F424996

General Info

Members Datasets Scaffolds Average Seq Length
369 197 738 298

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100068167|Ga0075431_1000681674
Length 301
Sequence MERMKASDFPQELLDEFHLYVHGDIDRRSFIDRCGKYTVGGLTAVGVFEALAPNYAWAQQIAKDDKRIKTEYATVQSPQGNGSIKGYLVRPANASATAKVPVVLVVHENRGLNPYIEDVARRVGTENFMAFAPDGLTSVGGYPGNDEQGGALFGKVDRPKMTEDFVAAATWLKARPESTGKLGVVGFCFGGGISNTLAVRMGADLSAAVPFYGGAPQAADVPKIKAAVLAHHGELDKALAAGWPAYDEALKAANVPHEGYIYPNANHGFHNDTTPRYDEAAAKQAWGRTVAWFNKYLRTTS

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
116 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
117 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
120 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
121 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
194 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.98
Rhizosphere 96.48
Stem 0
Stem Tuber 0
Unclassified 3.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100068167 3300006847 Bacteria 3672
2 JGI25405J52794_10001578 3300003911 Bacteria 3781
3 Ga0058860_12080923 3300004801 Bacteria 1122
4 Ga0070658_10000976 3300005327 Bacteria 24552
5 Ga0070658_10195189 3300005327 Bacteria 1707
6 Ga0068869_100144799 3300005334 Bacteria 1838
7 Ga0070666_10158085 3300005335 Bacteria 1583
8 Ga0070680_100275012 3300005336 Bacteria 1426
9 Ga0068868_100260775 3300005338 Bacteria 1461
10 Ga0068868_100272944 3300005338 Bacteria 1429
11 Ga0068868_100296203 3300005338 Bacteria 1373
12 Ga0070660_100091870 3300005339 Bacteria 2395
13 Ga0070689_100308547 3300005340 Bacteria 1319
14 Ga0070671_100049133 3300005355 Bacteria 3510
15 Ga0070674_100162624 3300005356 Bacteria 1695
16 Ga0070673_100051700 3300005364 Bacteria 3220
17 Ga0070713_100003463 3300005436 Bacteria 10422
18 Ga0070713_100182780 3300005436 Unclassified 1885
19 Ga0070705_100004237 3300005440 Bacteria 6999
20 Ga0070694_100042481 3300005444 Bacteria 3037
21 Ga0070678_100054188 3300005456 Bacteria 2921
22 Ga0070678_100238170 3300005456 Bacteria 1520
23 Ga0070681_10102220 3300005458 Bacteria 2811
24 Ga0070681_10178694 3300005458 Bacteria 2044
25 Ga0070681_10207341 3300005458 Bacteria 1877
26 Ga0070685_10381054 3300005466 Bacteria 972
27 Ga0070706_100048022 3300005467 Bacteria 3940
28 Ga0070698_100017948 3300005471 Bacteria 7451
29 Ga0070698_100555303 3300005471 Bacteria 1088
30 Ga0070699_100004202 3300005518 Bacteria 12740
31 Ga0070679_100429710 3300005530 Bacteria 1266
32 Ga0070684_100296871 3300005535 Bacteria 1482
33 Ga0070684_100317325 3300005535 Bacteria 1431
34 Ga0068853_100106432 3300005539 Bacteria 2486
35 Ga0070696_100000606 3300005546 Bacteria 23003
36 Ga0070665_100042313 3300005548 Bacteria 4578
37 Ga0070665_100102956 3300005548 Bacteria 2859
38 Ga0068855_100004820 3300005563 Bacteria 16473
39 Ga0068855_100004890 3300005563 Bacteria 16358
40 Ga0068855_100005019 3300005563 Bacteria 16158
41 Ga0068855_100005914 3300005563 Bacteria 14915
42 Ga0068855_100020882 3300005563 Bacteria 7854
43 Ga0068855_100473756 3300005563 Bacteria 1363
44 Ga0068857_100005169 3300005577 Bacteria 11097
45 Ga0068857_100008144 3300005577 Bacteria 9050
46 Ga0068856_100038535 3300005614 Bacteria 4692
47 Ga0068856_100040646 3300005614 Bacteria 4569
48 Ga0068856_100073792 3300005614 Bacteria 3378
49 Ga0068856_100074112 3300005614 Bacteria 3370
50 Ga0068852_100011503 3300005616 Bacteria 6663
51 Ga0068864_100001652 3300005618 Bacteria 18367
52 Ga0068864_100337130 3300005618 Bacteria 1420
53 Ga0068863_100023635 3300005841 Bacteria 5868
54 Ga0068863_100024819 3300005841 Bacteria 5718
55 Ga0068863_100072642 3300005841 Bacteria 3255
56 Ga0068863_100078428 3300005841 Bacteria 3128
57 Ga0068858_100001891 3300005842 Bacteria 21380
58 Ga0068858_100008368 3300005842 Bacteria 9950
59 Ga0068858_100444409 3300005842 Bacteria 1249
60 Ga0068860_100027066 3300005843 Bacteria 5525
61 Ga0068860_100048113 3300005843 Bacteria 4065
