F425176

General Info

Members Datasets Scaffolds Average Seq Length
369 236 360 280

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0143463|Ga0496108_0143463_1065_2003
Length 312
Sequence VTAALTAATVEAHEGEADGARRRSRFAWVLLAPGLAYLVLFFVAPVAVLLLFSFYERVPGGAVGQTTPAFRIANYTEAIAEYAPQFGRSFLFALIATVLTLAIGYPLAYVIAVRARNRPLLQGLMLVMVIAPFFTSFILRTIAWKQILADESAVVAVLKAVAILPEGARLTATPFAVVAGLTYNFLPFMVLPIYASLERIDTSLIEAGKDLYASARQAFFRVTLPLTTPGVIAGVLLTFIPASGDYVNAAFLGGANNTMIGNKIQSTYLVESDYPKAAALSFLMMAAVLALVFIYIRFAGTEAFTGSEEEAK

Samples

Sample ID Description Type Environment
1 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
2 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
3 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
4 2643221641 Nocardioides sp. Root122 Isolate Unclassified
5 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
6 2739367898 Nocardioides sp. CF479 Isolate Unclassified
7 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
8 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
9 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
112 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
130 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
131 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
132 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
133 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
134 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
135 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
136 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
137 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
138 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
139 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
189 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
224 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
229 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
235 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
236 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.02
Metatranscriptomes 0.54
Isolates 2.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.71
Nodule 0.27
Rhizoplane 8.67
Rhizosphere 82.93
Stem 0
Stem Tuber 0
Unclassified 5.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002629 3300001979 Bacteria 8090
2 JGI25407J50210_10002447 3300003373 Bacteria 4370
3 Ga0070683_100000481 3300005329 Bacteria 28092
4 Ga0070683_100013435 3300005329 Bacteria 7142
5 Ga0070683_100036163 3300005329 Bacteria 4517
6 Ga0070683_100043068 3300005329 Bacteria 4159
7 Ga0070683_100049975 3300005329 Bacteria 3869
8 Ga0070683_100074045 3300005329 Bacteria 3180
9 Ga0070666_10007530 3300005335 Bacteria 6712
10 Ga0070682_100000815 3300005337 Bacteria 18228
11 Ga0068868_100000008 3300005338 Bacteria 121926
12 Ga0068868_100066958 3300005338 Bacteria 2857
13 Ga0068868_100336833 3300005338 Bacteria 1289
14 Ga0070660_100009526 3300005339 Bacteria 6836
15 Ga0070668_100002947 3300005347 Bacteria 12579
16 Ga0070674_100361424 3300005356 Bacteria 1175
17 Ga0070688_100057270 3300005365 Bacteria 2449
18 Ga0070688_100219836 3300005365 Bacteria 1338
19 Ga0070659_100020330 3300005366 Bacteria 5041
20 Ga0070659_100216793 3300005366 Bacteria 1579
21 Ga0070667_100002992 3300005367 Bacteria 14517
22 Ga0070667_100058800 3300005367 Bacteria 3251
23 Ga0070703_10024422 3300005406 Bacteria 1786
24 Ga0070714_100109615 3300005435 Bacteria 2443
25 Ga0070713_100000076 3300005436 Bacteria 61668
26 Ga0070700_100000019 3300005441 Bacteria 137133
27 Ga0070694_100129813 3300005444 Bacteria 1819
28 Ga0070663_100002015 3300005455 Bacteria 11348
29 Ga0070678_100105036 3300005456 Bacteria 2198
30 Ga0070662_100000039 3300005457 Bacteria 74491
31 Ga0068867_100000239 3300005459 Bacteria 36083
32 Ga0068867_100033698 3300005459 Bacteria 3711
33 Ga0070679_100014594 3300005530 Bacteria 7548
34 Ga0070684_100010251 3300005535 Bacteria 7419
35 Ga0070684_100038445 3300005535 Bacteria 4111
36 Ga0070684_100048629 3300005535 Bacteria 3679
37 Ga0070672_100317992 3300005543 Bacteria 1323
38 Ga0070693_100000193 3300005547 Bacteria 28441
39 Ga0070665_100007269 3300005548 Bacteria 11253
40 Ga0070665_100054350 3300005548 Bacteria 4016
41 Ga0068855_100172118 3300005563 Bacteria 2452
42 Ga0070664_100093453 3300005564 Bacteria 2606
43 Ga0070664_100742423 3300005564 Bacteria 916
44 Ga0068854_100000115 3300005578 Bacteria 55089
45 Ga0068856_100000057 3300005614 Bacteria 102045
46 Ga0068856_100245477 3300005614 Bacteria 1806
47 Ga0068859_100217276 3300005617 Bacteria 1999
48 Ga0068851_10002118 3300005834 Bacteria 8726
49 Ga0068863_100015526 3300005841 Bacteria 7317
50 Ga0068858_100102921 3300005842 Bacteria 2664
51 Ga0068858_100149284 3300005842 Bacteria 2197
52 Ga0068860_100000403 3300005843 Bacteria 56312
53 Ga0068860_100251466 3300005843 Bacteria 1721
54 Ga0068860_100617716 3300005843 Bacteria 1090
55 Ga0068862_100000391 3300005844 Bacteria 47191
56 Ga0081538_10000907 3300005981 Bacteria 32006
57 Ga0081538_10005717 3300005981 Bacteria 11118
58 Ga0081538_10019069 3300005981 Bacteria 5118
59 Ga0081539_10001100 3300005985 Bacteria 49090
60 Ga0075365_10008776 3300006038 Bacteria 5766
61 Ga0075368_10008762 3300006042 Bacteria 3620
62 Ga0075364_10005779 3300006051 Bacteria 7216
63 Ga0075364_10014893 3300006051 Bacteria 4812
64 Ga0070715_10000003 3300006163 Bacteria 345282
65 Ga0075367_10091259 3300006178 Bacteria 1853
66 Ga0075367_10112450 3300006178 Bacteria 1672
67 Ga0097621_100561193 3300006237 Bacteria 1040
68 Ga0068871_100017232 3300006358 Bacteria 5462
