F425277

General Info

Members Datasets Scaffolds Average Seq Length
370 172 740 134

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100887699|Ga0070682_1008876991
Length 134
Sequence MRSKVANLGAVLALGLVAKPIVAHHSFSAEFDSAKPLKMTGPVTKVEWMNPHTFFYIDVTDEKTNKVTNWAMEMGSPNGLMRQGWTRNTMKIGDVVTVEGSMAKDGSPTGNARSVTLMSTGQRLFAASSQGTTP

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
129 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
133 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
138 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
139 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
140 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
141 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
158 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
159 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.57
Metatranscriptomes 2.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.27
Rhizosphere 98.38
Stem 0
Stem Tuber 0
Unclassified 42.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100887699 3300005337 Unclassified 731
2 Ga0058859_11780990 3300004798 Unclassified 606
3 Ga0058861_11464746 3300004800 Unclassified 968
4 Ga0058860_11492312 3300004801 Unclassified 520
5 Ga0058860_11552903 3300004801 Unclassified 532
6 Ga0058860_11555299 3300004801 Unclassified 619
7 Ga0058860_11634639 3300004801 Unclassified 520
8 Ga0058862_12597658 3300004803 Bacteria 1355
9 Ga0065704_10118768 3300005289 Bacteria 1811
10 Ga0065704_10126487 3300005289 Unclassified 1689
11 Ga0065704_10468913 3300005289 Bacteria 689
12 Ga0065704_10582506 3300005289 Bacteria 617
13 Ga0065715_10094865 3300005293 Unclassified 4223
14 Ga0065715_10140277 3300005293 Unclassified 1864
15 Ga0065707_10110818 3300005295 Bacteria 2409
16 Ga0065707_10226403 3300005295 Unclassified 1205
17 Ga0065707_10558981 3300005295 Unclassified 716
18 Ga0070676_10479881 3300005328 Bacteria 879
19 Ga0070690_100388512 3300005330 Unclassified 1022
20 Ga0070677_10565063 3300005333 Unclassified 625
21 Ga0068869_100899088 3300005334 Unclassified 766
22 Ga0068869_100953951 3300005334 Bacteria 745
23 Ga0070666_10168076 3300005335 Unclassified 1535
24 Ga0070666_10181616 3300005335 Bacteria 1476
25 Ga0070680_100531425 3300005336 Bacteria 1007
26 Ga0070682_101593534 3300005337 Bacteria 564
27 Ga0068868_100378878 3300005338 Unclassified 1217
28 Ga0068868_100863203 3300005338 Unclassified 820
29 Ga0068868_101470187 3300005338 Unclassified 637
30 Ga0070689_100070168 3300005340 Unclassified 2735
31 Ga0070689_101198615 3300005340 Unclassified 681
32 Ga0070687_100047496 3300005343 Bacteria 2202
33 Ga0070692_10214255 3300005345 Bacteria 1135
34 Ga0070668_100043377 3300005347 Unclassified 3450
35 Ga0070669_100003917 3300005353 Bacteria 10775
36 Ga0070669_100687975 3300005353 Unclassified 863
37 Ga0070669_100738501 3300005353 Unclassified 833
38 Ga0070669_101014258 3300005353 Unclassified 712
39 Ga0070675_100003474 3300005354 Bacteria 11947
40 Ga0070675_100014705 3300005354 Bacteria 6174
41 Ga0070675_100029314 3300005354 Unclassified 4438
42 Ga0070675_100161630 3300005354 Bacteria 1926
43 Ga0070675_100256260 3300005354 Unclassified 1532
44 Ga0070675_100708287 3300005354 Bacteria 917
45 Ga0070674_100140665 3300005356 Bacteria 1811
46 Ga0070674_100408806 3300005356 Bacteria 1111
47 Ga0070674_101173725 3300005356 Unclassified 681
48 Ga0070673_100034057 3300005364 Unclassified 3850
49 Ga0070673_100077176 3300005364 Bacteria 2692
50 Ga0070673_100253777 3300005364 Unclassified 1534
51 Ga0070673_100258174 3300005364 Bacteria 1521
52 Ga0070688_100018631 3300005365 Bacteria 4009
53 Ga0070688_100027650 3300005365 Bacteria 3379
54 Ga0070688_100245349 3300005365 Bacteria 1273
55 Ga0070667_100016163 3300005367 Bacteria 6174