62 Ga0068860_100300690 3300005843 Bacteria 1572
63 Ga0068860_100461734 3300005843 Bacteria 1264
64 Ga0081455_10003892 3300005937 Bacteria 17003
65 Ga0081538_10009213 3300005981 Bacteria 8271
66 Ga0081540_1018036 3300005983 Bacteria 4345
67 Ga0081539_10070995 3300005985 Bacteria 1867
68 Ga0070717_10034728 3300006028 Bacteria 4078
69 Ga0097621_100004088 3300006237 Bacteria 10118
70 Ga0097621_100020497 3300006237 Bacteria 5094
71 Ga0097621_100056905 3300006237 Bacteria 3195
72 Ga0097621_100086626 3300006237 Bacteria 2614
73 Ga0068871_100005925 3300006358 Bacteria 8602
74 Ga0068871_100024400 3300006358 Bacteria 4689
75 Ga0075428_100006222 3300006844 Bacteria 13277
76 Ga0075428_100041345 3300006844 Bacteria 5070
77 Ga0075430_100124330 3300006846 Bacteria 2150
78 Ga0075430_100173902 3300006846 Bacteria 1792
79 Ga0075431_100098515 3300006847 Bacteria 3018
80 Ga0075429_100183732 3300006880 Bacteria 1832
81 Ga0068865_100246753 3300006881 Bacteria 1407
82 Ga0097620_100196127 3300006931 Bacteria 2104
83 Ga0105240_10003098 3300009093 Bacteria 26153
84 Ga0105240_10005869 3300009093 Bacteria 18195
85 Ga0105240_10020600 3300009093 Bacteria 8790
86 Ga0105240_10026130 3300009093 Bacteria 7662
87 Ga0105240_10355776 3300009093 Bacteria 1660
88 Ga0111539_10002576 3300009094 Bacteria 24001
89 Ga0111539_10610060 3300009094 Unclassified 1271
90 Ga0105245_10034640 3300009098 Bacteria 4479
91 Ga0105247_10038179 3300009101 Bacteria 2930
92 Ga0114129_10002893 3300009147 Bacteria 24016
93 Ga0114129_10100582 3300009147 Bacteria 4001
94 Ga0114129_10153229 3300009147 Bacteria 3154
95 Ga0114129_10231976 3300009147 Bacteria 2486
96 Ga0114129_10357492 3300009147 Bacteria 1933
97 Ga0114129_10413407 3300009147 Bacteria 1776
98 Ga0105243_10758411 3300009148 Bacteria 952
99 Ga0105241_10001195 3300009174 Bacteria 19861
100 Ga0105242_10010742 3300009176 Bacteria 7030
101 Ga0105242_10050523 3300009176 Bacteria 3386
102 Ga0105248_10023636 3300009177 Bacteria 6829
103 Ga0105248_10027152 3300009177 Bacteria 6369
104 Ga0105248_10072411 3300009177 Bacteria 3873
105 Ga0105248_10352623 3300009177 Bacteria 1657
106 Ga0105237_10009252 3300009545 Bacteria 10562
107 Ga0105238_10011289 3300009551 Bacteria 8988
108 Ga0105249_10185146 3300009553 Bacteria 2029
109 Ga0105239_10011103 3300010375 Bacteria 10052
110 Ga0105239_10027229 3300010375 Bacteria 6293
111 Ga0105239_10038977 3300010375 Bacteria 5205
112 Ga0105239_10041510 3300010375 Bacteria 5042
113 Ga0105239_10945987 3300010375 Bacteria 989
114 Ga0157370_10002747 3300013104 Bacteria 21033
115 Ga0157370_10086222 3300013104 Bacteria 2950
116 Ga0157369_10000921 3300013105 Bacteria 37496
117 Ga0157369_10523534 3300013105 Bacteria 1226
118 Ga0157374_10033066 3300013296 Bacteria 4716
119 Ga0157374_10387088 3300013296 Bacteria 1393
120 Ga0157378_10007387 3300013297 Bacteria 9598
121 Ga0157378_10038148 3300013297 Unclassified 4257
122 Ga0157378_10055523 3300013297 Bacteria 3529
123 Ga0163162_10016513 3300013306 Bacteria 7214
124 Ga0163162_10019300 3300013306 Bacteria 6684
125 Ga0163162_10184278 3300013306 Bacteria 2214
126 Ga0163162_10350380 3300013306 Bacteria 1609
127 Ga0157372_10018936 3300013307 Bacteria 7409
128 Ga0157372_10128374 3300013307 Bacteria 2916
129 Ga0157375_10012756 3300013308 Bacteria 7461
130 Ga0157375_10155836 3300013308 Bacteria 2423
131 Ga0157375_10160173 3300013308 Bacteria 2392
132 Ga0157375_10943936 3300013308 Bacteria 1005
133 Ga0163163_10018775 3300014325 Bacteria 6482
134 Ga0163163_10023988 3300014325 Bacteria 5802
135 Ga0163163_10037528 3300014325 Bacteria 4715
136 Ga0163163_10041968 3300014325 Bacteria 4477
137 Ga0163163_10402834 3300014325 Bacteria 1426
138 Ga0163163_10440049 3300014325 Bacteria 1363
139 Ga0157379_10009566 3300014968 Bacteria 8441
140 Ga0157379_10021217 3300014968 Bacteria 5748
141 Ga0157379_10071452 3300014968 Bacteria 3104
142 Ga0157376_10006108 3300014969 Bacteria 8477
