F425320

General Info

Members Datasets Scaffolds Average Seq Length
370 205 333 188

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100002949|Ga0070665_1000029495
Length 188
Sequence VTAVDTRETILNAARAVAQAHGYGGLSFRELAKEVGIKSASIHYHFPTKGDLAAALARQYTERAKGELEAILEEVDEPAACLKRYVALFRRALENGNRMCLCGILAAGYEDIPREVRAEVVAFADLNVAWLTKVLGRVRGAKGPAKEQWGQAIYAAIGGAQLAARSRGDIATFDQIVAGYSASGLIPS

Samples

Sample ID Description Type Environment
1 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
2 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
3 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
4 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
5 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
6 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
7 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
8 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
9 2643221664 Massilia sp. Root418 Isolate Unclassified
10 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
11 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
12 2738541280 Massilia sp. GV090 Isolate Unclassified
13 2738541293 Rhizobium sp. GV031 Isolate Unclassified
14 2738541300 Massilia sp. GV016 Isolate Unclassified
15 2738543018 Massilia sp. GV045 Isolate Unclassified
16 2738543030 Massilia sp. GV097 Isolate Unclassified
17 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
18 2802429634 Rhizobium anhuiense S10 Isolate Nodule
19 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
20 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
21 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
22 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
23 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
24 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
25 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
26 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
27 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
28 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
29 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
30 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
31 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
32 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
33 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
34 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
35 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
36 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
37 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
38 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
39 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
40 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
41 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
42 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
43 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
44 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
45 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
46 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
47 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
67 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
68 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
69 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
95 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
96 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
97 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
98 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
99 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
100 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
101 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
102 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
103 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
104 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
105 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
106 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
107 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
108 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
109 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
110 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
114 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
115 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
118 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
119 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
122 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
123 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
124 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
130 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
131 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
132 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
133 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
136 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
141 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
142 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
143 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
144 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
145 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
146 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
152 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
153 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
154 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
164 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
165 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
166 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
167 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
175 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
176 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
179 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
180 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
181 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
182 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