56 Ga0070667_101418885 3300005367 Bacteria 651
57 Ga0070703_10505519 3300005406 Unclassified 544
58 Ga0070701_10310740 3300005438 Bacteria 972
59 Ga0070705_100113161 3300005440 Bacteria 1738
60 Ga0070705_100308040 3300005440 Unclassified 1138
61 Ga0070700_100044846 3300005441 Bacteria 2725
62 Ga0070694_100073054 3300005444 Unclassified 2368
63 Ga0070708_100622922 3300005445 Unclassified 1017
64 Ga0070663_101819380 3300005455 Unclassified 546
65 Ga0070662_100032669 3300005457 Unclassified 3658
66 Ga0068867_100001424 3300005459 Bacteria 16560
67 Ga0068867_100385580 3300005459 Bacteria 1178
68 Ga0070685_10004711 3300005466 Bacteria 6902
69 Ga0070706_100241120 3300005467 Bacteria 1688
70 Ga0070706_100574689 3300005467 Unclassified 1048
71 Ga0070707_100274745 3300005468 Bacteria 1638
72 Ga0070707_100617153 3300005468 Bacteria 1047
73 Ga0070707_100742266 3300005468 Unclassified 945
74 Ga0070698_100025963 3300005471 Bacteria 6103
75 Ga0070698_100045138 3300005471 Bacteria 4511
76 Ga0070698_100239607 3300005471 Bacteria 1747
77 Ga0070698_100271315 3300005471 Bacteria 1628
78 Ga0070698_100454312 3300005471 Unclassified 1217
79 Ga0070698_100489919 3300005471 Unclassified 1167
80 Ga0070699_100032780 3300005518 Unclassified 4487
81 Ga0070699_101014866 3300005518 Bacteria 761
82 Ga0070699_101655451 3300005518 Unclassified 586
83 Ga0070697_100948509 3300005536 Unclassified 764
84 Ga0070697_101175934 3300005536 Unclassified 683
85 Ga0068853_100772330 3300005539 Unclassified 919
86 Ga0070672_100011169 3300005543 Bacteria 6256
87 Ga0070672_100021342 3300005543 Unclassified 4736
88 Ga0070672_101530934 3300005543 Bacteria 598
89 Ga0070686_100589505 3300005544 Bacteria 874
90 Ga0070704_100089255 3300005549 Bacteria 2292
91 Ga0070704_100232768 3300005549 Bacteria 1504
92 Ga0070704_101660345 3300005549 Unclassified 590
93 Ga0070664_100024381 3300005564 Bacteria 5003
94 Ga0070664_100049537 3300005564 Unclassified 3553
95 Ga0070664_100454611 3300005564 Unclassified 1176
96 Ga0070664_100666957 3300005564 Bacteria 967
97 Ga0070664_101124668 3300005564 Bacteria 740
98 Ga0068857_100021889 3300005577 Bacteria 5626
99 Ga0068857_100239100 3300005577 Bacteria 1662
100 Ga0068857_100982850 3300005577 Bacteria 812
101 Ga0070702_101062281 3300005615 Unclassified 645
102 Ga0068852_100342639 3300005616 Bacteria 1457
103 Ga0068859_100008410 3300005617 Bacteria 10458
104 Ga0068859_100019594 3300005617 Bacteria 6796
105 Ga0068859_100374050 3300005617 Bacteria 1520
106 Ga0068864_100124990 3300005618 Unclassified 2304
107 Ga0068864_100151789 3300005618 Bacteria 2099
108 Ga0068866_11104082 3300005718 Bacteria 568
109 Ga0068861_100017890 3300005719 Bacteria 5038
110 Ga0068861_100178379 3300005719 Bacteria 1766
111 Ga0068861_100402955 3300005719 Bacteria 1214
112 Ga0068861_100696181 3300005719 Bacteria 944
113 Ga0068870_10005193 3300005840 Bacteria 5671
114 Ga0068863_100039723 3300005841 Unclassified 4475
115 Ga0068863_100182101 3300005841 Bacteria 2017
116 Ga0068863_100372421 3300005841 Bacteria 1394
117 Ga0068858_100085009 3300005842 Bacteria 2943
118 Ga0068858_100155058 3300005842 Unclassified 2154
119 Ga0068858_100646932 3300005842 Bacteria 1027
120 Ga0068858_100859222 3300005842 Unclassified 886
121 Ga0068860_100010554 3300005843 Bacteria 9126
122 Ga0068862_100000840 3300005844 Bacteria 30227
123 Ga0068862_100251781 3300005844 Unclassified 1610
124 Ga0068862_100473691 3300005844 Unclassified 1184
125 Ga0068862_101320163 3300005844 Unclassified 723
126 Ga0081455_10682717 3300005937 Unclassified 657
127 Ga0081455_10691520 3300005937 Unclassified 651
128 Ga0075427_10023468 3300006194 Bacteria 988
129 Ga0097621_101315664 3300006237 Unclassified 683