143 Ga0157376_10072883 3300014969 Bacteria 2923
144 Ga0157376_10268147 3300014969 Bacteria 1602
145 Ga0157376_10402855 3300014969 Bacteria 1323
146 Ga0157376_10590991 3300014969 Bacteria 1104
147 Ga0197907_10957548 3300020069 Bacteria 1344
148 Ga0206349_1673008 3300020075 Bacteria 1114
149 Ga0207642_10283458 3300025899 Bacteria 954
150 Ga0207710_10071056 3300025900 Bacteria 1596
151 Ga0207680_10023833 3300025903 Bacteria 3349
152 Ga0207680_10307027 3300025903 Bacteria 1107
153 Ga0207699_10150807 3300025906 Bacteria 1538
154 Ga0207645_10068775 3300025907 Bacteria 2265
155 Ga0207705_10008885 3300025909 Bacteria 7322
156 Ga0207705_10156567 3300025909 Bacteria 1710
157 Ga0207684_10005225 3300025910 Bacteria 12063
158 Ga0207654_10009473 3300025911 Bacteria 4947
159 Ga0207707_10063009 3300025912 Bacteria 3227
160 Ga0207707_10269198 3300025912 Bacteria 1477
161 Ga0207695_10001508 3300025913 Bacteria 38700
162 Ga0207695_10012992 3300025913 Bacteria 9948
163 Ga0207695_10015332 3300025913 Bacteria 9027
164 Ga0207695_10024586 3300025913 Bacteria 6770
165 Ga0207695_10099255 3300025913 Bacteria 2910
166 Ga0207695_10273731 3300025913 Bacteria 1583
167 Ga0207671_10018402 3300025914 Bacteria 5361
168 Ga0207660_10060712 3300025917 Bacteria 2719
169 Ga0207660_10254701 3300025917 Bacteria 1386
170 Ga0207657_10222918 3300025919 Bacteria 1510
171 Ga0207649_10146267 3300025920 Bacteria 1623
172 Ga0207652_10163866 3300025921 Bacteria 1993
173 Ga0207694_10034967 3300025924 Bacteria 3853
174 Ga0207694_10037762 3300025924 Bacteria 3712
175 Ga0207659_10066014 3300025926 Bacteria 2624
176 Ga0207659_10400420 3300025926 Bacteria 1148
177 Ga0207687_10011260 3300025927 Bacteria 5843
178 Ga0207687_10084374 3300025927 Bacteria 2302
179 Ga0207687_10190835 3300025927 Bacteria 1595
180 Ga0207687_10430616 3300025927 Bacteria 1090
181 Ga0207664_10047242 3300025929 Bacteria 3381
182 Ga0207644_10034517 3300025931 Bacteria 3540
183 Ga0207686_10003776 3300025934 Bacteria 8127
184 Ga0207686_10006155 3300025934 Bacteria 6448
185 Ga0207686_10030321 3300025934 Bacteria 3200
186 Ga0207686_10035865 3300025934 Bacteria 2980
187 Ga0207686_10372783 3300025934 Bacteria 1080
188 Ga0207669_10190823 3300025937 Bacteria 1478
189 Ga0207704_10008848 3300025938 Bacteria 4834
190 Ga0207665_10052840 3300025939 Bacteria 2738
191 Ga0207665_10326018 3300025939 Bacteria 1153
192 Ga0207711_10017251 3300025941 Bacteria 6000
193 Ga0207711_10145340 3300025941 Bacteria 2136
194 Ga0207711_10291144 3300025941 Bacteria 1505
195 Ga0207661_10057273 3300025944 Bacteria 3133
196 Ga0207661_10468343 3300025944 Bacteria 1149
197 Ga0207667_10001420 3300025949 Bacteria 29988
198 Ga0207667_10002810 3300025949 Bacteria 21575
199 Ga0207667_10110536 3300025949 Unclassified 2835
200 Ga0207667_10262228 3300025949 Bacteria 1767
201 Ga0207667_10347890 3300025949 Bacteria 1512
202 Ga0207651_10035764 3300025960 Bacteria 3234
203 Ga0207651_10048981 3300025960 Bacteria 2860
204 Ga0207712_10225669 3300025961 Bacteria 1500
205 Ga0207677_10154738 3300026023 Bacteria 1774
206 Ga0207677_10371166 3300026023 Bacteria 1205
207 Ga0207703_10010123 3300026035 Bacteria 7390
208 Ga0207703_10021005 3300026035 Bacteria 5108
209 Ga0207703_10425057 3300026035 Bacteria 1237
210 Ga0207702_10085578 3300026078 Bacteria 2747
211 Ga0207702_10545115 3300026078 Bacteria 1134
212 Ga0207641_10017787 3300026088 Bacteria 5824
213 Ga0207641_10060545 3300026088 Bacteria 3227
214 Ga0207648_10090036 3300026089 Bacteria 2680
215 Ga0207676_10141696 3300026095 Bacteria 2059
216 Ga0207674_10004534 3300026116 Bacteria 16682
217 Ga0207674_10022535 3300026116 Bacteria 6761
218 Ga0207674_10304338 3300026116 Bacteria 1543
219 Ga0207683_10085873 3300026121 Bacteria 2797
220 Ga0207683_10252573 3300026121 Bacteria 1609
221 Ga0207428_10038841 3300027907 Bacteria 3867
222 Ga0207428_10138375 3300027907 Bacteria 1860