69 Ga0075431_100002381 3300006847 Bacteria 18073
70 Ga0097620_100217300 3300006931 Bacteria 1999
71 Ga0105240_10191264 3300009093 Bacteria 2406
72 Ga0105245_10002031 3300009098 Bacteria 18358
73 Ga0105245_10099474 3300009098 Bacteria 2689
74 Ga0105245_10112242 3300009098 Bacteria 2536
75 Ga0105247_10054052 3300009101 Bacteria 2478
76 Ga0105243_10041288 3300009148 Bacteria 3608
77 Ga0105243_10160368 3300009148 Bacteria 1939
78 Ga0105242_10002427 3300009176 Bacteria 14635
79 Ga0105248_10439878 3300009177 Bacteria 1469
80 Ga0105238_10055195 3300009551 Bacteria 3989
81 Ga0105249_10000841 3300009553 Bacteria 27506
82 Ga0105249_10073501 3300009553 Bacteria 3163
83 Ga0105239_10042952 3300010375 Bacteria 4953
84 Ga0105239_10397857 3300010375 Bacteria 1559
85 Ga0105239_10676154 3300010375 Bacteria 1180
86 Ga0157371_10023682 3300013102 Bacteria 4489
87 Ga0157370_10008623 3300013104 Bacteria 10979
88 Ga0157370_10032556 3300013104 Bacteria 5090
89 Ga0157378_10012517 3300013297 Bacteria 7425
90 Ga0163162_10239948 3300013306 Bacteria 1943
91 Ga0163162_10300339 3300013306 Bacteria 1738
92 Ga0163162_10433658 3300013306 Bacteria 1446
93 Ga0157372_10000616 3300013307 Bacteria 38850
94 Ga0157372_10490302 3300013307 Bacteria 1433
95 Ga0157375_10212104 3300013308 Bacteria 2094
96 Ga0163163_10121871 3300014325 Bacteria 2642
97 Ga0163163_10460188 3300014325 Bacteria 1332
98 Ga0163163_10607286 3300014325 Bacteria 1157
99 Ga0157377_10111281 3300014745 Bacteria 1646
100 Ga0157379_10054784 3300014968 Bacteria 3563
101 Ga0163161_10004640 3300017792 Bacteria 9559
102 Ga0206356_11472949 3300020070 Bacteria 4321
103 Ga0213875_10034838 3300021388 Bacteria 2376
104 Ga0224712_10003493 3300022467 Bacteria 4094
105 Ga0207656_10000354 3300025321 Bacteria 15472
106 Ga0207710_10039663 3300025900 Bacteria 2084
107 Ga0207688_10355567 3300025901 Bacteria 903
108 Ga0207647_10052011 3300025904 Bacteria 2529
109 Ga0207685_10000003 3300025905 Bacteria 344527
110 Ga0207705_10197252 3300025909 Bacteria 1524
111 Ga0207693_10000859 3300025915 Bacteria 27121
112 Ga0207657_10016663 3300025919 Bacteria 7081
113 Ga0207652_10001763 3300025921 Bacteria 18893
114 Ga0207687_10000350 3300025927 Bacteria 30682
115 Ga0207700_10000009 3300025928 Bacteria 314953
116 Ga0207664_10027335 3300025929 Bacteria 4324
117 Ga0207690_10053222 3300025932 Bacteria 2715
118 Ga0207706_10000026 3300025933 Bacteria 149379
119 Ga0207686_10001457 3300025934 Bacteria 13395
120 Ga0207669_10043773 3300025937 Bacteria 2624
121 Ga0207661_10000142 3300025944 Bacteria 45456
122 Ga0207661_10000166 3300025944 Bacteria 42698
123 Ga0207661_10085372 3300025944 Bacteria 2616
124 Ga0207661_10116479 3300025944 Bacteria 2268
125 Ga0207661_10133772 3300025944 Bacteria 2127
126 Ga0207679_10066463 3300025945 Bacteria 2702
127 Ga0207679_10171316 3300025945 Bacteria 1787
128 Ga0207712_10008190 3300025961 Bacteria 6607
129 Ga0207712_10226801 3300025961 Bacteria 1497
130 Ga0207712_10341132 3300025961 Bacteria 1242
131 Ga0207668_10002710 3300025972 Bacteria 10367
132 Ga0207640_10000059 3300025981 Bacteria 90901
133 Ga0207658_10001012 3300025986 Bacteria 22933
134 Ga0207677_10000142 3300026023 Bacteria 58625
135 Ga0207703_10124796 3300026035 Bacteria 2215
136 Ga0207678_10005805 3300026067 Bacteria 11002
137 Ga0207678_10030237 3300026067 Bacteria 4728
138 Ga0207708_10000038 3300026075 Bacteria 137212
139 Ga0207702_10000027 3300026078 Bacteria 183792
140 Ga0207702_10004385 3300026078 Bacteria 12570
141 Ga0207641_10078349 3300026088 Bacteria 2862
142 Ga0207648_10041940 3300026089 Bacteria 4018
143 Ga0207683_10063083 3300026121 Bacteria 3264
144 Ga0209813_10001549 3300027866 Bacteria 5157
145 Ga0268266_10000664 3300028379 Bacteria 46506
146 Ga0268266_10032922 3300028379 Bacteria 4406
147 Ga0268265_10000440 3300028380 Bacteria 43839
148 Ga0268264_10000355 3300028381 Bacteria 68889
149 Ga0268264_10080875 3300028381 Bacteria 2776
150 Ga0268264_10550242 3300028381 Bacteria 1132
151 Ga0316576_10007696 3300031727 Bacteria 6796
152 Ga0316578_10077387 3300031728 Bacteria 1975
153 Ga0307407_10180817 3300031903 Bacteria 1398
154 Ga0307407_10362218 3300031903 Bacteria 1030
155 Ga0307409_100032138 3300031995 Bacteria 3800
156 Ga0307409_100096124 3300031995 Bacteria 2443
157 Ga0307409_100197942 3300031995 Bacteria 1795
158 Ga0307416_100052520 3300032002 Bacteria 3264
159 Ga0307416_100182760 3300032002 Bacteria 1967
160 Ga0307416_100588074 3300032002 Bacteria 1191
161 Ga0307411_10072427 3300032005 Bacteria 2340
162 Ga0307415_100012246 3300032126 Bacteria 4952
163 Ga0307415_100160617 3300032126 Bacteria 1741
164 Ga0316585_10014238 3300032137 Bacteria 2375
165 Ga0373955_0117856 3300035172 Bacteria 1541
166 Ga0316574_0011525 3300035398 Bacteria 5027
167 Ga0373933_0366763 3300035724 Bacteria 937
168 Ga0373937_0133971 3300036401 Bacteria 2316
169 Ga0373937_0468581 3300036401 Bacteria 1196
170 Ga0316584_0000676 3300036712 Bacteria 18730
171 Ga0316584_0154676 3300036712 Bacteria 1706
172 Ga0395900_0054381 3300037418 Bacteria 4122
173 Ga0395898_0043648 3300037466 Bacteria 4417
174 Ga0395898_0163797 3300037466 Bacteria 2127
175 Ga0395905_0134218 3300037471 Bacteria 2328
176 Ga0436364_1431654 3300037853 Bacteria 2439
177 Ga0395901_0015912 3300038443 Bacteria 7664
178 Ga0395901_0213618 3300038443 Bacteria 2018
179 Ga0395901_0219823 3300038443 Bacteria 1986
180 Ga0451797_0144488 3300041453 Bacteria 1091
181 Ga0451797_0408301 3300041453 Bacteria 1206