130 Ga0068871_100135268 3300006358 Unclassified 2093
131 Ga0075428_100015436 3300006844 Bacteria 8466
132 Ga0075428_100056993 3300006844 Bacteria 4278
133 Ga0075428_100060822 3300006844 Unclassified 4136
134 Ga0075428_100541536 3300006844 Unclassified 1244
135 Ga0075428_101223860 3300006844 Bacteria 791
136 Ga0075430_100391682 3300006846 Bacteria 1146
137 Ga0075430_100937801 3300006846 Unclassified 713
138 Ga0075431_100066073 3300006847 Bacteria 3734
139 Ga0075431_100072165 3300006847 Bacteria 3562
140 Ga0075431_100122024 3300006847 Bacteria 2689
141 Ga0075431_100238484 3300006847 Unclassified 1851
142 Ga0075433_10021988 3300006852 Bacteria 5352
143 Ga0075433_10025197 3300006852 Bacteria 5028
144 Ga0075433_10435285 3300006852 Unclassified 1156
145 Ga0075434_100062858 3300006871 Bacteria 3696
146 Ga0075434_100176133 3300006871 Bacteria 2159
147 Ga0075434_100286252 3300006871 Unclassified 1668
148 Ga0075434_100294400 3300006871 Unclassified 1643
149 Ga0075434_100413516 3300006871 Bacteria 1370
150 Ga0075434_100546339 3300006871 Bacteria 1178
151 Ga0075434_100922039 3300006871 Bacteria 888
152 Ga0075434_100928776 3300006871 Bacteria 885
153 Ga0075434_101335325 3300006871 Unclassified 728
154 Ga0075434_101700799 3300006871 Unclassified 639
155 Ga0075429_100065154 3300006880 Unclassified 3172
156 Ga0075429_100068638 3300006880 Bacteria 3086
157 Ga0075429_100118427 3300006880 Bacteria 2314
158 Ga0075429_100165417 3300006880 Bacteria 1938
159 Ga0068865_100034912 3300006881 Unclassified 3378
160 Ga0097620_100008410 3300006931 Bacteria 10458
161 Ga0097620_100019594 3300006931 Bacteria 6796
162 Ga0097620_100374074 3300006931 Bacteria 1520
163 Ga0075435_100230742 3300007076 Bacteria 1573
164 Ga0075435_100509393 3300007076 Bacteria 1041
165 Ga0075435_100516651 3300007076 Bacteria 1033
166 Ga0075435_100740862 3300007076 Unclassified 855
167 Ga0075435_100865274 3300007076 Unclassified 788
168 Ga0099794_10153671 3300007265 Unclassified 1169
169 Ga0111539_10044211 3300009094 Bacteria 5337
170 Ga0111539_10060260 3300009094 Unclassified 4498
171 Ga0111539_10170973 3300009094 Bacteria 2539
172 Ga0111539_10184043 3300009094 Bacteria 2440
173 Ga0111539_10268713 3300009094 Unclassified 1985
174 Ga0111539_10336901 3300009094 Bacteria 1756
175 Ga0111539_10740049 3300009094 Bacteria 1145
176 Ga0111539_11762888 3300009094 Unclassified 718
177 Ga0105245_10137959 3300009098 Bacteria 2294
178 Ga0114129_10021857 3300009147 Bacteria 9080
179 Ga0114129_10054549 3300009147 Bacteria 5603
180 Ga0114129_10102142 3300009147 Bacteria 3966
181 Ga0114129_10172091 3300009147 Unclassified 2951
182 Ga0114129_10205067 3300009147 Unclassified 2668
183 Ga0114129_10388393 3300009147 Bacteria 1842
184 Ga0114129_10491216 3300009147 Bacteria 1605
185 Ga0114129_10522142 3300009147 Bacteria 1548
186 Ga0114129_10968639 3300009147 Bacteria 1073
187 Ga0114129_11145043 3300009147 Unclassified 972
188 Ga0114129_11648759 3300009147 Unclassified 784
189 Ga0114129_13190662 3300009147 Bacteria 533
190 Ga0105243_10111128 3300009148 Unclassified 2293
191 Ga0105242_10050182 3300009176 Bacteria 3397
192 Ga0105242_10583601 3300009176 Unclassified 1077
193 Ga0105248_10272545 3300009177 Unclassified 1905
194 Ga0105248_11042340 3300009177 Unclassified 924
195 Ga0105248_11650556 3300009177 Unclassified 726
196 Ga0105248_11820062 3300009177 Unclassified 691
197 Ga0105249_10000823 3300009553 Bacteria 27980
198 Ga0105249_10226882 3300009553 Bacteria 1841
199 Ga0105249_10528853 3300009553 Bacteria 1227
200 Ga0105249_12823038 3300009553 Unclassified 557
201 Ga0105246_11184791 3300011119 Unclassified 702
202 Ga0157378_10507408 3300013297 Bacteria 1206
203 Ga0157378_12259712 3300013297 Unclassified 595
204 Ga0163162_10366378 3300013306 Bacteria 1574