223 Ga0268266_10124073 3300028379 Bacteria 2302
224 Ga0268265_10323255 3300028380 Bacteria 1398
225 Ga0268264_10004150 3300028381 Bacteria 12394
226 Ga0265338_10004716 3300028800 Bacteria 18249
227 Ga0265325_10015622 3300031241 Bacteria 4265
228 Ga0265339_10000101 3300031249 Bacteria 69843
229 Ga0265331_10030818 3300031250 Bacteria 2668
230 Ga0265316_10010482 3300031344 Bacteria 8441
231 Ga0265313_10000548 3300031595 Bacteria 39188
232 Ga0265342_10044515 3300031712 Bacteria 2675
233 Ga0373923_0055990 3300035111 Bacteria 1664
234 Ga0373954_0170548 3300035118 Bacteria 1066
235 Ga0373943_0003957 3300035170 Bacteria 6742
236 Ga0373943_0008347 3300035170 Bacteria 4649
237 Ga0373943_0015305 3300035170 Bacteria 3483
238 Ga0373946_0168870 3300035171 Bacteria 1031
239 Ga0373955_0135814 3300035172 Unclassified 1438
240 Ga0373924_0001909 3300035410 Bacteria 6927
241 Ga0373935_0063273 3300035692 Bacteria 2371
242 Ga0373927_0016145 3300035695 Bacteria 4927
243 Ga0373927_0050692 3300035695 Bacteria 2685
244 Ga0373927_0064439 3300035695 Bacteria 2370
245 Ga0373927_0133952 3300035695 Bacteria 1619
246 Ga0373933_0035909 3300035724 Unclassified 2898
247 Ga0373947_0000037 3300035725 Bacteria 63924
248 Ga0373947_0056166 3300035725 Bacteria 2379
249 Ga0373947_0058466 3300035725 Bacteria 2337
250 Ga0373947_0096485 3300035725 Bacteria 1851
251 Ga0373947_0158805 3300035725 Bacteria 1461
252 Ga0373937_0022798 3300036401 Bacteria 5633
253 Ga0373925_0000139 3300037068 Bacteria 77722
254 Ga0373925_0033280 3300037068 Bacteria 3799
255 Ga0373925_0095064 3300037068 Bacteria 2282
256 Ga0373925_0195963 3300037068 Bacteria 1605
257 Ga0373925_0198473 3300037068 Bacteria 1595
258 Ga0395898_0341501 3300037466 Bacteria 1428
259 Ga0436365_0186705 3300039437 Bacteria 3854
260 Ga0439464_0025808 3300042439 Bacteria 1628
261 Ga0451577_0317309 3300042876 Bacteria 1413
262 Ga0439440_0053326 3300042993 Bacteria 1016
263 Ga0453684_0072619 3300044712 Bacteria 4343
264 Ga0453684_0249497 3300044712 Bacteria 2039
265 Ga0451576_0061865 3300045051 Bacteria 3904
266 Ga0451576_0188125 3300045051 Bacteria 2156
267 Ga0495592_0006514 3300046454 Bacteria 8700
268 Ga0495603_0124416 3300046455 Bacteria 1503
269 Ga0495651_0011873 3300046462 Bacteria 6701
270 Ga0495651_0057097 3300046462 Bacteria 2997
271 Ga0495580_0046586 3300046472 Bacteria 3075
272 Ga0495580_0260614 3300046472 Bacteria 1186
273 Ga0495582_0150448 3300046473 Bacteria 1321
274 Ga0495582_0252571 3300046473 Bacteria 1011
275 Ga0495662_0079054 3300046476 Bacteria 1599
276 Ga0495664_0040731 3300046477 Bacteria 2748
277 Ga0495664_0072814 3300046477 Unclassified 2054
278 Ga0495664_0125400 3300046477 Bacteria 1553
279 Ga0495618_0003953 3300046514 Bacteria 9140
280 Ga0495628_0005724 3300046516 Bacteria 10887
281 Ga0495628_0018819 3300046516 Bacteria 5716
282 Ga0495628_0137182 3300046516 Bacteria 1869
283 Ga0495630_0001346 3300046517 Bacteria 16892
284 Ga0495630_0060581 3300046517 Bacteria 2841
285 Ga0495630_0089020 3300046517 Bacteria 2332
286 Ga0495630_0282681 3300046517 Bacteria 1268
287 Ga0495652_0003415 3300046529 Bacteria 15698
288 Ga0495665_0053622 3300046531 Bacteria 2132
289 Ga0495665_0103910 3300046531 Bacteria 1491
290 Ga0495640_0013126 3300046533 Bacteria 6305
291 Ga0495640_0084773 3300046533 Bacteria 2101
292 Ga0495645_0001449 3300046543 Bacteria 16009
293 Ga0495645_0014701 3300046543 Bacteria 5559
294 Ga0495645_0095565 3300046543 Bacteria 2118
295 Ga0495645_0118840 3300046543 Bacteria 1863
296 Ga0495667_0004459 3300046559 Bacteria 9442
297 Ga0495667_0004712 3300046559 Bacteria 9223
298 Ga0495667_0061222 3300046559 Unclassified 2468
299 Ga0495635_0047351 3300046663 Bacteria 2965
300 Ga0495599_0014540 3300046678 Unclassified 4874
301 Ga0495658_0202397 3300046683 Bacteria 1238
302 Ga0495613_0000186 3300046689 Bacteria 60855
303 Ga0495613_0095611 3300046689 Bacteria 2149
304 Ga0495624_0041553 3300046690 Bacteria 2940
