487 Ga0495594_0033210
488 Ga0495594_0035893
489 Ga0495594_0058503
490 Ga0495583_0020627
491 Ga0495583_0065433
492 Ga0495606_0007008
493 Ga0495616_0006020
494 Ga0495620_0008629
495 Ga0495620_0018935
496 Ga0495620_0101736
497 Ga0495628_0268941
498 Ga0495630_0061651
499 Ga0495630_0357364
500 Ga0495666_0014423
501 Ga0495652_0061931
502 Ga0495652_0332867
503 Ga0495640_0022161
504 Ga0495587_0008930
505 Ga0495587_0157107
506 Ga0495609_0096523
507 Ga0495645_0045355
508 Ga0495645_0054534
509 Ga0495622_0005208
510 Ga0495622_0005729
511 Ga0495622_0140013
512 Ga0495668_0029628
513 Ga0495634_0001721
514 Ga0495634_0039107
515 Ga0495611_0006080
516 Ga0495611_0017933
517 Ga0495625_0014680
518 Ga0495625_0165883
519 Ga0495635_0020659
520 Ga0495635_0110999
521 Ga0495635_0120719
522 Ga0495588_0002157
523 Ga0495588_0002383
524 Ga0495588_0137985
525 Ga0495657_0004717
526 Ga0495657_0028465
527 Ga0495657_0036390
528 Ga0495623_0039044
529 Ga0495646_0006252
530 Ga0495646_0127400
531 Ga0495658_0030635
532 Ga0495613_0001444
533 Ga0495613_0003960
534 Ga0495613_0011065
535 Ga0495624_0032157
536 Ga0495624_0108298
537 Ga0495670_0111324
538 Ga0495649_0041212
539 Ga0495649_0211141
540 Ga0495589_0008240
541 Ga0495589_0023267
542 Ga0495600_0008034
543 Ga0495581_0009385
544 Ga0495581_0184217
545 Ga0495604_0004174
546 Ga0495636_0002083
547 Ga0495636_0005132
548 Ga0495636_0013736
549 Ga0495636_0095506
550 Ga0495674_0037861
551 Ga0495674_0245227
552 Ga0495676_0007630
553 Ga0495676_0011637
554 Ga0495676_0012282
555 Ga0495676_0017920
556 Ga0495676_0046181
557 Ga0495676_0060878
558 Ga0495676_0084929
559 Ga0495680_0007427
560 Ga0495687_003658
561 Ga0495687_013413
562 Ga0495675_0002761
563 Ga0495677_0016602
564 Ga0495677_0103916
565 Ga0495685_002590
566 Ga0495685_028222
567 Ga0495685_042705
568 Ga0495681_0000354
569 Ga0495684_0123911
570 Ga0495593_0001423
571 Ga0495593_0019534
572 Ga0495602_0055544
573 Ga0495614_0002926
574 Ga0495614_0007632
575 Ga0495614_0011156
576 Ga0495614_0035467
577 Ga0496106_0441614
578 Ga0496108_0394229
579 Ga0496110_0152904
580 Ga0501031_0064158
581 Ga0501032_0004558
582 Ga0501032_0136838
583 Ga0501032_0160986
584 Ga0501033_0001126
585 Ga0501033_0005191
586 Ga0501033_0008111
587 Ga0501033_0075397
588 Ga0501033_0377232
589 Ga0501034_0001336
590 Ga0501034_0033549
591 Ga0501034_0102418
592 Ga0501036_0004813
593 Ga0501036_0021775
594 Ga0501036_0080547
595 Ga0501036_0232394
596 Ga0501037_0003888
597 Ga0501037_0036867
598 Ga0501037_0047234
599 Ga0501038_0004786
600 Ga0501038_0024675
601 Ga0501038_0082827
602 Ga0501038_0095388
603 Ga0501038_0164912
604 Ga0501039_0001764
605 Ga0501042_0002150
606 Ga0501043_0002657
607 Ga0501043_0073677
608 Ga0501043_0078939
609 Ga0501043_0141065
610 Ga0501046_0108894
611 Ga0501046_0192813
612 Ga0501047_0012838
613 Ga0501047_0067222
614 Ga0501047_0077045
615 Ga0501047_0160464
616 Ga0501047_0243475
617 Ga0501047_0304289
618 Ga0501048_0005204
619 Ga0501048_0038772
620 Ga0501048_0227337
621 Ga0501069_0027075
622 Ga0501070_0001722
623 Ga0501070_0163453
624 Ga0501070_0250932
625 Ga0501070_0265407
626 Ga0501074_0000779
627 Ga0501080_0069132
628 Ga0501035_0000861
629 Ga0501035_0074171
630 Ga0501035_0075486
631 Ga0501035_0087254
632 Ga0501035_0175859
633 Ga0501035_0185378
634 Ga0501044_0002961
635 Ga0501044_0005648
636 Ga0501044_0035346