205 Ga0163162_13364274 3300013306 Unclassified 511
206 Ga0157375_10092093 3300013308 Unclassified 3094
207 Ga0157375_11235261 3300013308 Bacteria 877
208 Ga0163163_10218480 3300014325 Bacteria 1955
209 Ga0163163_10825470 3300014325 Archaea 990
210 Ga0157380_10124695 3300014326 Unclassified 2187
211 Ga0157380_11123256 3300014326 Bacteria 826
212 Ga0157377_10049748 3300014745 Unclassified 2357
213 Ga0157379_10470576 3300014968 Bacteria 1162
214 Ga0157376_10518081 3300014969 Bacteria 1175
215 Ga0163161_10507146 3300017792 Bacteria 983
216 Ga0184600_123942 3300019190 Unclassified 552
217 Ga0207697_10079513 3300025315 Bacteria 1381
218 Ga0207697_10465946 3300025315 Unclassified 560
219 Ga0207653_10156091 3300025885 Unclassified 842
220 Ga0207710_10204391 3300025900 Unclassified 976
221 Ga0207680_10109932 3300025903 Bacteria 1786
222 Ga0207680_10145579 3300025903 Bacteria 1575
223 Ga0207647_10147402 3300025904 Bacteria 1377
224 Ga0207643_10004773 3300025908 Bacteria 7261
225 Ga0207684_10285733 3300025910 Unclassified 1423
226 Ga0207662_10003470 3300025918 Bacteria 8120
227 Ga0207662_10442180 3300025918 Unclassified 888
228 Ga0207646_10073876 3300025922 Bacteria 3046
229 Ga0207646_10098994 3300025922 Unclassified 2613
230 Ga0207681_10026484 3300025923 Unclassified 3740
231 Ga0207681_10526307 3300025923 Bacteria 971
232 Ga0207681_11533472 3300025923 Unclassified 558
233 Ga0207650_11647401 3300025925 Unclassified 544
234 Ga0207659_10138002 3300025926 Bacteria 1890
235 Ga0207659_10522659 3300025926 Unclassified 1006
236 Ga0207659_10624069 3300025926 Bacteria 920
237 Ga0207659_10644286 3300025926 Bacteria 905
238 Ga0207706_10028030 3300025933 Bacteria 5032
239 Ga0207686_10027544 3300025934 Bacteria 3330
240 Ga0207709_11301188 3300025935 Unclassified 601
241 Ga0207670_10025181 3300025936 Unclassified 3731
242 Ga0207669_10234667 3300025937 Bacteria 1356
243 Ga0207669_10464544 3300025937 Bacteria 1006
244 Ga0207704_10018304 3300025938 Unclassified 3654
245 Ga0207691_10007867 3300025940 Bacteria 10269
246 Ga0207691_10505321 3300025940 Bacteria 1026
247 Ga0207691_10957439 3300025940 Unclassified 715
248 Ga0207711_10015481 3300025941 Bacteria 6330
249 Ga0207711_10221462 3300025941 Bacteria 1731
250 Ga0207689_10168934 3300025942 Bacteria 1802
251 Ga0207651_10072041 3300025960 Bacteria 2452
252 Ga0207651_10541285 3300025960 Bacteria 1011
253 Ga0207668_10055717 3300025972 Bacteria 2750
254 Ga0207640_10693135 3300025981 Bacteria 872
255 Ga0207677_10343699 3300026023 Unclassified 1248
256 Ga0207677_10674295 3300026023 Bacteria 915
257 Ga0207677_10946816 3300026023 Bacteria 778
258 Ga0207677_11073888 3300026023 Unclassified 733
259 Ga0207703_10102703 3300026035 Unclassified 2426
260 Ga0207703_10115846 3300026035 Bacteria 2293
261 Ga0207703_10169380 3300026035 Unclassified 1920
262 Ga0207708_10015215 3300026075 Bacteria 5768
263 Ga0207708_10941976 3300026075 Bacteria 749
264 Ga0207641_10287175 3300026088 Unclassified 1549
265 Ga0207641_10560208 3300026088 Bacteria 1115
266 Ga0207641_11473569 3300026088 Unclassified 682
267 Ga0207648_10003248 3300026089 Bacteria 17101
268 Ga0207648_10132664 3300026089 Bacteria 2192
269 Ga0207676_10086046 3300026095 Bacteria 2567
270 Ga0207676_10129258 3300026095 Unclassified 2145
271 Ga0207674_10024528 3300026116 Bacteria 6443
272 Ga0207674_10125330 3300026116 Unclassified 2534
273 Ga0207674_11716900 3300026116 Unclassified 596
274 Ga0207675_100000903 3300026118 Bacteria 29636
275 Ga0207675_100086464 3300026118 Bacteria 2944
276 Ga0207675_100417431 3300026118 Bacteria 1325
277 Ga0207675_100881050 3300026118 Bacteria 911
278 Ga0207698_10596910 3300026142 Bacteria 1088
279 Ga0207698_11914238 3300026142 Unclassified 608