183 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
184 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
185 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
186 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
187 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
188 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
189 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
190 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
191 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
192 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
193 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
194 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
195 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
196 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
197 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
198 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
199 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
200 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
201 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
202 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
203 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
204 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
205 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90
Metatranscriptomes 0
Isolates 10

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.81
Nodule 5.41
Rhizoplane 2.7
Rhizosphere 51.35
Stem 0
Stem Tuber 0
Unclassified 19.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1002595 3300002705 Bacteria 6373
2 JGI25162J39368_1000196 3300002737 Bacteria 63573
3 JGI25154J39366_1000128 3300002738 Bacteria 59551
4 JGI25159J45721_1015103 3300002987 Bacteria 1708
5 JGI25165J46597_1000292 3300003214 Bacteria 63577
6 JGI25153J46596_10000315 3300003215 Bacteria 35615
7 rootL2_10121188 3300003322 Bacteria 3810
8 rootH1_10348352 3300003323 Bacteria 1326
9 JGI25160J50197_1000023 3300003354 Bacteria 200692
10 JGI25160J50197_1015254 3300003354 Bacteria 2531
11 JGI25161J50226_1000012 3300003374 Bacteria 200668
12 Ga0055539_1018092 3300003752 Bacteria 849
13 Ga0055540_1000531 3300003792 Bacteria 28690
14 Ga0055543_1000009 3300004625 Bacteria 200706
15 Ga0065165_1000064 3300005262 Bacteria 175153
16 Ga0070669_100446124 3300005353 Bacteria 1066
17 Ga0070665_100002949 3300005548 Bacteria 18386
18 Ga0068856_100004493 3300005614 Bacteria 13871
19 Ga0068856_100081973 3300005614 Bacteria 3201
20 Ga0068862_101042840 3300005844 Bacteria 810
21 Ga0075365_10119282 3300006038 Bacteria 1818
22 Ga0075364_10072465 3300006051 Bacteria 2270
23 Ga0075364_10505037 3300006051 Bacteria 826
24 Ga0075367_10502597 3300006178 Bacteria 769
25 Ga0075369_10025193 3300006186 Bacteria 2471
26 Ga0075366_10060589 3300006195 Bacteria 2248
27 Ga0075370_10041653 3300006353 Bacteria 2592
28 Ga0075370_10083451 3300006353 Bacteria 1838
29 Ga0097620_100094430 3300006931 Bacteria 3043
30 Ga0105251_10000623 3300009011 Bacteria 32586
31 Ga0105240_10007957 3300009093 Bacteria 15295
32 Ga0105247_10009868 3300009101 Bacteria 5783
33 Ga0105247_10177898 3300009101 Bacteria 1418
34 Ga0105237_10055626 3300009545 Bacteria 3963
35 Ga0157373_10076127 3300013100 Bacteria 2368
36 Ga0157369_10521473 3300013105 Bacteria 1229
37 Ga0157379_10315353 3300014968 Bacteria 1427
38 Ga0182005_1034376 3300015265 Bacteria 1379
39 Ga0209435_100131 3300025206 Bacteria 25636
40 Ga0209437_100312 3300025233 Bacteria 65593
41 Ga0209646_1000155 3300025246 Bacteria 95204
42 Ga0209026_1001247 3300025250 Bacteria 11646
43 Ga0209677_100351 3300025253 Bacteria 28656
44 Ga0209148_1001319 3300025254 Bacteria 13175
45 Ga0209148_1011658 3300025254 Bacteria 1628
46 Ga0209759_1000375 3300025256 Bacteria 55963
47 Ga0209759_1021151 3300025256 Bacteria 1489
48 Ga0209233_1000230 3300025261 Bacteria 97941
49 Ga0209233_1004977 3300025261 Bacteria 4466
50 Ga0209455_1003711 3300025272 Bacteria 5285
51 Ga0209455_1007749 3300025272 Bacteria 2993
52 Ga0209455_1008410 3300025272 Bacteria 2808
53 Ga0209673_1000022 3300025273 Bacteria 413125
54 Ga0209130_1000048 3300025284 Bacteria 233357
55 Ga0209130_1000528 3300025284 Bacteria 38547
56 Ga0209564_1000440 3300025295 Bacteria 71511
57 Ga0209758_1000048 3300025297 Bacteria 358400
58 Ga0209050_1000060 3300025298 Bacteria 321699
59 Ga0209256_1000970 3300025299 Bacteria 34492
60 Ga0207426_1000136 3300025302 Bacteria 201401
61 Ga0207426_1000358 3300025302 Bacteria 83113
62 Ga0207426_1000420 3300025302 Bacteria 69895
63 Ga0209051_1000037 3300025303 Bacteria 321747
64 Ga0209257_1009510 3300025304 Bacteria 5176
65 Ga0207713_1000481 3300025735 Bacteria 41406
66 Ga0207710_10036031 3300025900 Bacteria 2180
67 Ga0207710_10123263 3300025900 Bacteria 1239
68 Ga0207695_10002671 3300025913 Bacteria 26049
69 Ga0207658_10390747 3300025986 Bacteria 1221
70 Ga0207702_10031335 3300026078 Bacteria 4432
71 Ga0207702_10151906 3300026078 Unclassified 2107
72 Ga0268266_10006890 3300028379 Bacteria 10345
73 Ga0268265_10985379 3300028380 Bacteria 832
74 Ga0307513_10366962 3300031456 Bacteria 1183
75 Ga0307412_10005928 3300031911 Bacteria 6888
76 Ga0439438_000450 3300041405 Bacteria 18562
77 Ga0451787_571441 3300041441 Bacteria 1602
78 Ga0451833_0610564 3300041491 Bacteria 1509
79 Ga0451833_0868791 3300041491 Bacteria 812
80 Ga0451835_0016286 3300041492 Bacteria 3071
81 Ga0451835_0597552 3300041492 Bacteria 1827
82 Ga0451835_0867582 3300041492 Bacteria 1341
83 Ga0451835_1193436 3300041492 Bacteria 1020
84 Ga0451839_0843655 3300041496 Bacteria 1338
85 Ga0451839_1503336 3300041496 Bacteria 3876
86 Ga0451841_0258911 3300041498 Bacteria 1046
87 Ga0451841_0511162 3300041498 Bacteria 2036
88 Ga0451845_0127159 3300041501 Bacteria 2588
89 Ga0451845_0606547 3300041501 Bacteria 1896
90 Ga0451847_0393911 3300041503 Bacteria 1648
91 Ga0451847_0529332 3300041503 Bacteria 2367
92 Ga0451847_0880430 3300041503 Bacteria 3314
93 Ga0451849_1459255 3300041505 Bacteria 1297