182 Ga0451800_0606121 3300041459 Bacteria 1339
183 Ga0451833_0469571 3300041491 Bacteria 13777
184 Ga0451837_1643552 3300041494 Bacteria 1525
185 Ga0451839_0458089 3300041496 Bacteria 1000
186 Ga0451843_0551206 3300041509 Bacteria 2167
187 Ga0439431_0004919 3300041997 Bacteria 2945
188 Ga0439431_0027984 3300041997 Bacteria 1387
189 Ga0439445_0007867 3300042004 Bacteria 2485
190 Ga0439446_0002277 3300042156 Bacteria 4581
191 Ga0439434_0016292 3300042435 Bacteria 2220
192 Ga0466972_0140674 3300044658 Bacteria 1136
193 Ga0466972_0196467 3300044658 Bacteria 945
194 Ga0466961_0019924 3300044693 Bacteria 4318
195 Ga0466963_0225634 3300044694 Bacteria 1312
196 Ga0466963_0244267 3300044694 Bacteria 1259
197 Ga0466964_0035766 3300044706 Bacteria 1988
198 Ga0466970_0009838 3300044765 Bacteria 4842
199 Ga0466957_0045134 3300044842 Bacteria 2672
200 Ga0466957_0318218 3300044842 Bacteria 1049
201 Ga0466957_0336399 3300044842 Bacteria 1022
202 Ga0466967_0000008 3300045976 Bacteria 127135
203 Ga0466967_0082886 3300045976 Bacteria 2899
204 Ga0466967_0097118 3300045976 Bacteria 2689
205 Ga0466967_0128112 3300045976 Bacteria 2353
206 Ga0495592_0020206 3300046454 Bacteria 5066
207 Ga0495629_0001046 3300046459 Bacteria 22155
208 Ga0495641_0031068 3300046461 Bacteria 2555
209 Ga0495641_0057551 3300046461 Bacteria 1761
210 Ga0495651_0084067 3300046462 Bacteria 2399
211 Ga0495653_0032856 3300046463 Bacteria 4116
212 Ga0495582_0000159 3300046473 Bacteria 36459
213 Ga0495662_0023208 3300046476 Bacteria 2996
214 Ga0495594_0033248 3300046499 Bacteria 2803
215 Ga0495608_0000001 3300046511 Bacteria 411278
216 Ga0495628_0000858 3300046516 Bacteria 28086
217 Ga0495628_0102370 3300046516 Bacteria 2210
218 Ga0495628_0213979 3300046516 Bacteria 1449
219 Ga0495630_0007228 3300046517 Bacteria 7922
220 Ga0495644_0000814 3300046523 Bacteria 12836
221 Ga0495652_0007389 3300046529 Bacteria 10129
222 Ga0495640_0025737 3300046533 Bacteria 4262
223 Ga0495587_0013882 3300046536 Bacteria 5057
224 Ga0495622_0000521 3300046557 Bacteria 23348
225 Ga0495634_0011960 3300046642 Bacteria 6296
226 Ga0495634_0039024 3300046642 Bacteria 3236
227 Ga0495634_0073779 3300046642 Bacteria 2243
228 Ga0495634_0120193 3300046642 Bacteria 1683
229 Ga0495625_0000960 3300046660 Bacteria 38405
230 Ga0495588_0000179 3300046674 Bacteria 77030
231 Ga0495657_0000002 3300046675 Bacteria 411958
232 Ga0495658_0000190 3300046683 Bacteria 35518
233 Ga0495613_0000242 3300046689 Bacteria 51661
234 Ga0495624_0001522 3300046690 Bacteria 17958
235 Ga0495624_0149743 3300046690 Bacteria 1428
236 Ga0495600_0059519 3300046809 Bacteria 2495
237 Ga0495600_0092045 3300046809 Bacteria 1977
238 Ga0495604_0000513 3300047317 Bacteria 34041
239 Ga0495604_0001522 3300047317 Bacteria 19077
240 Ga0495604_0005945 3300047317 Bacteria 9682
241 Ga0495604_0096490 3300047317 Bacteria 2182
242 Ga0495674_0000007 3300047319 Bacteria 336257
243 Ga0495674_0249862 3300047319 Bacteria 1460
244 Ga0495676_0140596 3300047321 Bacteria 1731
245 Ga0495680_0087218 3300047322 Bacteria 2348
246 Ga0495675_0000162 3300047444 Bacteria 47605
247 Ga0495675_0025468 3300047444 Bacteria 3772
248 Ga0495593_0041335 3300047673 Bacteria 2479
249 Ga0495602_0000010 3300048088 Bacteria 212121
250 Ga0495602_0000188 3300048088 Bacteria 58305
251 Ga0495602_0116222 3300048088 Bacteria 2162
252 Ga0496100_0085487 3300048903 Bacteria 2141
253 Ga0496102_0065191 3300048905 Bacteria 3338
254 Ga0496104_0000002 3300048907 Bacteria 686017
255 Ga0496104_0064954 3300048907 Bacteria 3462
256 Ga0496104_0266358 3300048907 Bacteria 1626
257 Ga0496104_0288685 3300048907 Bacteria 1553
258 Ga0496105_0000001 3300048908 Bacteria 1328178
259 Ga0496105_0027534 3300048908 Bacteria 4645
260 Ga0496108_0003182 3300048911 Bacteria 13215
261 Ga0496108_0007744 3300048911 Bacteria 8701
262 Ga0496108_0127139 3300048911 Bacteria 2189
263 Ga0496108_0143463 3300048911 Bacteria 2058
264 Ga0496109_0000035 3300048912 Bacteria 159744
265 Ga0496109_0048806 3300048912 Bacteria 3852
266 Ga0496109_0081915 3300048912 Bacteria 2974
267 Ga0496109_0263011 3300048912 Bacteria 1625
268 Ga0496109_0319946 3300048912 Bacteria 1464
269 Ga0496110_0000476 3300048913 Bacteria 27211
270 Ga0496110_0100457 3300048913 Bacteria 2593
271 Ga0496110_0115920 3300048913 Bacteria 2412
272 Ga0496111_0000022 3300048914 Bacteria 66777
273 Ga0496111_0160623 3300048914 Bacteria 1668
274 Ga0496112_0000002 3300048915 Bacteria 782039
275 Ga0496112_0001898 3300048915 Bacteria 16486
276 Ga0496113_0000093 3300048916 Bacteria 38914
277 Ga0496113_0006741 3300048916 Bacteria 7319
278 Ga0496113_0017271 3300048916 Bacteria 5004
279 Ga0496114_0010670 3300048917 Bacteria 7311
280 Ga0496114_0029627 3300048917 Bacteria 4502
281 Ga0496119_0005514 3300048922 Bacteria 12076
282 Ga0496120_0028792 3300048923 Bacteria 3400
283 Ga0496121_0031897 3300048924 Bacteria 4803
284 Ga0496124_0017478 3300048927 Bacteria 6757
285 Ga0496125_0033667 3300048928 Bacteria 4530
286 Ga0496125_0115861 3300048928 Bacteria 1926
287 Ga0496126_0028027 3300048929 Bacteria 5371
288 Ga0496126_0064007 3300048929 Bacteria 3295
289 Ga0501031_0042323 3300049568 Bacteria 2973
290 Ga0501032_0044811 3300049569 Bacteria 2993
291 Ga0501034_0016642 3300049571 Bacteria 7539
292 Ga0501034_0142121 3300049571 Bacteria 2379
293 Ga0501034_0154861 3300049571 Bacteria 2266
294 Ga0501034_0185019 3300049571 Bacteria 2047
295 Ga0501034_0454047 3300049571 Bacteria 1199
296 Ga0501036_0003223 3300049572 Bacteria 13017
297 Ga0501036_0242723 3300049572 Bacteria 1511