280 Ga0209970_1055045 3300027614 Unclassified 724
281 Ga0207428_10004898 3300027907 Bacteria 12614
282 Ga0207428_10358749 3300027907 Bacteria 1072
283 Ga0207428_10376276 3300027907 Bacteria 1042
284 Ga0207428_10699002 3300027907 Unclassified 725
285 Ga0268265_10000073 3300028380 Bacteria 128856
286 Ga0268265_10055394 3300028380 Bacteria 3013
287 Ga0268265_10470561 3300028380 Unclassified 1178
288 Ga0268265_10639873 3300028380 Unclassified 1021
289 Ga0268264_10020334 3300028381 Bacteria 5425
290 Ga0268264_10069051 3300028381 Unclassified 2988
291 Ga0268264_10984571 3300028381 Unclassified 849
292 Ga0265765_1046947 3300030879 Unclassified 585
293 Ga0373932_0216799 3300035112 Bacteria 686
294 Ga0373955_0560651 3300035172 Unclassified 699
295 Ga0373931_0536726 3300035691 Bacteria 759
296 Ga0373937_0557751 3300036401 Unclassified 1088
297 Ga0373937_0897911 3300036401 Bacteria 835
298 Ga0439456_091451 3300042013 Unclassified 684
299 Ga0439460_0030565 3300042461 Bacteria 1532
300 Ga0451576_2372131 3300045051 Bacteria 543
301 Ga0495591_111023 3300046458 Unclassified 673
302 Ga0495580_0523725 3300046472 Unclassified 790
303 Ga0495644_0176389 3300046523 Unclassified 821
304 Ga0495642_0110884 3300046528 Bacteria 1173
305 Ga0495598_0018407 3300046537 Bacteria 1816
306 Ga0495621_0181427 3300046539 Unclassified 840
307 Ga0495621_0267890 3300046539 Unclassified 701
308 Ga0495659_0068892 3300046664 Bacteria 1322
309 Ga0495659_0207354 3300046664 Bacteria 805
310 Ga0495669_0027215 3300046684 Unclassified 2501
311 Ga0495613_0545452 3300046689 Unclassified 776
312 Ga0495636_0022958 3300047318 Unclassified 2524
313 Ga0495636_0139263 3300047318 Unclassified 1083
314 Ga0495684_0320499 3300047471 Bacteria 1108
315 Ga0496104_1338979 3300048907 Unclassified 619
316 Ga0501036_0296910 3300049572 Bacteria 1351
317 Ga0501037_0488926 3300049573 Unclassified 836
318 Ga0501040_0095648 3300049576 Bacteria 2067
319 Ga0501041_0017911 3300049577 Unclassified 4215
320 Ga0501042_0026682 3300049578 Bacteria 4058
321 Ga0501043_0380711 3300049579 Bacteria 1068
322 Ga0501046_0028840 3300049580 Bacteria 4516
323 Ga0501067_0031679 3300049583 Bacteria 2934
324 Ga0501071_0018917 3300049587 Bacteria 4778
325 Ga0501071_0864893 3300049587 Unclassified 697
326 Ga0501072_0551289 3300049588 Unclassified 910
327 Ga0501075_0056020 3300049591 Bacteria 2967
328 Ga0501076_0005897 3300049592 Bacteria 8839
329 Ga0501077_0048446 3300049593 Unclassified 2700
330 Ga0501079_0044390 3300049741 Bacteria 3430
331 Ga0501081_0009761 3300049743 Bacteria 6256
332 Ga0501045_0025815 3300049824 Unclassified 4224
333 nmdc:mga05p37_14189_c1 3300050507 Bacteria 9565
334 nmdc:mga05p37_144588_c1 3300050507 Unclassified 2912
335 nmdc:mga05p37_213229_c1 3300050507 Unclassified 2333
336 nmdc:mga05p37_34505_c1 3300050507 Bacteria 6197
337 nmdc:mga05p37_410008_c1 3300050507 Bacteria 1580
338 nmdc:mga05p37_460456_c1 3300050507 Bacteria 1470
339 nmdc:mga05p37_94836_c1 3300050507 Unclassified 3676
340 nmdc:mga09592_120939_c1 3300050508 Bacteria 2249
341 nmdc:mga09592_206575_c1 3300050508 Bacteria 1701
342 nmdc:mga09592_548531_c1 3300050508 Bacteria 993
343 nmdc:mga09592_91719_c1 3300050508 Bacteria 2596
344 nmdc:mga06r32_151694_c1 3300050510 Unclassified 2296
345 nmdc:mga06r32_164783_c1 3300050510 Bacteria 2199
346 nmdc:mga06r32_168818_c1 3300050510 Bacteria 2171
347 nmdc:mga06r32_185067_c1 3300050510 Bacteria 2069
348 nmdc:mga06r32_794243_c1 3300050510 Unclassified 907
349 nmdc:mga08y16_212602_c1 3300050511 Unclassified 2003
350 nmdc:mga08y16_42570_c1 3300050511 Unclassified 4756
351 nmdc:mga08y16_5164_c1 3300050511 Unclassified 4931
352 nmdc:mga08y16_568098_c1 3300050511 Bacteria 1146
353 nmdc:mga08y16_680124_c1 3300050511 Bacteria 1031