94 Ga0451851_0507517 3300041507 Bacteria 2117
95 Ga0451851_0698488 3300041507 Bacteria 2598
96 Ga0451843_0092546 3300041509 Bacteria 2275
97 Ga0451843_0402790 3300041509 Bacteria 1211
98 Ga0451855_1507476 3300041511 Bacteria 1957
99 Ga0451853_0023355 3300041512 Bacteria 1374
100 Ga0451853_0911215 3300041512 Bacteria 2472
101 Ga0439452_009334 3300042010 Bacteria 2893
102 Ga0439463_050266 3300042016 Bacteria 1063
103 Ga0495617_024900 3300046452 Bacteria 2018
104 Ga0495617_050194 3300046452 Bacteria 1388
105 Ga0495591_000640 3300046458 Bacteria 25873
106 Ga0495629_0051382 3300046459 Bacteria 2885
107 Ga0495638_0000629 3300046460 Bacteria 38947
108 Ga0495638_0065776 3300046460 Bacteria 2230
109 Ga0495650_0004126 3300046471 Bacteria 10121
110 Ga0495650_0022091 3300046471 Bacteria 3058
111 Ga0495650_0067617 3300046471 Bacteria 1411
112 Ga0495605_0002755 3300046474 Bacteria 10731
113 Ga0495605_0007150 3300046474 Bacteria 6350
114 Ga0495605_0010497 3300046474 Bacteria 5180
115 Ga0495605_0035108 3300046474 Bacteria 2536
116 Ga0495584_0017858 3300046491 Bacteria 3608
117 Ga0495585_0013590 3300046492 Bacteria 4758
118 Ga0495585_0017457 3300046492 Bacteria 4145
119 Ga0495585_0056110 3300046492 Unclassified 2176
120 Ga0495585_0063601 3300046492 Bacteria 2025
121 Ga0495594_0003210 3300046499 Bacteria 8469
122 Ga0495594_0177708 3300046499 Bacteria 1211
123 Ga0495607_0000047 3300046501 Bacteria 121696
124 Ga0495607_0000424 3300046501 Bacteria 42978
125 Ga0495607_0001437 3300046501 Bacteria 21228
126 Ga0495607_0006051 3300046501 Bacteria 8566
127 Ga0495607_0006062 3300046501 Bacteria 8561
128 Ga0495607_0014028 3300046501 Bacteria 5231
129 Ga0495607_0103040 3300046501 Bacteria 1525
130 Ga0495607_0111570 3300046501 Unclassified 1449
131 Ga0495583_0000047 3300046506 Bacteria 217720
132 Ga0495583_0001037 3300046506 Bacteria 31392
133 Ga0495583_0003438 3300046506 Bacteria 12051
134 Ga0495583_0269409 3300046506 Bacteria 680
135 Ga0495583_0270457 3300046506 Bacteria 678
136 Ga0495606_0000924 3300046507 Bacteria 43266
137 Ga0495606_0001576 3300046507 Bacteria 29890
138 Ga0495606_0005955 3300046507 Bacteria 11442
139 Ga0495606_0031874 3300046507 Bacteria 3659
140 Ga0495606_0099051 3300046507 Bacteria 1778
141 Ga0495606_0106341 3300046507 Bacteria 1699
142 Ga0495606_0200205 3300046507 Bacteria 1138
143 Ga0495610_0037917 3300046512 Bacteria 2449
144 Ga0495610_0056986 3300046512 Bacteria 1876
145 Ga0495610_0062031 3300046512 Bacteria 1774
146 Ga0495610_0078519 3300046512 Bacteria 1521
147 Ga0495616_0021146 3300046513 Bacteria 3527
148 Ga0495616_0052959 3300046513 Bacteria 2018
149 Ga0495620_0000225 3300046515 Bacteria 42537
150 Ga0495620_0002464 3300046515 Bacteria 10728
151 Ga0495620_0005152 3300046515 Bacteria 7317
152 Ga0495620_0021544 3300046515 Bacteria 3128
153 Ga0495620_0271669 3300046515 Bacteria 645
154 Ga0495631_0011147 3300046518 Bacteria 4430
155 Ga0495631_0012068 3300046518 Bacteria 4233
156 Ga0495632_0000467 3300046519 Bacteria 38367
157 Ga0495632_0000862 3300046519 Bacteria 26683
158 Ga0495632_0003013 3300046519 Bacteria 12294
159 Ga0495632_0005519 3300046519 Bacteria 8344
160 Ga0495632_0035275 3300046519 Bacteria 2554
161 Ga0495632_0071928 3300046519 Unclassified 1660
162 Ga0495637_0000034 3300046520 Bacteria 127356
163 Ga0495637_0000346 3300046520 Bacteria 35690
164 Ga0495637_0000418 3300046520 Bacteria 31189
165 Ga0495637_0038325 3300046520 Bacteria 2076
166 Ga0495643_0017424 3300046522 Bacteria 4199
167 Ga0495643_0080021 3300046522 Bacteria 1702
168 Ga0495644_0001267 3300046523 Bacteria 10375
169 Ga0495648_0001127 3300046524 Bacteria 27054
170 Ga0495648_0065964 3300046524 Bacteria 2124
171 Ga0495648_0238381 3300046524 Bacteria 885
172 Ga0495642_0000225 3300046528 Bacteria 32370
173 Ga0495654_0000866 3300046530 Bacteria 22797
174 Ga0495654_0000900 3300046530 Bacteria 22195
175 Ga0495654_0003730 3300046530 Bacteria 9236
176 Ga0495654_0064545 3300046530 Bacteria 1750
177 Ga0495654_0187754 3300046530 Bacteria 891
178 Ga0495654_0215137 3300046530 Bacteria 815
179 Ga0495609_0000004 3300046538 Bacteria 697346
180 Ga0495609_0000106 3300046538 Bacteria 98302
181 Ga0495609_0000401 3300046538 Bacteria 36473
182 Ga0495609_0054401 3300046538 Bacteria 1777
183 Ga0495609_0063007 3300046538 Bacteria 1637
184 Ga0495609_0115302 3300046538 Bacteria 1157
185 Ga0495597_0003321 3300046542 Bacteria 9491
186 Ga0495645_0052733 3300046543 Bacteria 2958
187 Ga0495622_0002777 3300046557 Bacteria 8362
188 Ga0495622_0010447 3300046557 Bacteria 4287
189 Ga0495622_0073450 3300046557 Bacteria 1578
190 Ga0495633_0000206 3300046558 Bacteria 74675
191 Ga0495668_0010202 3300046616 Bacteria 5707
192 Ga0495668_0080803 3300046616 Bacteria 1784
193 Ga0495611_0000257 3300046648 Bacteria 36502
194 Ga0495611_0000526 3300046648 Bacteria 22757
195 Ga0495611_0001867 3300046648 Bacteria 10038
196 Ga0495625_0000004 3300046660 Bacteria 611314
197 Ga0495625_0000050 3300046660 Bacteria 197065
198 Ga0495625_0004633 3300046660 Bacteria 12925
199 Ga0495625_0008678 3300046660 Bacteria 8634
200 Ga0495625_0010066 3300046660 Bacteria 7859
201 Ga0495625_0034957 3300046660 Bacteria 3706
202 Ga0495625_0367686 3300046660 Bacteria 905
203 Ga0495661_0000005 3300046665 Bacteria 433622
204 Ga0495661_0000614 3300046665 Bacteria 36352
205 Ga0495661_0002216 3300046665 Bacteria 15128
206 Ga0495661_0077995 3300046665 Bacteria 1918
207 Ga0495588_0000050 3300046674 Bacteria 335314
208 Ga0495624_0531294 3300046690 Bacteria 703
209 Ga0495670_0088895 3300046691 Bacteria 1579
210 Ga0495670_0241884 3300046691 Bacteria 961
211 Ga0495671_0000089 3300046692 Bacteria 85775
212 Ga0495671_0000938 3300046692 Bacteria 20595
213 Ga0495671_0005190 3300046692 Bacteria 7659
214 Ga0495671_0007600 3300046692 Bacteria 6162
215 Ga0495671_0045013 3300046692 Bacteria 2210
216 Ga0495671_0255595 3300046692 Bacteria 845
217 Ga0495649_0068423 3300046694 Bacteria 1905
218 Ga0495649_0137405 3300046694 Bacteria 1288
219 Ga0495649_0364062 3300046694 Bacteria 729