298 Ga0501037_0221587 3300049573 Bacteria 1331
299 Ga0501038_0010469 3300049574 Bacteria 8482
300 Ga0501039_0007528 3300049575 Bacteria 8319
301 Ga0501039_0022470 3300049575 Bacteria 4842
302 Ga0501039_0222774 3300049575 Bacteria 1483
303 Ga0501040_0007349 3300049576 Bacteria 7132
304 Ga0501041_0002616 3300049577 Bacteria 10265
305 Ga0501042_0008596 3300049578 Bacteria 6755
306 Ga0501042_0176149 3300049578 Bacteria 1543
307 Ga0501042_0206955 3300049578 Bacteria 1415
308 Ga0501046_0009990 3300049580 Bacteria 8174
309 Ga0501047_0038816 3300049581 Bacteria 4606
310 Ga0501047_0079139 3300049581 Bacteria 3161
311 Ga0501047_0213945 3300049581 Bacteria 1785
312 Ga0501048_0010588 3300049582 Bacteria 6881
313 Ga0501068_0039768 3300049584 Bacteria 2821
314 Ga0501068_0060299 3300049584 Bacteria 2304
315 Ga0501069_0011420 3300049585 Bacteria 4705
316 Ga0501069_0121784 3300049585 Bacteria 1490
317 Ga0501070_0042144 3300049586 Bacteria 3802
318 Ga0501070_0042924 3300049586 Bacteria 3765
319 Ga0501070_0275368 3300049586 Bacteria 1374
320 Ga0501071_0028264 3300049587 Bacteria 3951
321 Ga0501071_0030191 3300049587 Bacteria 3832
322 Ga0501072_0202357 3300049588 Bacteria 1583
323 Ga0501074_0013046 3300049590 Bacteria 6042
324 Ga0501075_0003985 3300049591 Bacteria 9963
325 Ga0501076_0085028 3300049592 Bacteria 2541
326 Ga0501077_0069194 3300049593 Bacteria 2237
327 Ga0501077_0233615 3300049593 Bacteria 1169
328 Ga0501079_0004009 3300049741 Bacteria 10891
329 Ga0501079_0655804 3300049741 Bacteria 826
330 Ga0501080_0051387 3300049742 Bacteria 3835
331 Ga0501080_0123691 3300049742 Bacteria 2396
332 Ga0501083_0017934 3300049744 Bacteria 4937
333 Ga0501083_0039945 3300049744 Bacteria 3186
334 Ga0501083_0168542 3300049744 Bacteria 1432
335 Ga0501035_0021446 3300049822 Bacteria 5940
336 Ga0501044_0033167 3300049823 Bacteria 5427
337 Ga0501045_0004964 3300049824 Bacteria 9218
338 nmdc:mga00v17_24671_c1 3300050491 Bacteria 3489
339 nmdc:mga06z11_24987_c1 3300050494 Bacteria 2825
340 nmdc:mga04h51_8258_c1 3300050495 Bacteria 2783
341 nmdc:mga05p37_457291_c1 3300050507 Bacteria 1476
342 nmdc:mga06r32_5257_c1 3300050510 Bacteria 11644
343 Ga0495601_0000012 3300053077 Bacteria 227853
344 Ga0495601_0061537 3300053077 Bacteria 2383
345 Ga0495601_0092717 3300053077 Bacteria 1946
346 Ga0495612_0005092 3300053078 Bacteria 5439
347 Ga0495612_0037490 3300053078 Bacteria 1969
348 Ga0495612_0117682 3300053078 Bacteria 1141
349 Ga0495655_0000406 3300053083 Bacteria 7323
350 Ga0495595_0000001 3300053084 Bacteria 495226
351 Ga0495595_0013415 3300053084 Bacteria 3462
352 Ga0495619_0000018 3300053085 Bacteria 209943
353 Ga0495619_0000372 3300053085 Bacteria 30832
354 Ga0495619_0000509 3300053085 Bacteria 25913
355 Ga0495619_0003093 3300053085 Bacteria 10804
356 Ga0495619_0031236 3300053085 Bacteria 3450
357 Ga0501084_0006308 3300054114 Bacteria 9745
358 Ga0501082_0001590 3300060353 Bacteria 20028
359 Ga0501082_0034785 3300060353 Bacteria 4343
360 Ga0530510_0010301 3300061734 Bacteria 6552

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_10008623 Ga0157370_100086233 233
2 3300049578 Ga0501042_0176149 Ga0501042_0176149_472_1380 235
3 3300005981 Ga0081538_10019069 Ga0081538_100190695 237
4 3300006847 Ga0075431_100002381 Ga0075431_10000238111 237
5 3300050510 nmdc:mga06r32_5257_c1 nmdc:mga06r32_5257_c1_3734_4654 237
6 3300038443 Ga0395901_0219823 Ga0395901_0219823_721_1626 239
7 3300009093 Ga0105240_10191264 Ga0105240_101912642 240
8 3300049573 Ga0501037_0221587 Ga0501037_0221587_340_1248 240
9 3300041453 Ga0451797_0408301 Ga0451797_0408301_368_1183 241
10 3300048916 Ga0496113_0017271 Ga0496113_0017271_1462_2373 241
11 3300048929 Ga0496126_0064007 Ga0496126_0064007_1799_2623 241
12 3300009177 Ga0105248_10439878 Ga0105248_104398781 242
13 3300013306 Ga0163162_10300339 Ga0163162_103003392 242
14 3300005564 Ga0070664_100093453 Ga0070664_1000934533 244
15 3300009551 Ga0105238_10055195 Ga0105238_100551952 244
16 3300025901 Ga0207688_10355567 Ga0207688_103555671 244
17 3300025945 Ga0207679_10066463 Ga0207679_100664633 244
18 3300031727 Ga0316576_10007696 Ga0316576_100076963 244
19 3300031728 Ga0316578_10077387 Ga0316578_100773872 244
20 3300035398 Ga0316574_0011525 Ga0316574_0011525_2767_3660 244
21 3300036712 Ga0316584_0154676 Ga0316584_0154676_798_1691 244
22 3300046642 Ga0495634_0011960 Ga0495634_0011960_118_882 245
23 3300048912 Ga0496109_0048806 Ga0496109_0048806_217_1128 248
24 3300006038 Ga0075365_10008776 Ga0075365_100087765 249
25 3300049588 Ga0501072_0202357 Ga0501072_0202357_600_1502 249
26 3300005335 Ga0070666_10007530 Ga0070666_100075302 250
27 3300005548 Ga0070665_100007269 Ga0070665_1000072693 250
28 3300006042 Ga0075368_10008762 Ga0075368_100087624 250
29 3300006178 Ga0075367_10091259 Ga0075367_100912592 250
30 3300027866 Ga0209813_10001549 Ga0209813_100015494 250
31 3300028379 Ga0268266_10000664 Ga0268266_100006643 250
32 3300048927 Ga0496124_0017478 Ga0496124_0017478_3470_4321 250
33 3300048928 Ga0496125_0115861 Ga0496125_0115861_903_1754 250
34 3300050495 nmdc:mga04h51_8258_c1 nmdc:mga04h51_8258_c1_1722_2627 250
35 3300006178 Ga0075367_10112450 Ga0075367_101124502 251
36 3300048923 Ga0496120_0028792 Ga0496120_0028792_2534_3388 251
37 3300050494 nmdc:mga06z11_24987_c1 nmdc:mga06z11_24987_c1_204_1115 251
38 3300005338 Ga0068868_100336833 Ga0068868_1003368332 252
39 3300005543 Ga0070672_100317992 Ga0070672_1003179922 252
40 3300005564 Ga0070664_100742423 Ga0070664_1007424231 252