354 nmdc:mga08y16_752194_c1 3300050511 Bacteria 971
355 nmdc:mga08y16_7948_c1 3300050511 Bacteria 11099
356 nmdc:mga0n895_1503409_c1 3300050512 Unclassified 640
357 nmdc:mga0n895_166773_c1 3300050512 Bacteria 2234
358 nmdc:mga0n895_264706_c1 3300050512 Unclassified 1744
359 nmdc:mga0n895_510139_c1 3300050512 Bacteria 1211
360 nmdc:mga0n895_592668_c1 3300050512 Bacteria 1111
361 nmdc:mga0rr50_296319_c1 3300050513 Bacteria 1352
362 nmdc:mga0rr50_493371_c1 3300050513 Bacteria 1041
363 nmdc:mga0rr50_772536_c1 3300050513 Unclassified 820
364 nmdc:mga0a205_1270987_c1 3300050515 Unclassified 584
365 nmdc:mga0a205_1307653_c1 3300050515 Unclassified 573
366 nmdc:mga0a205_204057_c1 3300050515 Bacteria 1866
367 nmdc:mga0a205_342888_c1 3300050515 Bacteria 1362
368 Ga0501084_0911251 3300054114 Bacteria 739
369 Ga0501082_0006740 3300060353 Bacteria 9929
370 Ga0530510_0256963 3300061734 Bacteria 1302
371 Ga0070682_100887699
372 Ga0058859_11780990
373 Ga0058861_11464746
374 Ga0058860_11492312
375 Ga0058860_11552903
376 Ga0058860_11555299
377 Ga0058860_11634639
378 Ga0058862_12597658
379 Ga0065704_10118768
380 Ga0065704_10126487
381 Ga0065704_10468913
382 Ga0065704_10582506
383 Ga0065715_10094865
384 Ga0065715_10140277
385 Ga0065707_10110818
386 Ga0065707_10226403
387 Ga0065707_10558981
388 Ga0070676_10479881
389 Ga0070690_100388512
390 Ga0070677_10565063
391 Ga0068869_100899088
392 Ga0068869_100953951
393 Ga0070666_10168076
394 Ga0070666_10181616
395 Ga0070680_100531425
396 Ga0070682_101593534
397 Ga0068868_100378878
398 Ga0068868_100863203
399 Ga0068868_101470187
400 Ga0070689_100070168
401 Ga0070689_101198615
402 Ga0070687_100047496
403 Ga0070692_10214255
404 Ga0070668_100043377
405 Ga0070669_100003917
406 Ga0070669_100687975
407 Ga0070669_100738501
408 Ga0070669_101014258
409 Ga0070675_100003474
410 Ga0070675_100014705
411 Ga0070675_100029314
412 Ga0070675_100161630
413 Ga0070675_100256260
414 Ga0070675_100708287
415 Ga0070674_100140665
416 Ga0070674_100408806
417 Ga0070674_101173725
418 Ga0070673_100034057
419 Ga0070673_100077176
420 Ga0070673_100253777
421 Ga0070673_100258174
422 Ga0070688_100018631
423 Ga0070688_100027650
424 Ga0070688_100245349
425 Ga0070667_100016163
426 Ga0070667_101418885
427 Ga0070703_10505519
428 Ga0070701_10310740
429 Ga0070705_100113161
430 Ga0070705_100308040
431 Ga0070700_100044846
432 Ga0070694_100073054
433 Ga0070708_100622922
434 Ga0070663_101819380
435 Ga0070662_100032669
436 Ga0068867_100001424
437 Ga0068867_100385580
438 Ga0070685_10004711
439 Ga0070706_100241120
440 Ga0070706_100574689
441 Ga0070707_100274745
442 Ga0070707_100617153
443 Ga0070707_100742266
444 Ga0070698_100025963
445 Ga0070698_100045138
446 Ga0070698_100239607
447 Ga0070698_100271315
448 Ga0070698_100454312
449 Ga0070698_100489919
450 Ga0070699_100032780
451 Ga0070699_101014866
452 Ga0070699_101655451
453 Ga0070697_100948509
454 Ga0070697_101175934
455 Ga0068853_100772330
456 Ga0070672_100011169
457 Ga0070672_100021342
458 Ga0070672_101530934
459 Ga0070686_100589505
460 Ga0070704_100089255
461 Ga0070704_100232768
462 Ga0070704_101660345
463 Ga0070664_100024381
464 Ga0070664_100049537
465 Ga0070664_100454611
466 Ga0070664_100666957
467 Ga0070664_101124668
468 Ga0068857_100021889
469 Ga0068857_100239100
470 Ga0068857_100982850
471 Ga0070702_101062281
472 Ga0068852_100342639
473 Ga0068859_100008410
474 Ga0068859_100019594
475 Ga0068859_100374050
476 Ga0068864_100124990
477 Ga0068864_100151789
478 Ga0068866_11104082
479 Ga0068861_100017890
480 Ga0068861_100178379
481 Ga0068861_100402955
482 Ga0068861_100696181
483 Ga0068870_10005193
484 Ga0068863_100039723
485 Ga0068863_100182101
486 Ga0068863_100372421
487 Ga0068858_100085009
488 Ga0068858_100155058