637 Ga0501044_0054878
638 Ga0501044_0070371
639 Ga0501044_0094208
640 Ga0501044_0095236
641 nmdc:mga03n38_92431_c1
642 Ga0500610_0111049
643 Ga0495619_0037076
644 Ga0500583_0127562
645 Ga0500640_002135
646 Ga0500560_012027
647 Ga0500573_0078754
648 Ga0500573_0095925
649 Ga0500636_0233748
650 Ga0466962_0003184
651 Ga0466962_0073455
652 2547407022
653 2554258381
654 2585299946
655 2585311550
656 2585315846
657 2616697594
658 2616906046
659 2643765296
660 2643898105
661 2643944506
662 2644264645
663 2644385569
664 2644409251
665 2644431404
666 2644436607
667 2644462633
668 2644625563
669 2784588062
670 2785343988
671 2785368835
672 2786670021
673 2793982102
674 2808841499
675 2808920059
676 2809231662
677 2811848455
678 2812358748
679 2812481051
680 2819693477
681 2852641961
682 2862184713
683 2862287878
684 2862387098
685 2862511515
686 2862579795
687 2862707121
688 2863405276
689 2867434761
690 2867475362
691 2873156311
692 2875393997
693 2877681681
694 2912720643
695 2912724809
696 2912760111
697 2918504003
698 2919473501
699 2935394653
700 2946050627
701 2946067130
702 2946075415
703 2947230111
704 2954003319
705 2954386825
706 2954676363
707 2954687805
708 2954697642
709 2954704573
710 2954716783
711 2954726730
712 2954735065
713 2954745653
714 2954753936
715 2954764627
716 2966603094
717 2990060968
718 2997452661
719 2997607988
720 3006394850
721 3006426748
722 3006486541
723 3006487941
724 3006496355
725 8008487835
726 8008559800
727 8008579356
728 8023631062
729 8025482873
730 8025526646
731 8025533235
732 8047898666
733 8048136032
734 8048360253
735 8048375628
736 8048382577
737 8048413289
738 8054162851
739 8056451439
740 8056672385

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gjy-assembly1.cif.gz_A crystal structure of a probable spermidine synthase from corynebacterium glutamicum atcc 13032 0.9042 2 253
3gjy-assembly1.cif.gz_A crystal structure of a probable spermidine synthase from corynebacterium glutamicum atcc 13032 0.8748 2 253
3ujd-assembly1.cif.gz_A phosphoethanolamine methyltransferase mutant (y19f) from plasmodium falciparum in complex with phosphocholine 0.7869 42 170
3ujc-assembly1.cif.gz_A phosphoethanolamine methyltransferase mutant (h132a) from plasmodium falciparum in complex with phosphocholine 0.786 42 170
1ve3-assembly1.cif.gz_A-3 crystal structure of ph0226 protein from pyrococcus horikoshii ot3 0.7835 54 172
ID Description Score Start End Superfamily
3gjyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8692 2 253 3.40.50.150
3gjyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8413 2 253 3.40.50.150
3dliB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8281 38 167 3.40.50.150
af_Q8IEF7_65_300_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8056 44 165 3.40.50.150
af_A0A1D6MBP0_252_453_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7924 38 163 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A4D4KYJ0-F1-model_v4 Spermine synthase 0.9804 2 249 GO:0006596
AF-A0A7K3B780-F1-model_v4 Spermine synthase 0.9764 2 252 GO:0006596
AF-A0A7V9DR03-F1-model_v4 Spermine synthase 0.9732 2 107
AF-A0A6F8YPD7-F1-model_v4 PABS domain-containing protein 0.9697 2 253 GO:0006596
AF-A0A6B3HM79-F1-model_v4 Methyltransferase domain-containing protein 0.9668 19 186 GO:0006596
GO:0008168
GO:0032259

Map