305 Ga0495600_0009657 3300046809 Bacteria 5965
306 Ga0495581_0152724 3300047315 Bacteria 1349
307 Ga0495604_0009218 3300047317 Bacteria 7814
308 Ga0495604_0066094 3300047317 Bacteria 2752
309 Ga0495604_0203267 3300047317 Bacteria 1373
310 Ga0495674_0006682 3300047319 Bacteria 11052
311 Ga0495674_0048827 3300047319 Bacteria 3742
312 Ga0495674_0198108 3300047319 Bacteria 1667
313 Ga0495674_0308376 3300047319 Bacteria 1292
314 Ga0495680_0010360 3300047322 Bacteria 8319
315 Ga0495675_0092625 3300047444 Bacteria 1896
316 Ga0495675_0095015 3300047444 Unclassified 1869
317 Ga0495684_0000188 3300047471 Bacteria 47553
318 Ga0495684_0002063 3300047471 Bacteria 16143
319 Ga0495684_0005297 3300047471 Bacteria 10044
320 Ga0495684_0059410 3300047471 Bacteria 2912
321 Ga0495684_0089953 3300047471 Unclassified 2326
322 Ga0495684_0193734 3300047471 Bacteria 1501
323 Ga0495684_0196745 3300047471 Bacteria 1488
324 Ga0495684_0298781 3300047471 Bacteria 1157
325 Ga0495602_0003234 3300048088 Bacteria 16819
326 Ga0495602_0036198 3300048088 Bacteria 4596
327 Ga0495602_0245059 3300048088 Bacteria 1339
328 Ga0496100_0040523 3300048903 Bacteria 2964
329 Ga0496101_0003170 3300048904 Bacteria 10187
330 Ga0496104_0000217 3300048907 Bacteria 50667
331 Ga0496104_0094044 3300048907 Bacteria 2867
332 Ga0496105_0008307 3300048908 Bacteria 8069
333 Ga0496105_0259439 3300048908 Unclassified 1406
334 Ga0496107_0156979 3300048910 Bacteria 1685
335 Ga0496112_0074766 3300048915 Bacteria 3351
336 Ga0496114_0023015 3300048917 Bacteria 5078
337 Ga0496114_0438535 3300048917 Bacteria 1157
338 Ga0496115_0010567 3300048918 Bacteria 6903
339 Ga0501034_0071161 3300049571 Bacteria 3488
340 Ga0501034_0188908 3300049571 Bacteria 2023
341 Ga0501038_0251808 3300049574 Bacteria 1399
342 Ga0501039_0189388 3300049575 Bacteria 1618
343 Ga0501042_0168111 3300049578 Bacteria 1582
344 Ga0501043_0235048 3300049579 Bacteria 1415
345 Ga0501048_0146039 3300049582 Bacteria 1673
346 Ga0501072_0207191 3300049588 Bacteria 1563
347 Ga0501072_0262378 3300049588 Bacteria 1375
348 Ga0501076_0028880 3300049592 Bacteria 4310
349 Ga0501081_0010911 3300049743 Bacteria 5938
350 Ga0501035_0130216 3300049822 Bacteria 2194
351 Ga0501045_0206748 3300049824 Bacteria 1462
352 nmdc:mga05p37_166809_c1 3300050507 Bacteria 2687
353 nmdc:mga05p37_18386_c1 3300050507 Bacteria 8443
354 nmdc:mga05p37_55578_c1 3300050507 Bacteria 4872
355 nmdc:mga09592_39241_c1 3300050508 Bacteria 3977
356 nmdc:mga0qj67_80752_c1 3300050509 Bacteria 2606
357 nmdc:mga06r32_17888_c1 3300050510 Bacteria 6478
358 nmdc:mga06r32_23447_c1 3300050510 Bacteria 5710
359 nmdc:mga0a205_330488_c1 3300050515 Bacteria 1394
360 nmdc:mga0a205_38028_c1 3300050515 Bacteria 4628
361 Ga0495601_0005360 3300053077 Bacteria 7471
362 Ga0495612_0010156 3300053078 Bacteria 3808
363 Ga0495595_0001895 3300053084 Bacteria 8123
364 Ga0495619_0000225 3300053085 Bacteria 40938
365 Ga0495619_0003281 3300053085 Bacteria 10461
366 Ga0495619_0051719 3300053085 Bacteria 2715
367 Ga0495619_0267892 3300053085 Bacteria 1184
368 Ga0501084_0171327 3300054114 Bacteria 1832
369 Ga0530510_0161963 3300061734 Bacteria 1655
370 Ga0075431_100068167
371 JGI25405J52794_10001578
372 Ga0058860_12080923
373 Ga0070658_10000976
374 Ga0070658_10195189
375 Ga0068869_100144799
376 Ga0070666_10158085
377 Ga0070680_100275012
378 Ga0068868_100260775
379 Ga0068868_100272944
380 Ga0068868_100296203
381 Ga0070660_100091870
382 Ga0070689_100308547
383 Ga0070671_100049133
384 Ga0070674_100162624
385 Ga0070673_100051700
386 Ga0070713_100003463
387 Ga0070713_100182780
388 Ga0070705_100004237
389 Ga0070694_100042481
390 Ga0070678_100054188
391 Ga0070678_100238170
392 Ga0070681_10102220
393 Ga0070681_10178694
394 Ga0070681_10207341
395 Ga0070685_10381054
396 Ga0070706_100048022
397 Ga0070698_100017948
398 Ga0070698_100555303
399 Ga0070699_100004202
400 Ga0070679_100429710