489 Ga0068858_100646932
490 Ga0068858_100859222
491 Ga0068860_100010554
492 Ga0068862_100000840
493 Ga0068862_100251781
494 Ga0068862_100473691
495 Ga0068862_101320163
496 Ga0081455_10682717
497 Ga0081455_10691520
498 Ga0075427_10023468
499 Ga0097621_101315664
500 Ga0068871_100135268
501 Ga0075428_100015436
502 Ga0075428_100056993
503 Ga0075428_100060822
504 Ga0075428_100541536
505 Ga0075428_101223860
506 Ga0075430_100391682
507 Ga0075430_100937801
508 Ga0075431_100066073
509 Ga0075431_100072165
510 Ga0075431_100122024
511 Ga0075431_100238484
512 Ga0075433_10021988
513 Ga0075433_10025197
514 Ga0075433_10435285
515 Ga0075434_100062858
516 Ga0075434_100176133
517 Ga0075434_100286252
518 Ga0075434_100294400
519 Ga0075434_100413516
520 Ga0075434_100546339
521 Ga0075434_100922039
522 Ga0075434_100928776
523 Ga0075434_101335325
524 Ga0075434_101700799
525 Ga0075429_100065154
526 Ga0075429_100068638
527 Ga0075429_100118427
528 Ga0075429_100165417
529 Ga0068865_100034912
530 Ga0097620_100008410
531 Ga0097620_100019594
532 Ga0097620_100374074
533 Ga0075435_100230742
534 Ga0075435_100509393
535 Ga0075435_100516651
536 Ga0075435_100740862
537 Ga0075435_100865274
538 Ga0099794_10153671
539 Ga0111539_10044211
540 Ga0111539_10060260
541 Ga0111539_10170973
542 Ga0111539_10184043
543 Ga0111539_10268713
544 Ga0111539_10336901
545 Ga0111539_10740049
546 Ga0111539_11762888
547 Ga0105245_10137959
548 Ga0114129_10021857
549 Ga0114129_10054549
550 Ga0114129_10102142
551 Ga0114129_10172091
552 Ga0114129_10205067
553 Ga0114129_10388393
554 Ga0114129_10491216
555 Ga0114129_10522142
556 Ga0114129_10968639
557 Ga0114129_11145043
558 Ga0114129_11648759
559 Ga0114129_13190662
560 Ga0105243_10111128
561 Ga0105242_10050182
562 Ga0105242_10583601
563 Ga0105248_10272545
564 Ga0105248_11042340
565 Ga0105248_11650556
566 Ga0105248_11820062
567 Ga0105249_10000823
568 Ga0105249_10226882
569 Ga0105249_10528853
570 Ga0105249_12823038
571 Ga0105246_11184791
572 Ga0157378_10507408
573 Ga0157378_12259712
574 Ga0163162_10366378
575 Ga0163162_13364274
576 Ga0157375_10092093
577 Ga0157375_11235261
578 Ga0163163_10218480
579 Ga0163163_10825470
580 Ga0157380_10124695
581 Ga0157380_11123256
582 Ga0157377_10049748
583 Ga0157379_10470576
584 Ga0157376_10518081
585 Ga0163161_10507146
586 Ga0184600_123942
587 Ga0207697_10079513
588 Ga0207697_10465946
589 Ga0207653_10156091
590 Ga0207710_10204391
591 Ga0207680_10109932
592 Ga0207680_10145579
593 Ga0207647_10147402
594 Ga0207643_10004773
595 Ga0207684_10285733
596 Ga0207662_10003470
597 Ga0207662_10442180
598 Ga0207646_10073876
599 Ga0207646_10098994
600 Ga0207681_10026484
601 Ga0207681_10526307
602 Ga0207681_11533472
603 Ga0207650_11647401
604 Ga0207659_10138002
605 Ga0207659_10522659
606 Ga0207659_10624069
607 Ga0207659_10644286
608 Ga0207706_10028030
609 Ga0207686_10027544
610 Ga0207709_11301188
611 Ga0207670_10025181
612 Ga0207669_10234667
613 Ga0207669_10464544
614 Ga0207704_10018304
615 Ga0207691_10007867
616 Ga0207691_10505321
617 Ga0207691_10957439
618 Ga0207711_10015481
619 Ga0207711_10221462
620 Ga0207689_10168934
621 Ga0207651_10072041
622 Ga0207651_10541285
623 Ga0207668_10055717
624 Ga0207640_10693135
625 Ga0207677_10343699
626 Ga0207677_10674295
627 Ga0207677_10946816
628 Ga0207677_11073888
629 Ga0207703_10102703
630 Ga0207703_10115846
631 Ga0207703_10169380
632 Ga0207708_10015215
633 Ga0207708_10941976
634 Ga0207641_10287175
635 Ga0207641_10560208
636 Ga0207641_11473569
637 Ga0207648_10003248
638 Ga0207648_10132664
639 Ga0207676_10086046
640 Ga0207676_10129258
641 Ga0207674_10024528
642 Ga0207674_10125330
643 Ga0207674_11716900
644 Ga0207675_100000903
645 Ga0207675_100086464
646 Ga0207675_100417431
647 Ga0207675_100881050
648 Ga0207698_10596910