220 Ga0495589_0000470 3300046794 Bacteria 29417
221 Ga0495589_0017657 3300046794 Bacteria 3661
222 Ga0495600_0080611 3300046809 Bacteria 2125
223 Ga0495660_0009173 3300046810 Bacteria 5779
224 Ga0495660_0015201 3300046810 Bacteria 4448
225 Ga0495660_0023418 3300046810 Bacteria 3521
226 Ga0495660_0031210 3300046810 Bacteria 2997
227 Ga0495660_0048271 3300046810 Unclassified 2328
228 Ga0495660_0210982 3300046810 Bacteria 921
229 Ga0495660_0312845 3300046810 Bacteria 708
230 Ga0495672_0000489 3300047320 Bacteria 46184
231 Ga0495672_0064567 3300047320 Bacteria 2095
232 Ga0495676_0000377 3300047321 Bacteria 36426
233 Ga0495683_0000006 3300047323 Bacteria 272409
234 Ga0495683_0000031 3300047323 Bacteria 150363
235 Ga0495683_0024051 3300047323 Bacteria 3128
236 Ga0495679_000154 3300047446 Bacteria 61634
237 Ga0495679_000299 3300047446 Bacteria 39909
238 Ga0495679_006756 3300047446 Plasmid 4886
239 Ga0495673_0000997 3300047469 Bacteria 25163
240 Ga0495673_0001436 3300047469 Bacteria 19010
241 Ga0495673_0004140 3300047469 Bacteria 9178
242 Ga0495673_0004636 3300047469 Bacteria 8554
243 Ga0495673_0006451 3300047469 Bacteria 6889
244 Ga0495673_0029672 3300047469 Bacteria 2578
245 Ga0495673_0114148 3300047469 Bacteria 1076
246 Ga0495673_0121698 3300047469 Bacteria 1033
247 Ga0495681_0001998 3300047470 Bacteria 14903
248 Ga0495681_0002173 3300047470 Bacteria 14206
249 Ga0495681_0011414 3300047470 Bacteria 5291
250 Ga0495681_0230462 3300047470 Bacteria 739
251 Ga0495686_0000026 3300047472 Bacteria 383637
252 Ga0495686_0224349 3300047472 Bacteria 1067
253 Ga0495626_0000600 3300048091 Bacteria 35252
254 Ga0496102_0118219 3300048905 Bacteria 2474
255 Ga0496102_0316742 3300048905 Bacteria 1470
256 Ga0496103_0288999 3300048906 Bacteria 1055
257 Ga0496110_0207290 3300048913 Bacteria 1782
258 Ga0496111_0249308 3300048914 Bacteria 1318
259 Ga0496112_0634178 3300048915 Bacteria 999
260 Ga0496113_0904860 3300048916 Unclassified 698
261 Ga0496116_0111342 3300048919 Bacteria 1608
262 Ga0496116_0168158 3300048919 Bacteria 1192
263 Ga0496117_0202532 3300048920 Bacteria 1120
264 Ga0496117_0216792 3300048920 Bacteria 1068
265 Ga0496118_0001422 3300048921 Bacteria 36121
266 Ga0496118_0001619 3300048921 Bacteria 33260
267 Ga0496118_0026090 3300048921 Bacteria 4988
268 Ga0496118_0339600 3300048921 Bacteria 806
269 Ga0496119_0000510 3300048922 Bacteria 52939
270 Ga0496119_0135785 3300048922 Bacteria 1334
271 Ga0496120_0071593 3300048923 Bacteria 1903
272 Ga0496121_0001906 3300048924 Bacteria 33394
273 Ga0496121_0007006 3300048924 Bacteria 13692
274 Ga0496121_0007366 3300048924 Bacteria 13301
275 Ga0496121_0023670 3300048924 Bacteria 5904
276 Ga0496122_0006541 3300048925 Bacteria 13327
277 Ga0496122_0038356 3300048925 Bacteria 3841
278 Ga0496122_0067664 3300048925 Bacteria 2570
279 Ga0496122_0158395 3300048925 Unclassified 1385
280 Ga0496123_0006483 3300048926 Bacteria 11328
281 Ga0496123_0009856 3300048926 Bacteria 8531
282 Ga0496123_0025715 3300048926 Bacteria 4430
283 Ga0496123_0038009 3300048926 Bacteria 3390
284 Ga0496124_0001065 3300048927 Bacteria 43363
285 Ga0496124_0170819 3300048927 Bacteria 1684
286 Ga0496124_0227763 3300048927 Bacteria 1396
287 Ga0496124_0277988 3300048927 Bacteria 1222
288 Ga0496125_0048492 3300048928 Bacteria 3541
289 Ga0496126_0183425 3300048929 Bacteria 1776
290 Ga0495678_000008 3300049459 Bacteria 445926
291 Ga0495678_000186 3300049459 Bacteria 72357
292 Ga0495678_001996 3300049459 Bacteria 14669
293 Ga0495678_028221 3300049459 Bacteria 2371
294 Ga0495682_0000501 3300049460 Bacteria 27136
295 Ga0495682_0043617 3300049460 Bacteria 1642
296 Ga0501238_004477 3300049671 Bacteria 1749
297 nmdc:mga00v17_222734_c1 3300050491 Bacteria 1221
298 nmdc:mga00v17_83044_c1 3300050491 Bacteria 2003
299 nmdc:mga0yw44_189949_c1 3300050492 Bacteria 1354
300 nmdc:mga0yw44_243022_c1 3300050492 Bacteria 1197
301 nmdc:mga07m45_247458_c1 3300050496 Bacteria 1037
302 nmdc:mga07m45_74804_c1 3300050496 Bacteria 1930
303 nmdc:mga0sz30_3308_c1 3300050516 Bacteria 5796
304 Ga0500610_0347200 3300053079 Bacteria 630
305 Ga0500578_0016876 3300053086 Bacteria 4690
306 Ga0500578_0309312 3300053086 Bacteria 935
307 Ga0500644_0025137 3300053088 Bacteria 1829
308 Ga0500583_0049130 3300053092 Bacteria 1951
309 Ga0500651_0187714 3300053093 Bacteria 1225
310 Ga0500556_0000097 3300053104 Bacteria 81329
311 Ga0500556_0005823 3300053104 Bacteria 3489
312 Ga0500562_002337 3300053108 Bacteria 4763
313 Ga0500595_018309 3300053119 Bacteria 2565
314 Ga0500595_068051 3300053119 Bacteria 1061
315 Ga0500655_001799 3300053133 Bacteria 4019
316 Ga0500655_067680 3300053133 Bacteria 725
317 Ga0500658_0056431 3300053134 Bacteria 1620
318 Ga0500559_0005604 3300053136 Bacteria 5755
319 Ga0500568_0084630 3300053139 Bacteria 1201
320 Ga0500577_0036131 3300053142 Bacteria 1767
321 Ga0500588_0021874 3300053146 Bacteria 1733
322 Ga0500590_001004 3300053148 Bacteria 10926
323 Ga0500590_011519 3300053148 Bacteria 4482
324 Ga0500604_0041516 3300053151 Bacteria 1391
325 Ga0500616_0067265 3300053153 Bacteria 1838
326 Ga0500616_0270648 3300053153 Bacteria 717
327 Ga0500622_0010403 3300053156 Bacteria 5109
328 Ga0500627_0082219 3300053158 Bacteria 1436
329 Ga0500627_0139076 3300053158 Bacteria 1097
330 Ga0500637_0130761 3300053178 Bacteria 1456
331 Ga0500645_005060 3300053730 Bacteria 4927
332 Ga0500645_007047 3300053730 Bacteria 3948
333 Ga0500645_091609 3300053730 Bacteria 862

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053119 Ga0500595_068051 Ga0500595_068051_31_549 171
2 iso_pu_bacteria 2600255283 2601624115 181
3 iso_pu_bacteria 2643221664 2644355848 181
4 iso_pu_bacteria 2738541280 2738740654 181
5 iso_pu_bacteria 2738541300 2738844975 181
6 iso_pu_bacteria 2738543018 2739277390 181
7 iso_pu_bacteria 2738543030 2739346433 181
8 iso_pu_bacteria 2818991461 2819687555 181
9 3300013100 Ga0157373_10076127 Ga0157373_100761272 183
10 3300013105 Ga0157369_10521473 Ga0157369_105214731 183
11 3300025253 Ga0209677_100351 Ga0209677_1003515 183