401 Ga0070684_100296871
402 Ga0070684_100317325
403 Ga0068853_100106432
404 Ga0070696_100000606
405 Ga0070665_100042313
406 Ga0070665_100102956
407 Ga0068855_100004820
408 Ga0068855_100004890
409 Ga0068855_100005019
410 Ga0068855_100005914
411 Ga0068855_100020882
412 Ga0068855_100473756
413 Ga0068857_100005169
414 Ga0068857_100008144
415 Ga0068856_100038535
416 Ga0068856_100040646
417 Ga0068856_100073792
418 Ga0068856_100074112
419 Ga0068852_100011503
420 Ga0068864_100001652
421 Ga0068864_100337130
422 Ga0068863_100023635
423 Ga0068863_100024819
424 Ga0068863_100072642
425 Ga0068863_100078428
426 Ga0068858_100001891
427 Ga0068858_100008368
428 Ga0068858_100444409
429 Ga0068860_100027066
430 Ga0068860_100048113
431 Ga0068860_100300690
432 Ga0068860_100461734
433 Ga0081455_10003892
434 Ga0081538_10009213
435 Ga0081540_1018036
436 Ga0081539_10070995
437 Ga0070717_10034728
438 Ga0097621_100004088
439 Ga0097621_100020497
440 Ga0097621_100056905
441 Ga0097621_100086626
442 Ga0068871_100005925
443 Ga0068871_100024400
444 Ga0075428_100006222
445 Ga0075428_100041345
446 Ga0075430_100124330
447 Ga0075430_100173902
448 Ga0075431_100098515
449 Ga0075429_100183732
450 Ga0068865_100246753
451 Ga0097620_100196127
452 Ga0105240_10003098
453 Ga0105240_10005869
454 Ga0105240_10020600
455 Ga0105240_10026130
456 Ga0105240_10355776
457 Ga0111539_10002576
458 Ga0111539_10610060
459 Ga0105245_10034640
460 Ga0105247_10038179
461 Ga0114129_10002893
462 Ga0114129_10100582
463 Ga0114129_10153229
464 Ga0114129_10231976
465 Ga0114129_10357492
466 Ga0114129_10413407
467 Ga0105243_10758411
468 Ga0105241_10001195
469 Ga0105242_10010742
470 Ga0105242_10050523
471 Ga0105248_10023636
472 Ga0105248_10027152
473 Ga0105248_10072411
474 Ga0105248_10352623
475 Ga0105237_10009252
476 Ga0105238_10011289
477 Ga0105249_10185146
478 Ga0105239_10011103
479 Ga0105239_10027229
480 Ga0105239_10038977
481 Ga0105239_10041510
482 Ga0105239_10945987
483 Ga0157370_10002747
484 Ga0157370_10086222
485 Ga0157369_10000921
486 Ga0157369_10523534
487 Ga0157374_10033066
488 Ga0157374_10387088
489 Ga0157378_10007387
490 Ga0157378_10038148
491 Ga0157378_10055523
492 Ga0163162_10016513
493 Ga0163162_10019300
494 Ga0163162_10184278
495 Ga0163162_10350380
496 Ga0157372_10018936
497 Ga0157372_10128374
498 Ga0157375_10012756
499 Ga0157375_10155836
500 Ga0157375_10160173
501 Ga0157375_10943936
502 Ga0163163_10018775
503 Ga0163163_10023988
504 Ga0163163_10037528
505 Ga0163163_10041968
506 Ga0163163_10402834
507 Ga0163163_10440049
508 Ga0157379_10009566
509 Ga0157379_10021217
510 Ga0157379_10071452
511 Ga0157376_10006108
512 Ga0157376_10072883
513 Ga0157376_10268147
514 Ga0157376_10402855
515 Ga0157376_10590991
516 Ga0197907_10957548
517 Ga0206349_1673008
518 Ga0207642_10283458
519 Ga0207710_10071056
520 Ga0207680_10023833
521 Ga0207680_10307027
522 Ga0207699_10150807
523 Ga0207645_10068775
524 Ga0207705_10008885
525 Ga0207705_10156567
526 Ga0207684_10005225
527 Ga0207654_10009473
528 Ga0207707_10063009
529 Ga0207707_10269198
530 Ga0207695_10001508
531 Ga0207695_10012992
532 Ga0207695_10015332
533 Ga0207695_10024586
534 Ga0207695_10099255
535 Ga0207695_10273731
536 Ga0207671_10018402
537 Ga0207660_10060712
538 Ga0207660_10254701
539 Ga0207657_10222918
540 Ga0207649_10146267
541 Ga0207652_10163866
542 Ga0207694_10034967
543 Ga0207694_10037762
544 Ga0207659_10066014
545 Ga0207659_10400420
546 Ga0207687_10011260
547 Ga0207687_10084374
548 Ga0207687_10190835
549 Ga0207687_10430616
550 Ga0207664_10047242
551 Ga0207644_10034517
552 Ga0207686_10003776
553 Ga0207686_10006155
554 Ga0207686_10030321
555 Ga0207686_10035865
556 Ga0207686_10372783
557 Ga0207669_10190823
558 Ga0207704_10008848
559 Ga0207665_10052840
560 Ga0207665_10326018
561 Ga0207711_10017251
562 Ga0207711_10145340
563 Ga0207711_10291144
564 Ga0207661_10057273
565 Ga0207661_10468343
566 Ga0207667_10001420