41 3300009098 Ga0105245_10099474 Ga0105245_100994742 252
42 3300009148 Ga0105243_10160368 Ga0105243_101603682 252
43 3300014325 Ga0163163_10121871 Ga0163163_101218712 252
44 3300017792 Ga0163161_10004640 Ga0163161_100046403 252
45 3300041459 Ga0451800_0606121 Ga0451800_0606121_190_1050 252
46 3300041494 Ga0451837_1643552 Ga0451837_1643552_512_1426 252
47 3300046459 Ga0495629_0001046 Ga0495629_0001046_17461_18312 252
48 3300048911 Ga0496108_0127139 Ga0496108_0127139_77_925 252
49 3300048911 Ga0496108_0007744 Ga0496108_0007744_3850_4701 253
50 3300048912 Ga0496109_0000035 Ga0496109_0000035_113661_114512 253
51 3300049575 Ga0501039_0022470 Ga0501039_0022470_2852_3760 254
52 3300032137 Ga0316585_10014238 Ga0316585_100142382 255
53 3300036712 Ga0316584_0000676 Ga0316584_0000676_7041_7952 255
54 3300006163 Ga0070715_10000003 Ga0070715_1000000321 256
55 3300025905 Ga0207685_10000003 Ga0207685_1000000321 256
56 3300046674 Ga0495588_0000179 Ga0495588_0000179_12861_13712 257
57 3300005441 Ga0070700_100000019 Ga0070700_10000001945 258
58 3300026075 Ga0207708_10000038 Ga0207708_1000003845 258
59 3300049585 Ga0501069_0121784 Ga0501069_0121784_586_1446 258
60 3300047444 Ga0495675_0025468 Ga0495675_0025468_988_1836 259
61 3300006051 Ga0075364_10014893 Ga0075364_100148935 260
62 3300046461 Ga0495641_0031068 Ga0495641_0031068_1083_1973 260
63 3300006051 Ga0075364_10005779 Ga0075364_100057793 261
64 3300009553 Ga0105249_10073501 Ga0105249_100735013 261
65 3300013104 Ga0157370_10032556 Ga0157370_100325562 261
66 3300025961 Ga0207712_10341132 Ga0207712_103411321 261
67 3300046809 Ga0495600_0092045 Ga0495600_0092045_186_1034 261
68 3300047317 Ga0495604_0001522 Ga0495604_0001522_4730_5581 261
69 3300049571 Ga0501034_0454047 Ga0501034_0454047_15_935 261
70 3300049741 Ga0501079_0655804 Ga0501079_0655804_17_814 261
71 3300050491 nmdc:mga00v17_24671_c1 nmdc:mga00v17_24671_c1_925_1809 261
72 3300047317 Ga0495604_0005945 Ga0495604_0005945_683_1531 262
73 3300048088 Ga0495602_0000010 Ga0495602_0000010_198401_199249 262
74 3300053084 Ga0495595_0013415 Ga0495595_0013415_1795_2643 262
75 3300005329 Ga0070683_100049975 Ga0070683_1000499752 263
76 3300005843 Ga0068860_100000403 Ga0068860_10000040354 263
77 3300025944 Ga0207661_10133772 Ga0207661_101337722 263
78 3300028381 Ga0268264_10000355 Ga0268264_100003558 263
79 3300046463 Ga0495653_0032856 Ga0495653_0032856_741_1601 263
80 3300046642 Ga0495634_0073779 Ga0495634_0073779_1129_1986 264
81 3300048912 Ga0496109_0319946 Ga0496109_0319946_194_1051 264
82 3300049571 Ga0501034_0016642 Ga0501034_0016642_962_1816 264
83 3300049571 Ga0501034_0154861 Ga0501034_0154861_213_1067 264
84 3300049744 Ga0501083_0168542 Ga0501083_0168542_179_1033 264
85 3300050507 nmdc:mga05p37_457291_c1 nmdc:mga05p37_457291_c1_350_1219 264
86 3300060353 Ga0501082_0001590 Ga0501082_0001590_1588_2442 264
87 3300005337 Ga0070682_100000815 Ga0070682_10000081519 265
88 3300005578 Ga0068854_100000115 Ga0068854_10000011559 265
89 3300009098 Ga0105245_10002031 Ga0105245_100020318 265
90 3300010375 Ga0105239_10042952 Ga0105239_100429523 265
91 3300013307 Ga0157372_10000616 Ga0157372_1000061628 265
92 3300014325 Ga0163163_10607286 Ga0163163_106072862 265
93 3300025927 Ga0207687_10000350 Ga0207687_100003507 265
94 3300025981 Ga0207640_10000059 Ga0207640_1000005931 265
95 3300037418 Ga0395900_0054381 Ga0395900_0054381_69_932 265
96 3300037466 Ga0395898_0043648 Ga0395898_0043648_2126_2989 265
97 3300037471 Ga0395905_0134218 Ga0395905_0134218_1419_2282 265
98 3300038443 Ga0395901_0015912 Ga0395901_0015912_2137_3000 265
99 3300041453 Ga0451797_0144488 Ga0451797_0144488_74_991 265
100 3300041997 Ga0439431_0004919 Ga0439431_0004919_1823_2713 265
101 3300042004 Ga0439445_0007867 Ga0439445_0007867_1342_2232 265
102 3300042156 Ga0439446_0002277 Ga0439446_0002277_1220_2122 265
103 3300042435 Ga0439434_0016292 Ga0439434_0016292_1160_2050 265
104 3300046476 Ga0495662_0023208 Ga0495662_0023208_1823_2680 265
105 3300046660 Ga0495625_0000960 Ga0495625_0000960_6769_7671 265
106 3300053085 Ga0495619_0000018 Ga0495619_0000018_137504_138361 265
107 3300005339 Ga0070660_100009526 Ga0070660_1000095265 266
108 3300005366 Ga0070659_100216793 Ga0070659_1002167932 266
109 3300005563 Ga0068855_100172118 Ga0068855_1001721182 266
110 3300025904 Ga0207647_10052011 Ga0207647_100520113 266
111 3300025909 Ga0207705_10197252 Ga0207705_101972522 266
112 3300025919 Ga0207657_10016663 Ga0207657_100166633 266
113 3300032002 Ga0307416_100588074 Ga0307416_1005880742 266
114 3300032126 Ga0307415_100012246 Ga0307415_1000122462 266
115 3300041509 Ga0451843_0551206 Ga0451843_0551206_787_1701 266
116 3300005329 Ga0070683_100013435 Ga0070683_1000134354 267
117 3300005981 Ga0081538_10005717 Ga0081538_100057173 267
118 3300025944 Ga0207661_10000142 Ga0207661_1000014250 267
119 3300031903 Ga0307407_10362218 Ga0307407_103622182 267
120 3300031995 Ga0307409_100032138 Ga0307409_1000321383 267
121 3300032005 Ga0307411_10072427 Ga0307411_100724272 267
122 3300032126 Ga0307415_100160617 Ga0307415_1001606172 267
123 3300044842 Ga0466957_0336399 Ga0466957_0336399_178_993 267
124 3300046809 Ga0495600_0059519 Ga0495600_0059519_921_1781 267
125 3300047673 Ga0495593_0041335 Ga0495593_0041335_915_1775 267
126 3300048915 Ga0496112_0000002 Ga0496112_0000002_474300_475148 267
127 3300049593 Ga0501077_0233615 Ga0501077_0233615_276_1157 267
128 3300025915 Ga0207693_10000859 Ga0207693_1000085918 268