12 3300025254 Ga0209148_1011658 Ga0209148_10116581 183
13 3300025261 Ga0209233_1004977 Ga0209233_10049774 183
14 3300025272 Ga0209455_1003711 Ga0209455_10037113 183
15 3300046506 Ga0495583_0270457 Ga0495583_0270457_21_572 183
16 3300048927 Ga0496124_0277988 Ga0496124_0277988_417_968 183
17 3300050492 nmdc:mga0yw44_189949_c1 nmdc:mga0yw44_189949_c1_385_936 183
18 3300053079 Ga0500610_0347200 Ga0500610_0347200_67_618 183
19 iso_pu_bacteria 2718218334 2721028968 183
20 iso_pu_bacteria 2738541293 2738805477 183
21 iso_pu_bacteria 2821123053 2821130826 183
22 iso_pu_bacteria 2931369376 2931371484 183
23 iso_pu_bacteria 8024486573 8024493111 184
24 3300005844 Ga0068862_101042840 Ga0068862_1010428401 185
25 3300006195 Ga0075366_10060589 Ga0075366_100605893 185
26 3300015265 Ga0182005_1034376 Ga0182005_10343762 185
27 3300028380 Ga0268265_10985379 Ga0268265_109853791 185
28 3300041492 Ga0451835_1193436 Ga0451835_1193436_75_632 185
29 3300041498 Ga0451841_0511162 Ga0451841_0511162_1266_1823 185
30 3300041501 Ga0451845_0127159 Ga0451845_0127159_389_946 185
31 3300041503 Ga0451847_0529332 Ga0451847_0529332_389_946 185
32 3300042016 Ga0439463_050266 Ga0439463_050266_259_816 185
33 3300046501 Ga0495607_0000047 Ga0495607_0000047_115649_116206 185
34 3300046515 Ga0495620_0021544 Ga0495620_0021544_2015_2572 185
35 3300046519 Ga0495632_0005519 Ga0495632_0005519_6065_6664 185
36 3300046519 Ga0495632_0035275 Ga0495632_0035275_959_1516 185
37 3300046616 Ga0495668_0010202 Ga0495668_0010202_235_792 185
38 3300046660 Ga0495625_0004633 Ga0495625_0004633_2413_2970 185
39 3300046665 Ga0495661_0002216 Ga0495661_0002216_8179_8736 185
40 3300046692 Ga0495671_0000089 Ga0495671_0000089_11480_12037 185
41 3300047320 Ga0495672_0000489 Ga0495672_0000489_27395_27952 185
42 3300047469 Ga0495673_0004636 Ga0495673_0004636_5788_6345 185
43 3300050491 nmdc:mga00v17_222734_c1 nmdc:mga00v17_222734_c1_125_712 185
44 iso_pu_bacteria 2511231003 2511250407 185
45 3300005614 Ga0068856_100081973 Ga0068856_1000819733 186
46 3300026078 Ga0207702_10151906 Ga0207702_101519063 186
47 3300053153 Ga0500616_0270648 Ga0500616_0270648_132_695 186
48 iso_pu_bacteria 2513237138 2513867262 186
49 iso_pu_bacteria 2517287029 2517410163 186
50 iso_pu_bacteria 2667528174 2671116626 186
51 iso_pu_bacteria 2765235942 2766064538 186
52 iso_pu_bacteria 2802429634 2806055799 186
53 iso_pu_bacteria 2802429635 2806061248 186
54 iso_pu_bacteria 2842110456 2842113907 186
55 iso_pu_bacteria 2874628541 2874628753 186
56 iso_pu_bacteria 2932794094 2932794279 186
57 iso_pu_bacteria 2933586486 2933589457 186
58 iso_pu_bacteria 2935883170 2935890057 186
59 iso_pu_bacteria 2954011201 2954012613 186
60 iso_pu_bacteria 8005376324 8005379927 186
61 3300002737 JGI25162J39368_1000196 JGI25162J39368_100019611 187
62 3300002987 JGI25159J45721_1015103 JGI25159J45721_10151031 187
63 3300003214 JGI25165J46597_1000292 JGI25165J46597_100029211 187
64 3300003322 rootL2_10121188 rootL2_101211882 187
65 3300003323 rootH1_10348352 rootH1_103483523 187
66 3300003354 JGI25160J50197_1000023 JGI25160J50197_100002382 187
67 3300003354 JGI25160J50197_1015254 JGI25160J50197_10152543 187
68 3300003374 JGI25161J50226_1000012 JGI25161J50226_100001282 187
69 3300003752 Ga0055539_1018092 Ga0055539_10180921 187
70 3300003792 Ga0055540_1000531 Ga0055540_10005315 187
71 3300004625 Ga0055543_1000009 Ga0055543_100000982 187
72 3300005262 Ga0065165_1000064 Ga0065165_1000064116 187
73 3300005353 Ga0070669_100446124 Ga0070669_1004461242 187
74 3300005548 Ga0070665_100002949 Ga0070665_1000029495 187
75 3300005614 Ga0068856_100004493 Ga0068856_10000449314 187
76 3300006038 Ga0075365_10119282 Ga0075365_101192821 187
77 3300006051 Ga0075364_10072465 Ga0075364_100724652 187
78 3300006051 Ga0075364_10505037 Ga0075364_105050371 187
79 3300006178 Ga0075367_10502597 Ga0075367_105025971 187
80 3300006186 Ga0075369_10025193 Ga0075369_100251932 187
81 3300006353 Ga0075370_10041653 Ga0075370_100416533 187
82 3300006353 Ga0075370_10083451 Ga0075370_100834511 187
83 3300006931 Ga0097620_100094430 Ga0097620_1000944305 187
84 3300009011 Ga0105251_10000623 Ga0105251_1000062324 187
85 3300009101 Ga0105247_10009868 Ga0105247_100098686 187
86 3300009101 Ga0105247_10177898 Ga0105247_101778981 187
87 3300009545 Ga0105237_10055626 Ga0105237_100556261 187
88 3300014968 Ga0157379_10315353 Ga0157379_103153532 187
89 3300025233 Ga0209437_100312 Ga0209437_10031256 187
90 3300025256 Ga0209759_1021151 Ga0209759_10211511 187
91 3300025261 Ga0209233_1000230 Ga0209233_100023012 187
92 3300025272 Ga0209455_1008410 Ga0209455_10084104 187
93 3300025273 Ga0209673_1000022 Ga0209673_100002243 187
94 3300025284 Ga0209130_1000048 Ga0209130_1000048116 187
95 3300025284 Ga0209130_1000528 Ga0209130_10005287 187
96 3300025295 Ga0209564_1000440 Ga0209564_100044012 187
97 3300025298 Ga0209050_1000060 Ga0209050_1000060277 187
98 3300025299 Ga0209256_1000970 Ga0209256_100097012 187
99 3300025302 Ga0207426_1000136 Ga0207426_1000136116 187
100 3300025302 Ga0207426_1000358 Ga0207426_100035877 187
101 3300025302 Ga0207426_1000420 Ga0207426_100042051 187
102 3300025303 Ga0209051_1000037 Ga0209051_1000037277 187
103 3300025304 Ga0209257_1009510 Ga0209257_10095104 187
104 3300025735 Ga0207713_1000481 Ga0207713_100048124 187
105 3300025900 Ga0207710_10036031 Ga0207710_100360311 187
106 3300025900 Ga0207710_10123263 Ga0207710_101232632 187
107 3300025986 Ga0207658_10390747 Ga0207658_103907472 187
108 3300026078 Ga0207702_10031335 Ga0207702_100313353 187
109 3300028379 Ga0268266_10006890 Ga0268266_100068904 187
110 3300031911 Ga0307412_10005928 Ga0307412_100059285 187
111 3300041405 Ga0439438_000450 Ga0439438_000450_3953_4516 187
112 3300041441 Ga0451787_571441 Ga0451787_571441_116_691 187
113 3300041491 Ga0451833_0610564 Ga0451833_0610564_714_1289 187
114 3300041491 Ga0451833_0868791 Ga0451833_0868791_135_707 187
115 3300041492 Ga0451835_0016286 Ga0451835_0016286_1333_1908 187
116 3300041492 Ga0451835_0597552 Ga0451835_0597552_682_1254 187