567 Ga0207667_10002810
568 Ga0207667_10110536
569 Ga0207667_10262228
570 Ga0207667_10347890
571 Ga0207651_10035764
572 Ga0207651_10048981
573 Ga0207712_10225669
574 Ga0207677_10154738
575 Ga0207677_10371166
576 Ga0207703_10010123
577 Ga0207703_10021005
578 Ga0207703_10425057
579 Ga0207702_10085578
580 Ga0207702_10545115
581 Ga0207641_10017787
582 Ga0207641_10060545
583 Ga0207648_10090036
584 Ga0207676_10141696
585 Ga0207674_10004534
586 Ga0207674_10022535
587 Ga0207674_10304338
588 Ga0207683_10085873
589 Ga0207683_10252573
590 Ga0207428_10038841
591 Ga0207428_10138375
592 Ga0268266_10124073
593 Ga0268265_10323255
594 Ga0268264_10004150
595 Ga0265338_10004716
596 Ga0265325_10015622
597 Ga0265339_10000101
598 Ga0265331_10030818
599 Ga0265316_10010482
600 Ga0265313_10000548
601 Ga0265342_10044515
602 Ga0373923_0055990
603 Ga0373954_0170548
604 Ga0373943_0003957
605 Ga0373943_0008347
606 Ga0373943_0015305
607 Ga0373946_0168870
608 Ga0373955_0135814
609 Ga0373924_0001909
610 Ga0373935_0063273
611 Ga0373927_0016145
612 Ga0373927_0050692
613 Ga0373927_0064439
614 Ga0373927_0133952
615 Ga0373933_0035909
616 Ga0373947_0000037
617 Ga0373947_0056166
618 Ga0373947_0058466
619 Ga0373947_0096485
620 Ga0373947_0158805
621 Ga0373937_0022798
622 Ga0373925_0000139
623 Ga0373925_0033280
624 Ga0373925_0095064
625 Ga0373925_0195963
626 Ga0373925_0198473
627 Ga0395898_0341501
628 Ga0436365_0186705
629 Ga0439464_0025808
630 Ga0451577_0317309
631 Ga0439440_0053326
632 Ga0453684_0072619
633 Ga0453684_0249497
634 Ga0451576_0061865
635 Ga0451576_0188125
636 Ga0495592_0006514
637 Ga0495603_0124416
638 Ga0495651_0011873
639 Ga0495651_0057097
640 Ga0495580_0046586
641 Ga0495580_0260614
642 Ga0495582_0150448
643 Ga0495582_0252571
644 Ga0495662_0079054
645 Ga0495664_0040731
646 Ga0495664_0072814
647 Ga0495664_0125400
648 Ga0495618_0003953
649 Ga0495628_0005724
650 Ga0495628_0018819
651 Ga0495628_0137182
652 Ga0495630_0001346
653 Ga0495630_0060581
654 Ga0495630_0089020
655 Ga0495630_0282681
656 Ga0495652_0003415
657 Ga0495665_0053622
658 Ga0495665_0103910
659 Ga0495640_0013126
660 Ga0495640_0084773
661 Ga0495645_0001449
662 Ga0495645_0014701
663 Ga0495645_0095565
664 Ga0495645_0118840
665 Ga0495667_0004459
666 Ga0495667_0004712
667 Ga0495667_0061222
668 Ga0495635_0047351
669 Ga0495599_0014540
670 Ga0495658_0202397
671 Ga0495613_0000186
672 Ga0495613_0095611
673 Ga0495624_0041553
674 Ga0495600_0009657
675 Ga0495581_0152724
676 Ga0495604_0009218
677 Ga0495604_0066094
678 Ga0495604_0203267
679 Ga0495674_0006682
680 Ga0495674_0048827
681 Ga0495674_0198108
682 Ga0495674_0308376
683 Ga0495680_0010360
684 Ga0495675_0092625
685 Ga0495675_0095015
686 Ga0495684_0000188
687 Ga0495684_0002063
688 Ga0495684_0005297
689 Ga0495684_0059410
690 Ga0495684_0089953
691 Ga0495684_0193734
692 Ga0495684_0196745
693 Ga0495684_0298781
694 Ga0495602_0003234
695 Ga0495602_0036198
696 Ga0495602_0245059
697 Ga0496100_0040523
698 Ga0496101_0003170
699 Ga0496104_0000217
700 Ga0496104_0094044
701 Ga0496105_0008307
702 Ga0496105_0259439
703 Ga0496107_0156979
704 Ga0496112_0074766
705 Ga0496114_0023015
706 Ga0496114_0438535
707 Ga0496115_0010567
708 Ga0501034_0071161
709 Ga0501034_0188908
710 Ga0501038_0251808
711 Ga0501039_0189388
712 Ga0501042_0168111
713 Ga0501043_0235048
714 Ga0501048_0146039
715 Ga0501072_0207191
716 Ga0501072_0262378
717 Ga0501076_0028880
718 Ga0501081_0010911
719 Ga0501035_0130216
720 Ga0501045_0206748
721 nmdc:mga05p37_166809_c1
722 nmdc:mga05p37_18386_c1
723 nmdc:mga05p37_55578_c1
724 nmdc:mga09592_39241_c1
725 nmdc:mga0qj67_80752_c1
726 nmdc:mga06r32_17888_c1
727 nmdc:mga06r32_23447_c1
728 nmdc:mga0a205_330488_c1
729 nmdc:mga0a205_38028_c1
730 Ga0495601_0005360
731 Ga0495612_0010156
732 Ga0495595_0001895
733 Ga0495619_0000225
734 Ga0495619_0003281
735 Ga0495619_0051719
736 Ga0495619_0267892
737 Ga0501084_0171327
738 Ga0530510_0161963