129 3300044842 Ga0466957_0318218 Ga0466957_0318218_25_873 268
130 3300048929 Ga0496126_0028027 Ga0496126_0028027_3326_4192 268
131 3300005841 Ga0068863_100015526 Ga0068863_1000155262 269
132 3300005843 Ga0068860_100617716 Ga0068860_1006177162 269
133 3300009101 Ga0105247_10054052 Ga0105247_100540522 269
134 3300009176 Ga0105242_10002427 Ga0105242_100024278 269
135 3300014325 Ga0163163_10460188 Ga0163163_104601882 269
136 3300025934 Ga0207686_10001457 Ga0207686_100014578 269
137 3300026035 Ga0207703_10124796 Ga0207703_101247962 269
138 3300026088 Ga0207641_10078349 Ga0207641_100783493 269
139 3300028381 Ga0268264_10550242 Ga0268264_105502422 269
140 3300031903 Ga0307407_10180817 Ga0307407_101808171 269
141 3300031995 Ga0307409_100197942 Ga0307409_1001979422 269
142 3300035172 Ga0373955_0117856 Ga0373955_0117856_650_1510 269
143 3300036401 Ga0373937_0468581 Ga0373937_0468581_106_966 269
144 3300047317 Ga0495604_0096490 Ga0495604_0096490_1051_1911 269
145 3300048917 Ga0496114_0029627 Ga0496114_0029627_3361_4278 269
146 3300053085 Ga0495619_0031236 Ga0495619_0031236_1256_2116 269
147 3300005834 Ga0068851_10002118 Ga0068851_100021185 270
148 3300006237 Ga0097621_100561193 Ga0097621_1005611931 270
149 3300006358 Ga0068871_100017232 Ga0068871_1000172325 270
150 3300025321 Ga0207656_10000354 Ga0207656_100003542 270
151 3300025900 Ga0207710_10039663 Ga0207710_100396632 270
152 3300044694 Ga0466963_0244267 Ga0466963_0244267_318_1178 270
153 3300045976 Ga0466967_0082886 Ga0466967_0082886_88_948 270
154 3300047317 Ga0495604_0000513 Ga0495604_0000513_22615_23472 270
155 3300048907 Ga0496104_0000002 Ga0496104_0000002_171957_172811 270
156 3300048908 Ga0496105_0000001 Ga0496105_0000001_1155368_1156222 270
157 3300048913 Ga0496110_0000476 Ga0496110_0000476_3870_4727 270
158 3300048914 Ga0496111_0000022 Ga0496111_0000022_670_1527 270
159 3300049571 Ga0501034_0142121 Ga0501034_0142121_597_1451 270
160 3300053078 Ga0495612_0117682 Ga0495612_0117682_59_916 270
161 3300005365 Ga0070688_100057270 Ga0070688_1000572702 271
162 3300005435 Ga0070714_100109615 Ga0070714_1001096152 271
163 3300005459 Ga0068867_100000239 Ga0068867_10000023922 271
164 3300005614 Ga0068856_100000057 Ga0068856_10000005769 271
165 3300013102 Ga0157371_10023682 Ga0157371_100236822 271
166 3300022467 Ga0224712_10003493 Ga0224712_100034933 271
167 3300025929 Ga0207664_10027335 Ga0207664_100273352 271
168 3300026078 Ga0207702_10000027 Ga0207702_1000002778 271
169 3300046516 Ga0495628_0000858 Ga0495628_0000858_16282_17139 271
170 3300047319 Ga0495674_0249862 Ga0495674_0249862_575_1435 271
171 3300048088 Ga0495602_0000188 Ga0495602_0000188_42662_43519 271
172 3300048911 Ga0496108_0003182 Ga0496108_0003182_4077_4946 271
173 3300048912 Ga0496109_0263011 Ga0496109_0263011_533_1402 271
174 3300048915 Ga0496112_0001898 Ga0496112_0001898_10925_11782 271
175 3300048916 Ga0496113_0000093 Ga0496113_0000093_10858_11715 271
176 3300048916 Ga0496113_0006741 Ga0496113_0006741_2521_3390 271
177 3300053077 Ga0495601_0061537 Ga0495601_0061537_223_1080 271
178 3300053078 Ga0495612_0005092 Ga0495612_0005092_1992_2852 271
179 3300053083 Ga0495655_0000406 Ga0495655_0000406_1247_2104 271
180 3300021388 Ga0213875_10034838 Ga0213875_100348382 272
181 3300037853 Ga0436364_1431654 Ga0436364_1431654_1384_2307 272
182 3300041491 Ga0451833_0469571 Ga0451833_0469571_5181_6074 272
183 3300041496 Ga0451839_0458089 Ga0451839_0458089_42_935 272
184 3300049575 Ga0501039_0222774 Ga0501039_0222774_28_933 272
185 3300049578 Ga0501042_0206955 Ga0501042_0206955_312_1217 272
186 3300031995 Ga0307409_100096124 Ga0307409_1000961242 273
187 3300032002 Ga0307416_100052520 Ga0307416_1000525203 273
188 3300045976 Ga0466967_0000008 Ga0466967_0000008_55652_56500 273
189 3300053085 Ga0495619_0000372 Ga0495619_0000372_11267_12127 273
190 3300038443 Ga0395901_0213618 Ga0395901_0213618_62_946 274
191 3300045976 Ga0466967_0128112 Ga0466967_0128112_1344_2204 274
192 3300010375 Ga0105239_10676154 Ga0105239_106761541 275
193 3300013306 Ga0163162_10433658 Ga0163162_104336582 275
194 3300037466 Ga0395898_0163797 Ga0395898_0163797_343_1242 275
195 3300046461 Ga0495641_0057551 Ga0495641_0057551_324_1181 275
196 3300048903 Ga0496100_0085487 Ga0496100_0085487_615_1466 275
197 3300048905 Ga0496102_0065191 Ga0496102_0065191_1388_2305 275
198 3300048917 Ga0496114_0010670 Ga0496114_0010670_6092_7009 275
199 3300003373 JGI25407J50210_10002447 JGI25407J50210_100024474 276
200 3300005981 Ga0081538_10000907 Ga0081538_100009075 276
201 3300035724 Ga0373933_0366763 Ga0373933_0366763_22_882 277
202 3300036401 Ga0373937_0133971 Ga0373937_0133971_564_1421 277
203 3300046516 Ga0495628_0102370 Ga0495628_0102370_656_1507 277
204 3300046516 Ga0495628_0213979 Ga0495628_0213979_391_1248 277
205 3300046517 Ga0495630_0007228 Ga0495630_0007228_5247_6104 277
206 3300046557 Ga0495622_0000521 Ga0495622_0000521_21153_22001 277
207 3300046642 Ga0495634_0039024 Ga0495634_0039024_687_1544 277
208 3300046642 Ga0495634_0120193 Ga0495634_0120193_349_1200 277
209 3300047322 Ga0495680_0087218 Ga0495680_0087218_67_924 277
210 3300048913 Ga0496110_0115920 Ga0496110_0115920_29_880 277
211 3300049568 Ga0501031_0042323 Ga0501031_0042323_388_1305 277
212 3300049569 Ga0501032_0044811 Ga0501032_0044811_210_1127 277
213 3300049572 Ga0501036_0003223 Ga0501036_0003223_4265_5182 277
214 3300049574 Ga0501038_0010469 Ga0501038_0010469_3379_4296 277
215 3300049575 Ga0501039_0007528 Ga0501039_0007528_5996_6913 277
216 3300049576 Ga0501040_0007349 Ga0501040_0007349_94_1011 277