117 3300041492 Ga0451835_0867582 Ga0451835_0867582_174_749 187
118 3300041496 Ga0451839_0843655 Ga0451839_0843655_158_733 187
119 3300041496 Ga0451839_1503336 Ga0451839_1503336_690_1262 187
120 3300041498 Ga0451841_0258911 Ga0451841_0258911_60_635 187
121 3300041501 Ga0451845_0606547 Ga0451845_0606547_608_1183 187
122 3300041503 Ga0451847_0393911 Ga0451847_0393911_558_1130 187
123 3300041503 Ga0451847_0880430 Ga0451847_0880430_1074_1649 187
124 3300041505 Ga0451849_1459255 Ga0451849_1459255_487_1062 187
125 3300041507 Ga0451851_0507517 Ga0451851_0507517_452_1024 187
126 3300041507 Ga0451851_0698488 Ga0451851_0698488_691_1266 187
127 3300041509 Ga0451843_0092546 Ga0451843_0092546_678_1250 187
128 3300041509 Ga0451843_0402790 Ga0451843_0402790_201_776 187
129 3300041511 Ga0451855_1507476 Ga0451855_1507476_813_1388 187
130 3300041512 Ga0451853_0023355 Ga0451853_0023355_645_1220 187
131 3300041512 Ga0451853_0911215 Ga0451853_0911215_1184_1759 187
132 3300042010 Ga0439452_009334 Ga0439452_009334_84_647 187
133 3300046452 Ga0495617_050194 Ga0495617_050194_338_901 187
134 3300046458 Ga0495591_000640 Ga0495591_000640_19356_19919 187
135 3300046459 Ga0495629_0051382 Ga0495629_0051382_2085_2657 187
136 3300046460 Ga0495638_0000629 Ga0495638_0000629_34184_34756 187
137 3300046460 Ga0495638_0065776 Ga0495638_0065776_1188_1760 187
138 3300046471 Ga0495650_0004126 Ga0495650_0004126_7284_7847 187
139 3300046471 Ga0495650_0067617 Ga0495650_0067617_117_680 187
140 3300046474 Ga0495605_0002755 Ga0495605_0002755_2011_2574 187
141 3300046474 Ga0495605_0007150 Ga0495605_0007150_2580_3143 187
142 3300046491 Ga0495584_0017858 Ga0495584_0017858_3006_3569 187
143 3300046492 Ga0495585_0017457 Ga0495585_0017457_2689_3252 187
144 3300046492 Ga0495585_0056110 Ga0495585_0056110_1417_1980 187
145 3300046492 Ga0495585_0063601 Ga0495585_0063601_1368_1943 187
146 3300046499 Ga0495594_0003210 Ga0495594_0003210_4435_4998 187
147 3300046499 Ga0495594_0177708 Ga0495594_0177708_352_915 187
148 3300046501 Ga0495607_0000424 Ga0495607_0000424_7037_7600 187
149 3300046501 Ga0495607_0006051 Ga0495607_0006051_4118_4681 187
150 3300046501 Ga0495607_0006062 Ga0495607_0006062_1954_2517 187
151 3300046501 Ga0495607_0014028 Ga0495607_0014028_4095_4658 187
152 3300046501 Ga0495607_0103040 Ga0495607_0103040_40_603 187
153 3300046501 Ga0495607_0111570 Ga0495607_0111570_328_891 187
154 3300046506 Ga0495583_0000047 Ga0495583_0000047_185044_185607 187
155 3300046506 Ga0495583_0001037 Ga0495583_0001037_7064_7627 187
156 3300046506 Ga0495583_0269409 Ga0495583_0269409_49_621 187
157 3300046507 Ga0495606_0000924 Ga0495606_0000924_7452_8015 187
158 3300046507 Ga0495606_0001576 Ga0495606_0001576_6252_6815 187
159 3300046507 Ga0495606_0005955 Ga0495606_0005955_5240_5803 187
160 3300046507 Ga0495606_0031874 Ga0495606_0031874_867_1430 187
161 3300046507 Ga0495606_0099051 Ga0495606_0099051_876_1448 187
162 3300046507 Ga0495606_0200205 Ga0495606_0200205_259_831 187
163 3300046512 Ga0495610_0037917 Ga0495610_0037917_138_716 187
164 3300046512 Ga0495610_0062031 Ga0495610_0062031_74_649 187
165 3300046512 Ga0495610_0078519 Ga0495610_0078519_332_895 187
166 3300046513 Ga0495616_0052959 Ga0495616_0052959_1178_1741 187
167 3300046515 Ga0495620_0000225 Ga0495620_0000225_31165_31728 187
168 3300046515 Ga0495620_0002464 Ga0495620_0002464_6579_7142 187
169 3300046515 Ga0495620_0271669 Ga0495620_0271669_38_616 187
170 3300046518 Ga0495631_0011147 Ga0495631_0011147_2182_2745 187
171 3300046518 Ga0495631_0012068 Ga0495631_0012068_1598_2161 187
172 3300046519 Ga0495632_0000862 Ga0495632_0000862_3697_4260 187
173 3300046519 Ga0495632_0003013 Ga0495632_0003013_2066_2629 187
174 3300046519 Ga0495632_0071928 Ga0495632_0071928_691_1254 187
175 3300046520 Ga0495637_0000346 Ga0495637_0000346_6367_6930 187
176 3300046520 Ga0495637_0038325 Ga0495637_0038325_1253_1816 187
177 3300046522 Ga0495643_0080021 Ga0495643_0080021_218_793 187
178 3300046523 Ga0495644_0001267 Ga0495644_0001267_7182_7745 187
179 3300046524 Ga0495648_0001127 Ga0495648_0001127_22424_22987 187
180 3300046524 Ga0495648_0065964 Ga0495648_0065964_1395_1967 187
181 3300046524 Ga0495648_0238381 Ga0495648_0238381_295_858 187
182 3300046530 Ga0495654_0000866 Ga0495654_0000866_16158_16721 187
183 3300046530 Ga0495654_0000900 Ga0495654_0000900_19229_19792 187
184 3300046530 Ga0495654_0003730 Ga0495654_0003730_6807_7370 187
185 3300046530 Ga0495654_0215137 Ga0495654_0215137_46_609 187
186 3300046538 Ga0495609_0000004 Ga0495609_0000004_516053_516616 187
187 3300046538 Ga0495609_0000401 Ga0495609_0000401_7256_7819 187
188 3300046538 Ga0495609_0054401 Ga0495609_0054401_228_791 187
189 3300046538 Ga0495609_0115302 Ga0495609_0115302_459_1031 187
190 3300046542 Ga0495597_0003321 Ga0495597_0003321_869_1432 187
191 3300046543 Ga0495645_0052733 Ga0495645_0052733_360_923 187
192 3300046557 Ga0495622_0002777 Ga0495622_0002777_4965_5528 187
193 3300046557 Ga0495622_0010447 Ga0495622_0010447_147_725 187
194 3300046558 Ga0495633_0000206 Ga0495633_0000206_31302_31865 187
195 3300046616 Ga0495668_0080803 Ga0495668_0080803_263_841 187
196 3300046648 Ga0495611_0000257 Ga0495611_0000257_30536_31099 187
197 3300046648 Ga0495611_0000526 Ga0495611_0000526_17854_18417 187
198 3300046648 Ga0495611_0001867 Ga0495611_0001867_4089_4652 187
199 3300046660 Ga0495625_0000004 Ga0495625_0000004_443415_443978 187
200 3300046660 Ga0495625_0000050 Ga0495625_0000050_28630_29193 187
201 3300046660 Ga0495625_0008678 Ga0495625_0008678_6638_7201 187
202 3300046660 Ga0495625_0010066 Ga0495625_0010066_6846_7421 187
203 3300046660 Ga0495625_0034957 Ga0495625_0034957_1504_2082 187
204 3300046660 Ga0495625_0367686 Ga0495625_0367686_248_820 187
205 3300046665 Ga0495661_0000005 Ga0495661_0000005_191882_192445 187
206 3300046665 Ga0495661_0000614 Ga0495661_0000614_28625_29188 187
207 3300046691 Ga0495670_0088895 Ga0495670_0088895_666_1229 187
208 3300046691 Ga0495670_0241884 Ga0495670_0241884_88_660 187