649 Ga0207698_11914238
650 Ga0209970_1055045
651 Ga0207428_10004898
652 Ga0207428_10358749
653 Ga0207428_10376276
654 Ga0207428_10699002
655 Ga0268265_10000073
656 Ga0268265_10055394
657 Ga0268265_10470561
658 Ga0268265_10639873
659 Ga0268264_10020334
660 Ga0268264_10069051
661 Ga0268264_10984571
662 Ga0265765_1046947
663 Ga0373932_0216799
664 Ga0373955_0560651
665 Ga0373931_0536726
666 Ga0373937_0557751
667 Ga0373937_0897911
668 Ga0439456_091451
669 Ga0439460_0030565
670 Ga0451576_2372131
671 Ga0495591_111023
672 Ga0495580_0523725
673 Ga0495644_0176389
674 Ga0495642_0110884
675 Ga0495598_0018407
676 Ga0495621_0181427
677 Ga0495621_0267890
678 Ga0495659_0068892
679 Ga0495659_0207354
680 Ga0495669_0027215
681 Ga0495613_0545452
682 Ga0495636_0022958
683 Ga0495636_0139263
684 Ga0495684_0320499
685 Ga0496104_1338979
686 Ga0501036_0296910
687 Ga0501037_0488926
688 Ga0501040_0095648
689 Ga0501041_0017911
690 Ga0501042_0026682
691 Ga0501043_0380711
692 Ga0501046_0028840
693 Ga0501067_0031679
694 Ga0501071_0018917
695 Ga0501071_0864893
696 Ga0501072_0551289
697 Ga0501075_0056020
698 Ga0501076_0005897
699 Ga0501077_0048446
700 Ga0501079_0044390
701 Ga0501081_0009761
702 Ga0501045_0025815
703 nmdc:mga05p37_14189_c1
704 nmdc:mga05p37_144588_c1
705 nmdc:mga05p37_213229_c1
706 nmdc:mga05p37_34505_c1
707 nmdc:mga05p37_410008_c1
708 nmdc:mga05p37_460456_c1
709 nmdc:mga05p37_94836_c1
710 nmdc:mga09592_120939_c1
711 nmdc:mga09592_206575_c1
712 nmdc:mga09592_548531_c1
713 nmdc:mga09592_91719_c1
714 nmdc:mga06r32_151694_c1
715 nmdc:mga06r32_164783_c1
716 nmdc:mga06r32_168818_c1
717 nmdc:mga06r32_185067_c1
718 nmdc:mga06r32_794243_c1
719 nmdc:mga08y16_212602_c1
720 nmdc:mga08y16_42570_c1
721 nmdc:mga08y16_5164_c1
722 nmdc:mga08y16_568098_c1
723 nmdc:mga08y16_680124_c1
724 nmdc:mga08y16_752194_c1
725 nmdc:mga08y16_7948_c1
726 nmdc:mga0n895_1503409_c1
727 nmdc:mga0n895_166773_c1
728 nmdc:mga0n895_264706_c1
729 nmdc:mga0n895_510139_c1
730 nmdc:mga0n895_592668_c1
731 nmdc:mga0rr50_296319_c1
732 nmdc:mga0rr50_493371_c1
733 nmdc:mga0rr50_772536_c1
734 nmdc:mga0a205_1270987_c1
735 nmdc:mga0a205_1307653_c1
736 nmdc:mga0a205_204057_c1
737 nmdc:mga0a205_342888_c1
738 Ga0501084_0911251
739 Ga0501082_0006740
740 Ga0530510_0256963

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

12

113

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7og2-assembly1.cif.gz_B crystal structure of pseudoalteromonas luteoviolacea l-amino acid oxidase 0.8192 39 71
4fxd-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7949 38 71
4fxd-assembly2.cif.gz_B crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7932 38 71
4b08-assembly1.cif.gz_A yeast dna polymerase alpha, selenomethionine protein 0.772 37 71
8foc-assembly1.cif.gz_1 cryo-em structure of s. cerevisiae dna polymerase alpha-primase in apo state conformation i 0.772 37 71
ID Description Score Start End Superfamily
af_B2RYE5_272_368_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8819 41 71 2.30.29.30
af_Q9VKY7_200_296_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8663 41 75 2.30.29.30
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8468 36 93 2.40.50.140
3rlfA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8225 36 96 2.40.50.140
af_Q58598_204_318_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8006 35 115 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A383CUF3-F1-model_v4 OB domain-containing protein 0.9856 30 123
AF-A0A2V9CMA3-F1-model_v4 Uncharacterized protein 0.9705 40 125
AF-A0A2W4Q999-F1-model_v4 DUF5666 domain-containing protein 0.966 30 122
AF-A0A7X4ETN3-F1-model_v4 DUF5666 domain-containing protein 0.9628 36 122
AF-A0A351D019-F1-model_v4 Minor tail protein 0.9604 34 125

Map