217 3300049577 Ga0501041_0002616 Ga0501041_0002616_6905_7822 277
218 3300049578 Ga0501042_0008596 Ga0501042_0008596_3160_4077 277
219 3300049580 Ga0501046_0009990 Ga0501046_0009990_3350_4267 277
220 3300049582 Ga0501048_0010588 Ga0501048_0010588_1561_2478 277
221 3300049584 Ga0501068_0060299 Ga0501068_0060299_1102_2019 277
222 3300049586 Ga0501070_0275368 Ga0501070_0275368_155_1072 277
223 3300049587 Ga0501071_0030191 Ga0501071_0030191_213_1130 277
224 3300049590 Ga0501074_0013046 Ga0501074_0013046_1113_2030 277
225 3300049591 Ga0501075_0003985 Ga0501075_0003985_1496_2413 277
226 3300049592 Ga0501076_0085028 Ga0501076_0085028_38_955 277
227 3300049593 Ga0501077_0069194 Ga0501077_0069194_166_1083 277
228 3300049741 Ga0501079_0004009 Ga0501079_0004009_5707_6624 277
229 3300049742 Ga0501080_0123691 Ga0501080_0123691_36_899 277
230 3300049744 Ga0501083_0039945 Ga0501083_0039945_1596_2513 277
231 3300049822 Ga0501035_0021446 Ga0501035_0021446_4472_5389 277
232 3300049824 Ga0501045_0004964 Ga0501045_0004964_6827_7744 277
233 3300053077 Ga0495601_0092717 Ga0495601_0092717_463_1320 277
234 3300053078 Ga0495612_0037490 Ga0495612_0037490_539_1396 277
235 3300053085 Ga0495619_0003093 Ga0495619_0003093_2587_3444 277
236 3300054114 Ga0501084_0006308 Ga0501084_0006308_2707_3624 277
237 3300060353 Ga0501082_0034785 Ga0501082_0034785_1904_2821 277
238 3300061734 Ga0530510_0010301 Ga0530510_0010301_1462_2379 277
239 iso_pu_bacteria 2643221567 2643850736 277
240 iso_pu_bacteria 2643221624 2644134489 277
241 iso_pu_bacteria 3002998708 3003006956 277
242 3300025961 Ga0207712_10226801 Ga0207712_102268012 278
243 3300032002 Ga0307416_100182760 Ga0307416_1001827602 278
244 3300041997 Ga0439431_0027984 Ga0439431_0027984_183_1094 278
245 3300049572 Ga0501036_0242723 Ga0501036_0242723_214_1119 278
246 iso_pu_bacteria 2643221641 2644229368 278
247 iso_pu_bacteria 2739367898 2740168071 278
248 iso_pu_bacteria 8054609563 8054613727 278
249 3300005329 Ga0070683_100043068 Ga0070683_1000430682 279
250 3300005338 Ga0068868_100066958 Ga0068868_1000669583 279
251 3300005365 Ga0070688_100219836 Ga0070688_1002198362 279
252 3300005456 Ga0070678_100105036 Ga0070678_1001050362 279
253 3300005614 Ga0068856_100245477 Ga0068856_1002454772 279
254 3300005617 Ga0068859_100217276 Ga0068859_1002172762 279
255 3300005842 Ga0068858_100149284 Ga0068858_1001492841 279
256 3300005985 Ga0081539_10001100 Ga0081539_1000110019 279
257 3300006931 Ga0097620_100217300 Ga0097620_1002173002 279
258 3300009098 Ga0105245_10112242 Ga0105245_101122422 279
259 3300013307 Ga0157372_10490302 Ga0157372_104903022 279
260 3300013308 Ga0157375_10212104 Ga0157375_102121043 279
261 3300014745 Ga0157377_10111281 Ga0157377_101112811 279
262 3300025945 Ga0207679_10171316 Ga0207679_101713162 279
263 3300026067 Ga0207678_10030237 Ga0207678_100302373 279
264 3300026121 Ga0207683_10063083 Ga0207683_100630832 279
265 3300044658 Ga0466972_0140674 Ga0466972_0140674_143_1045 279
266 3300044693 Ga0466961_0019924 Ga0466961_0019924_2799_3701 279
267 3300044706 Ga0466964_0035766 Ga0466964_0035766_179_1081 279
268 3300044765 Ga0466970_0009838 Ga0466970_0009838_308_1210 279
269 iso_pu_bacteria 2554235227 2555229067 279
270 iso_pu_bacteria 2654587600 2655033549 279
271 3300005367 Ga0070667_100058800 Ga0070667_1000588003 280
272 3300044658 Ga0466972_0196467 Ga0466972_0196467_35_904 281
273 3300044694 Ga0466963_0225634 Ga0466963_0225634_267_1121 281
274 3300044842 Ga0466957_0045134 Ga0466957_0045134_1802_2656 281
275 3300045976 Ga0466967_0097118 Ga0466967_0097118_1405_2271 281
276 3300049581 Ga0501047_0079139 Ga0501047_0079139_2088_2957 281
277 3300005329 Ga0070683_100000481 Ga0070683_1000004815 282
278 3300005329 Ga0070683_100036163 Ga0070683_1000361634 282
279 3300005366 Ga0070659_100020330 Ga0070659_1000203304 282
280 3300005436 Ga0070713_100000076 Ga0070713_10000007647 282
281 3300005535 Ga0070684_100010251 Ga0070684_1000102514 282
282 3300005535 Ga0070684_100038445 Ga0070684_1000384452 282
283 3300013297 Ga0157378_10012517 Ga0157378_100125175 282
284 3300025928 Ga0207700_10000009 Ga0207700_10000009230 282
285 3300025932 Ga0207690_10053222 Ga0207690_100532222 282
286 3300025944 Ga0207661_10000166 Ga0207661_100001665 282
287 3300025944 Ga0207661_10116479 Ga0207661_101164792 282
288 3300046473 Ga0495582_0000159 Ga0495582_0000159_6675_7523 282
289 3300046499 Ga0495594_0033248 Ga0495594_0033248_881_1729 282
290 3300046511 Ga0495608_0000001 Ga0495608_0000001_248043_248891 282
291 3300046533 Ga0495640_0025737 Ga0495640_0025737_2442_3290 282
292 3300046536 Ga0495587_0013882 Ga0495587_0013882_497_1345 282
293 3300046675 Ga0495657_0000002 Ga0495657_0000002_248723_249571 282
294 3300046683 Ga0495658_0000190 Ga0495658_0000190_995_1843 282
295 3300046689 Ga0495613_0000242 Ga0495613_0000242_48949_49797 282
296 3300046690 Ga0495624_0001522 Ga0495624_0001522_5072_5923 282
297 3300047319 Ga0495674_0000007 Ga0495674_0000007_155056_155904 282
298 3300047444 Ga0495675_0000162 Ga0495675_0000162_5421_6269 282
299 3300048907 Ga0496104_0064954 Ga0496104_0064954_331_1179 282
300 3300049586 Ga0501070_0042144 Ga0501070_0042144_2077_2958 282
301 3300053077 Ga0495601_0000012 Ga0495601_0000012_199757_200605 282
302 3300053084 Ga0495595_0000001 Ga0495595_0000001_162388_163236 282
303 3300053085 Ga0495619_0000509 Ga0495619_0000509_5417_6265 282
304 3300005406 Ga0070703_10024422 Ga0070703_100244222 283
305 iso_pu_bacteria 8053945823 8053946785 283