209 3300046692 Ga0495671_0000938 Ga0495671_0000938_14948_15511 187
210 3300046692 Ga0495671_0007600 Ga0495671_0007600_4268_4831 187
211 3300046692 Ga0495671_0045013 Ga0495671_0045013_624_1187 187
212 3300046692 Ga0495671_0255595 Ga0495671_0255595_69_632 187
213 3300046694 Ga0495649_0068423 Ga0495649_0068423_949_1521 187
214 3300046694 Ga0495649_0137405 Ga0495649_0137405_643_1215 187
215 3300046794 Ga0495589_0000470 Ga0495589_0000470_7076_7639 187
216 3300046810 Ga0495660_0009173 Ga0495660_0009173_2197_2760 187
217 3300046810 Ga0495660_0023418 Ga0495660_0023418_982_1545 187
218 3300046810 Ga0495660_0048271 Ga0495660_0048271_431_994 187
219 3300046810 Ga0495660_0210982 Ga0495660_0210982_119_697 187
220 3300047320 Ga0495672_0064567 Ga0495672_0064567_513_1076 187
221 3300047321 Ga0495676_0000377 Ga0495676_0000377_28599_29162 187
222 3300047323 Ga0495683_0000006 Ga0495683_0000006_271515_272078 187
223 3300047323 Ga0495683_0000031 Ga0495683_0000031_107045_107608 187
224 3300047446 Ga0495679_000154 Ga0495679_000154_21641_22204 187
225 3300047446 Ga0495679_000299 Ga0495679_000299_28455_29018 187
226 3300047446 Ga0495679_006756 Ga0495679_006756_3713_4276 187
227 3300047469 Ga0495673_0001436 Ga0495673_0001436_13159_13722 187
228 3300047469 Ga0495673_0006451 Ga0495673_0006451_4938_5501 187
229 3300047469 Ga0495673_0029672 Ga0495673_0029672_594_1157 187
230 3300047469 Ga0495673_0114148 Ga0495673_0114148_215_778 187
231 3300047469 Ga0495673_0121698 Ga0495673_0121698_409_981 187
232 3300047470 Ga0495681_0002173 Ga0495681_0002173_8438_9001 187
233 3300047470 Ga0495681_0011414 Ga0495681_0011414_4716_5279 187
234 3300047470 Ga0495681_0230462 Ga0495681_0230462_135_713 187
235 3300047472 Ga0495686_0000026 Ga0495686_0000026_362785_363348 187
236 3300047472 Ga0495686_0224349 Ga0495686_0224349_241_819 187
237 3300048091 Ga0495626_0000600 Ga0495626_0000600_28538_29101 187
238 3300048905 Ga0496102_0118219 Ga0496102_0118219_447_1010 187
239 3300048905 Ga0496102_0316742 Ga0496102_0316742_765_1328 187
240 3300048906 Ga0496103_0288999 Ga0496103_0288999_95_658 187
241 3300048913 Ga0496110_0207290 Ga0496110_0207290_572_1135 187
242 3300048914 Ga0496111_0249308 Ga0496111_0249308_451_1014 187
243 3300048915 Ga0496112_0634178 Ga0496112_0634178_417_980 187
244 3300048916 Ga0496113_0904860 Ga0496113_0904860_107_670 187
245 3300048919 Ga0496116_0111342 Ga0496116_0111342_891_1454 187
246 3300048919 Ga0496116_0168158 Ga0496116_0168158_567_1136 187
247 3300048920 Ga0496117_0216792 Ga0496117_0216792_187_750 187
248 3300048921 Ga0496118_0001422 Ga0496118_0001422_376_948 187
249 3300048921 Ga0496118_0001619 Ga0496118_0001619_11840_12403 187
250 3300048921 Ga0496118_0026090 Ga0496118_0026090_3518_4087 187
251 3300048921 Ga0496118_0339600 Ga0496118_0339600_183_746 187
252 3300048922 Ga0496119_0000510 Ga0496119_0000510_11326_11898 187
253 3300048922 Ga0496119_0135785 Ga0496119_0135785_203_772 187
254 3300048924 Ga0496121_0001906 Ga0496121_0001906_26252_26815 187
255 3300048924 Ga0496121_0007366 Ga0496121_0007366_3981_4544 187
256 3300048924 Ga0496121_0023670 Ga0496121_0023670_4343_4912 187
257 3300048925 Ga0496122_0006541 Ga0496122_0006541_11718_12290 187
258 3300048925 Ga0496122_0038356 Ga0496122_0038356_1995_2558 187
259 3300048925 Ga0496122_0067664 Ga0496122_0067664_1140_1703 187
260 3300048925 Ga0496122_0158395 Ga0496122_0158395_34_597 187
261 3300048926 Ga0496123_0006483 Ga0496123_0006483_2306_2878 187
262 3300048926 Ga0496123_0009856 Ga0496123_0009856_1140_1703 187
263 3300048926 Ga0496123_0025715 Ga0496123_0025715_2083_2646 187
264 3300048926 Ga0496123_0038009 Ga0496123_0038009_2188_2751 187
265 3300048927 Ga0496124_0001065 Ga0496124_0001065_36333_36896 187
266 3300048927 Ga0496124_0170819 Ga0496124_0170819_592_1161 187
267 3300048928 Ga0496125_0048492 Ga0496125_0048492_536_1105 187
268 3300048929 Ga0496126_0183425 Ga0496126_0183425_660_1226 187
269 3300049459 Ga0495678_000186 Ga0495678_000186_50017_50580 187
270 3300049459 Ga0495678_028221 Ga0495678_028221_1404_1967 187
271 3300049460 Ga0495682_0000501 Ga0495682_0000501_7191_7754 187
272 3300049460 Ga0495682_0043617 Ga0495682_0043617_146_718 187
273 3300050491 nmdc:mga00v17_83044_c1 nmdc:mga00v17_83044_c1_231_803 187
274 3300050492 nmdc:mga0yw44_243022_c1 nmdc:mga0yw44_243022_c1_350_922 187
275 3300050496 nmdc:mga07m45_247458_c1 nmdc:mga07m45_247458_c1_54_632 187
276 3300050496 nmdc:mga07m45_74804_c1 nmdc:mga07m45_74804_c1_1106_1678 187
277 3300050516 nmdc:mga0sz30_3308_c1 nmdc:mga0sz30_3308_c1_4510_5082 187
278 3300053086 Ga0500578_0016876 Ga0500578_0016876_1424_1996 187
279 3300053086 Ga0500578_0309312 Ga0500578_0309312_97_669 187
280 3300053088 Ga0500644_0025137 Ga0500644_0025137_1186_1749 187
281 3300053092 Ga0500583_0049130 Ga0500583_0049130_206_778 187
282 3300053093 Ga0500651_0187714 Ga0500651_0187714_484_1062 187
283 3300053104 Ga0500556_0000097 Ga0500556_0000097_22361_22933 187
284 3300053104 Ga0500556_0005823 Ga0500556_0005823_225_797 187
285 3300053108 Ga0500562_002337 Ga0500562_002337_1824_2396 187
286 3300053119 Ga0500595_018309 Ga0500595_018309_372_944 187
287 3300053133 Ga0500655_067680 Ga0500655_067680_114_686 187
288 3300053134 Ga0500658_0056431 Ga0500658_0056431_465_1043 187
289 3300053136 Ga0500559_0005604 Ga0500559_0005604_1154_1726 187
290 3300053142 Ga0500577_0036131 Ga0500577_0036131_507_1073 187
291 3300053146 Ga0500588_0021874 Ga0500588_0021874_625_1197 187
292 3300053148 Ga0500590_001004 Ga0500590_001004_10166_10744 187
293 3300053151 Ga0500604_0041516 Ga0500604_0041516_39_617 187
294 3300053153 Ga0500616_0067265 Ga0500616_0067265_950_1522 187
295 3300053156 Ga0500622_0010403 Ga0500622_0010403_2392_2964 187
296 3300053158 Ga0500627_0082219 Ga0500627_0082219_503_1081 187
297 3300053158 Ga0500627_0139076 Ga0500627_0139076_437_1009 187
298 3300053178 Ga0500637_0130761 Ga0500637_0130761_94_660 187
299 3300053730 Ga0500645_005060 Ga0500645_005060_3290_3862 187
300 3300053730 Ga0500645_007047 Ga0500645_007047_1418_1981 187