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF23678

1

36

0.95

PF01738

DLH

Dienelactone hydrolase family

84

297

0.92

PF02129

Peptidase_S15

X-Pro dipeptidyl-peptidase (S15 family)

82

234

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.9855 60 295
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.9691 60 295
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.8905 68 291
1zic-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (c123s, r206a) mutant- 1.7 a 0.8831 73 295
1zi8-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase mutant(e36d, c123s, a134s, s208g, a229v, k234r)- 1.4 a 0.882 73 295
ID Description Score Start End Superfamily
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9848 60 295 3.40.50.1820
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9682 60 295 3.40.50.1820
af_Q54MZ9_1_255_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8867 69 295 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8842 71 291 3.40.50.1820
af_Q5AI87_1_234_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8841 84 295 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A0R5RPW6-F1-model_v4 Dienelactone hydrolase family 1.001 192 289 GO:0016787
AF-A0A378BQ54-F1-model_v4 Putative enzyme 1.001 204 294 GO:0016787
AF-A0A6N3QHR6-F1-model_v4 Putative enzyme 0.9967 181 295 GO:0016787
AF-A0A376VX57-F1-model_v4 YghX 0.9967 190 294 GO:0016787
AF-A0A3N5H463-F1-model_v4 Dienelactone hydrolase family protein 0.9966 190 294 GO:0016787

Map