306 3300001979 JGI24740J21852_10002629 JGI24740J21852_100026295 284
307 3300005329 Ga0070683_100074045 Ga0070683_1000740452 284
308 3300005338 Ga0068868_100000008 Ga0068868_1000000086 284
309 3300005347 Ga0070668_100002947 Ga0070668_1000029475 284
310 3300005356 Ga0070674_100361424 Ga0070674_1003614242 284
311 3300005367 Ga0070667_100002992 Ga0070667_1000029923 284
312 3300005444 Ga0070694_100129813 Ga0070694_1001298131 284
313 3300005455 Ga0070663_100002015 Ga0070663_1000020158 284
314 3300005457 Ga0070662_100000039 Ga0070662_10000003950 284
315 3300005459 Ga0068867_100033698 Ga0068867_1000336983 284
316 3300005530 Ga0070679_100014594 Ga0070679_1000145945 284
317 3300005535 Ga0070684_100048629 Ga0070684_1000486293 284
318 3300005547 Ga0070693_100000193 Ga0070693_1000001933 284
319 3300005548 Ga0070665_100054350 Ga0070665_1000543503 284
320 3300005842 Ga0068858_100102921 Ga0068858_1001029212 284
321 3300005843 Ga0068860_100251466 Ga0068860_1002514662 284
322 3300005844 Ga0068862_100000391 Ga0068862_10000039113 284
323 3300009148 Ga0105243_10041288 Ga0105243_100412882 284
324 3300009553 Ga0105249_10000841 Ga0105249_1000084130 284
325 3300010375 Ga0105239_10397857 Ga0105239_103978572 284
326 3300013306 Ga0163162_10239948 Ga0163162_102399482 284
327 3300014968 Ga0157379_10054784 Ga0157379_100547842 284
328 3300020070 Ga0206356_11472949 Ga0206356_114729493 284
329 3300025921 Ga0207652_10001763 Ga0207652_1000176315 284
330 3300025933 Ga0207706_10000026 Ga0207706_1000002630 284
331 3300025937 Ga0207669_10043773 Ga0207669_100437733 284
332 3300025944 Ga0207661_10085372 Ga0207661_100853722 284
333 3300025961 Ga0207712_10008190 Ga0207712_100081903 284
334 3300025972 Ga0207668_10002710 Ga0207668_100027106 284
335 3300025986 Ga0207658_10001012 Ga0207658_100010123 284
336 3300026023 Ga0207677_10000142 Ga0207677_100001425 284
337 3300026067 Ga0207678_10005805 Ga0207678_100058052 284
338 3300026078 Ga0207702_10004385 Ga0207702_100043855 284
339 3300026089 Ga0207648_10041940 Ga0207648_100419402 284
340 3300028379 Ga0268266_10032922 Ga0268266_100329222 284
341 3300028380 Ga0268265_10000440 Ga0268265_1000044034 284
342 3300028381 Ga0268264_10080875 Ga0268264_100808753 284
343 3300046454 Ga0495592_0020206 Ga0495592_0020206_3961_4818 284
344 3300046462 Ga0495651_0084067 Ga0495651_0084067_777_1634 284
345 3300046523 Ga0495644_0000814 Ga0495644_0000814_5244_6110 284
346 3300046529 Ga0495652_0007389 Ga0495652_0007389_6857_7714 284
347 3300046690 Ga0495624_0149743 Ga0495624_0149743_283_1140 284
348 3300047321 Ga0495676_0140596 Ga0495676_0140596_853_1710 284
349 3300048088 Ga0495602_0116222 Ga0495602_0116222_1185_2042 284
350 3300048907 Ga0496104_0266358 Ga0496104_0266358_30_890 284
351 3300048907 Ga0496104_0288685 Ga0496104_0288685_451_1308 284
352 3300048908 Ga0496105_0027534 Ga0496105_0027534_1992_2852 284
353 3300048911 Ga0496108_0143463 Ga0496108_0143463_1065_2003 284
354 3300048912 Ga0496109_0081915 Ga0496109_0081915_2056_2943 284
355 3300048913 Ga0496110_0100457 Ga0496110_0100457_968_1855 284
356 3300048914 Ga0496111_0160623 Ga0496111_0160623_727_1653 284
357 3300048922 Ga0496119_0005514 Ga0496119_0005514_7414_8274 284
358 3300048924 Ga0496121_0031897 Ga0496121_0031897_28_888 284
359 3300048928 Ga0496125_0033667 Ga0496125_0033667_1072_1932 284
360 3300049571 Ga0501034_0185019 Ga0501034_0185019_558_1415 284
361 3300049581 Ga0501047_0038816 Ga0501047_0038816_1210_2067 284
362 3300049581 Ga0501047_0213945 Ga0501047_0213945_302_1159 284
363 3300049584 Ga0501068_0039768 Ga0501068_0039768_1761_2618 284
364 3300049585 Ga0501069_0011420 Ga0501069_0011420_3546_4403 284
365 3300049586 Ga0501070_0042924 Ga0501070_0042924_2154_3011 284
366 3300049587 Ga0501071_0028264 Ga0501071_0028264_1063_1920 284
367 3300049742 Ga0501080_0051387 Ga0501080_0051387_1065_1922 284
368 3300049744 Ga0501083_0017934 Ga0501083_0017934_3340_4197 284
369 3300049823 Ga0501044_0033167 Ga0501044_0033167_991_1848 284

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

104

300

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.8631 1 274
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.8589 1 274
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.8553 5 270
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.8443 5 274
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.8399 5 270
ID Description Score Start End Superfamily
af_P0AFK4_1_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9102 15 273 1.10.3720.10
af_P71745_27_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8826 14 277 1.10.3720.10
af_P31135_29_312_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8806 10 275 1.10.3720.10
af_P71746_10_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8796 14 277 1.10.3720.10
af_P77156_29_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8761 10 273 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A538GNX0-F1-model_v4 ABC transporter permease 0.9811 18 267 GO:0005886
GO:0055085
AF-A0A6J4MWX8-F1-model_v4 Putrescine transport system permease protein PotH 0.9759 9 278 GO:0005886
GO:0055085
AF-A0A6J7GI68-F1-model_v4 Unannotated protein 0.9732 1 279 GO:0005886
GO:0055085
AF-E6SEB2-F1-model_v4 Binding-protein-dependent transport systems inner membrane component 0.9729 7 278 GO:0005886
GO:0055085
AF-A0A538F0X3-F1-model_v4 ABC transporter permease 0.9703 18 280 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
87.73 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map