301 3300053730 Ga0500645_091609 Ga0500645_091609_86_658 187
302 iso_pu_bacteria 2510461076 2510892418 187
303 iso_pu_bacteria 2513237162 2514021214 187
304 iso_pu_bacteria 2515154113 2515632328 187
305 iso_pu_bacteria 2515154114 2515643416 187
306 iso_pu_bacteria 2852387548 2852395082 187
307 iso_pu_bacteria 2876363079 2876367280 187
308 iso_pu_bacteria 2903521522 2903526771 187
309 iso_pu_bacteria 2903528002 2903530610 187
310 iso_pu_bacteria 2963644680 2963650073 187
311 iso_pu_bacteria 8001845381 8001847284 187
312 iso_pu_bacteria 8005484373 8005486724 187
313 3300003215 JGI25153J46596_10000315 JGI25153J46596_100003154 188
314 3300025254 Ga0209148_1001319 Ga0209148_100131910 188
315 3300025272 Ga0209455_1007749 Ga0209455_10077492 188
316 3300025297 Ga0209758_1000048 Ga0209758_1000048120 188
317 3300031456 Ga0307513_10366962 Ga0307513_103669622 188
318 3300046452 Ga0495617_024900 Ga0495617_024900_512_1078 188
319 3300046471 Ga0495650_0022091 Ga0495650_0022091_2379_2945 188
320 3300046474 Ga0495605_0010497 Ga0495605_0010497_3542_4108 188
321 3300046474 Ga0495605_0035108 Ga0495605_0035108_738_1307 188
322 3300046492 Ga0495585_0013590 Ga0495585_0013590_3665_4231 188
323 3300046501 Ga0495607_0001437 Ga0495607_0001437_20450_21016 188
324 3300046506 Ga0495583_0003438 Ga0495583_0003438_5064_5741 188
325 3300046507 Ga0495606_0106341 Ga0495606_0106341_283_849 188
326 3300046512 Ga0495610_0056986 Ga0495610_0056986_373_939 188
327 3300046513 Ga0495616_0021146 Ga0495616_0021146_2541_3107 188
328 3300046515 Ga0495620_0005152 Ga0495620_0005152_5948_6514 188
329 3300046519 Ga0495632_0000467 Ga0495632_0000467_30064_30633 188
330 3300046520 Ga0495637_0000034 Ga0495637_0000034_4251_4817 188
331 3300046520 Ga0495637_0000418 Ga0495637_0000418_6430_6999 188
332 3300046522 Ga0495643_0017424 Ga0495643_0017424_3268_3837 188
333 3300046528 Ga0495642_0000225 Ga0495642_0000225_21988_22557 188
334 3300046530 Ga0495654_0064545 Ga0495654_0064545_154_723 188
335 3300046530 Ga0495654_0187754 Ga0495654_0187754_44_610 188
336 3300046538 Ga0495609_0000106 Ga0495609_0000106_28547_29116 188
337 3300046538 Ga0495609_0063007 Ga0495609_0063007_738_1307 188
338 3300046557 Ga0495622_0073450 Ga0495622_0073450_897_1469 188
339 3300046665 Ga0495661_0077995 Ga0495661_0077995_49_615 188
340 3300046674 Ga0495588_0000050 Ga0495588_0000050_303758_304327 188
341 3300046690 Ga0495624_0531294 Ga0495624_0531294_44_616 188
342 3300046692 Ga0495671_0005190 Ga0495671_0005190_3089_3766 188
343 3300046694 Ga0495649_0364062 Ga0495649_0364062_55_624 188
344 3300046794 Ga0495589_0017657 Ga0495589_0017657_2129_2698 188
345 3300046809 Ga0495600_0080611 Ga0495600_0080611_1171_1743 188
346 3300046810 Ga0495660_0015201 Ga0495660_0015201_3596_4165 188
347 3300046810 Ga0495660_0031210 Ga0495660_0031210_902_1471 188
348 3300046810 Ga0495660_0312845 Ga0495660_0312845_26_595 188
349 3300047323 Ga0495683_0024051 Ga0495683_0024051_1634_2203 188
350 3300047469 Ga0495673_0000997 Ga0495673_0000997_7405_7971 188
351 3300047469 Ga0495673_0004140 Ga0495673_0004140_7786_8355 188
352 3300047470 Ga0495681_0001998 Ga0495681_0001998_2682_3248 188
353 3300048923 Ga0496120_0071593 Ga0496120_0071593_1281_1847 188
354 3300048927 Ga0496124_0227763 Ga0496124_0227763_652_1218 188
355 3300049459 Ga0495678_000008 Ga0495678_000008_183806_184372 188
356 3300049459 Ga0495678_001996 Ga0495678_001996_6821_7390 188
357 3300049671 Ga0501238_004477 Ga0501238_004477_471_1103 188
358 3300053133 Ga0500655_001799 Ga0500655_001799_52_744 188
359 3300053139 Ga0500568_0084630 Ga0500568_0084630_383_964 188
360 3300053148 Ga0500590_011519 Ga0500590_011519_1465_2037 188
361 3300002705 JGI25156J39149_1002595 JGI25156J39149_10025951 189
362 3300002738 JGI25154J39366_1000128 JGI25154J39366_100012813 189
363 3300009093 Ga0105240_10007957 Ga0105240_1000795715 189
364 3300025206 Ga0209435_100131 Ga0209435_1001317 189
365 3300025246 Ga0209646_1000155 Ga0209646_100015561 189
366 3300025250 Ga0209026_1001247 Ga0209026_100124713 189
367 3300025256 Ga0209759_1000375 Ga0209759_100037550 189
368 3300025913 Ga0207695_10002671 Ga0207695_1000267112 189
369 3300048920 Ga0496117_0202532 Ga0496117_0202532_495_1064 189
370 3300048924 Ga0496121_0007006 Ga0496121_0007006_12771_13340 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

10

56

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3on4-assembly4.cif.gz_F crystal structure of tetr transcriptional regulator from legionella pneumophila 0.9157 8 184
2g7s-assembly1.cif.gz_A-2 the crystal structure of transcriptional regulator, tetr family, from agrobacterium tumefaciens 0.8972 2 185
2g7s-assembly1.cif.gz_A-2 the crystal structure of transcriptional regulator, tetr family, from agrobacterium tumefaciens 0.8704 2 185
3on4-assembly4.cif.gz_F crystal structure of tetr transcriptional regulator from legionella pneumophila 0.8641 8 184
3bru-assembly1.cif.gz_B crystal structure of regulatory protein tetr from rhodobacter sphaeroides 0.8601 8 182
ID Description Score Start End Superfamily
5ojxA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9461 7 56 1.10.10.60
2of7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9399 4 47 1.10.10.60
2eh3A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.937 6 52 1.10.10.60
1jt6E01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9354 6 52 1.10.10.60
3bt9E01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9344 6 52 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7W1LYU6-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9671 1 135 GO:0003677
GO:0006355
AF-A0A840HY75-F1-model_v4 TetR/AcrR family transcriptional repressor of nem operon 0.9647 7 187 GO:0003677
GO:0006355
AF-A0A6J5H3C6-F1-model_v4 HTH tetR-type domain-containing protein 0.9603 18 189 GO:0003677
GO:0006355
AF-A0A2V1YBI6-F1-model_v4 deleted 0.9569 12 189
AF-A0A7H9V1J1-F1-model_v4 deleted 0.9565 1 189

Feature Viewer

pLDDT pTM Quality
92.34 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map