F424986

General Info

Members Datasets Scaffolds Average Seq Length
369 233 369 792

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100008573|Ga0075363_1000085732
Length 834
Sequence MEPMEAATTTVMGLSSAEAERRLERLGPPEQETSRSVQSIVAANVLTLFNGIILVFFILVLSQGLFADALFGLIAIINSAIGIRQEIKAKETLDELALLVAPRAHAIRDGEVVEVLADRIVPGDVVRVEPGDQLIADGAVASSRGLTIDESLLTGEADGIRKQRGDRMLSGSFCISGSGTYEIDAVRENSYAAKIAGEAKEFRHPPSPLQVEVNQVLWATTIILVPLALAMLAGFIVRGVDFTEAAQTATAGLITLIPEGLVLLMSVTLAVAARRLARMDTLVQQMSATEXXXXVDTICVDKTGTLTDGSLELISVESPDPAGREVAERTLGRFAASAGERNRTLETVAEAFPMQPLPVVSEVPFSSQWKWSGLTVETDSGRRSFVIGAPDILIGSGALTLPAALAETLEREAGEGRRVIAFGEAPGGLPEDPATSPPPQLEPRALVVLEETLRPDAAETIEFMREQEVDLKLISGDARQTVTAVAYSLGVPQDAGVIEGPDLPEERAALTAAAERNTIFCRITPDQKKALVGALGDAGRFTAMIGDGVNDVPALKQARLAVAMGSGSQITKGIADIVLLRDQFSMLPRAVGEGRRIARNIHRLGRLYLTKTVYAGFLILAAALVGFPFPFLPRQLTIAAAITIGIPSFVLALAPSEGPLYRGRLLRALAAFAVPAGIGIGVGSLLSFGLVDAVFAGTLNEGRTAATTTLIVLGLAFILLLERGPGREHIAIQSYMLAMVSGLGALFALILAAAPVRDFFELDLLSAGQWFLCMASVAAGLVVASALWRLPYIQHLELHEGEEPAEDQVNPFTGAMPAPTHGNPLTRRRRGAES

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
112 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
113 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
114 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
115 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
116 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
117 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
118 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
119 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
137 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
138 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
139 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
151 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
171 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
225 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
226 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
227 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
230 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
231 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.44
Nodule 0
Rhizoplane 15.18
Rhizosphere 79.95
Stem 0
Stem Tuber 0
Unclassified 2.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000829 3300001977 Bacteria 4782
2 JGI24740J21852_10002564 3300001979 Bacteria 8188
3 Ga0070658_10008167 3300005327 Bacteria 8413
4 Ga0070683_100004875 3300005329 Bacteria 11118
5 Ga0070683_100017862 3300005329 Bacteria 6270
6 Ga0070683_100029458 3300005329 Bacteria 4971
7 Ga0070683_100112700 3300005329 Bacteria 2567
8 Ga0070677_10000001 3300005333 Bacteria 118426
9 Ga0070666_10015658 3300005335 Bacteria 4840
10 Ga0070682_100000028 3300005337 Bacteria 185177
11 Ga0070682_100000080 3300005337 Bacteria 85683
12 Ga0068868_100002781 3300005338 Bacteria 12121
13 Ga0068868_100005092 3300005338 Bacteria 9224
14 Ga0070660_100000656 3300005339 Bacteria 22861
15 Ga0070689_100041665 3300005340 Bacteria 3525
16 Ga0070691_10000054 3300005341 Bacteria 32149
17 Ga0070661_100003829 3300005344 Bacteria 10359
18 Ga0070675_100000058 3300005354 Bacteria 66874
19 Ga0070674_100000025 3300005356 Bacteria 78679
20 Ga0070673_100016085 3300005364 Bacteria 5279
21 Ga0070688_100002866 3300005365 Bacteria 8796
22 Ga0070688_100032977 3300005365 Bacteria 3128
23 Ga0070659_100005040 3300005366 Bacteria 9469
24 Ga0070659_100012109 3300005366 Bacteria 6389
25 Ga0070713_100001783 3300005436 Bacteria 13874
26 Ga0070711_100010844 3300005439 Bacteria 5650
27 Ga0070700_100000869 3300005441 Bacteria 14885
28 Ga0070663_100008958 3300005455 Bacteria 6180
29 Ga0070663_100027668 3300005455 Bacteria 3852
30 Ga0070678_100001346 3300005456 Bacteria 13080
31 Ga0070662_100000007 3300005457 Bacteria 168761
32 Ga0068867_100001633 3300005459 Bacteria 15598
33 Ga0070685_10000018 3300005466 Bacteria 110132
34 Ga0070679_100001155 3300005530 Bacteria 23125
35 Ga0070679_100003123 3300005530 Bacteria 15146
36 Ga0068853_100011379 3300005539 Bacteria 7226
37 Ga0070672_100000004 3300005543 Bacteria 129970
38 Ga0070686_100025795 3300005544 Bacteria 3540
39 Ga0070693_100007000 3300005547 Bacteria 5493
40 Ga0070665_100000202 3300005548 Bacteria 104773
41 Ga0070665_100007985 3300005548 Bacteria 10722
42 Ga0070665_100046474 3300005548 Bacteria 4361
43 Ga0068854_100001335 3300005578 Bacteria 14874
44 Ga0068854_100006441 3300005578 Bacteria 7467
45 Ga0068856_100011258 3300005614 Bacteria 8682
46 Ga0068852_100000012 3300005616 Bacteria 140734
47 Ga0068864_100000024 3300005618 Bacteria 252632
48 Ga0068866_10000001 3300005718 Bacteria 519680
49 Ga0068861_100018544 3300005719 Bacteria 4957
50 Ga0068851_10001094 3300005834 Bacteria 11760
51 Ga0068851_10008651 3300005834 Bacteria 4712
52 Ga0068863_100000004 3300005841 Bacteria 272478
53 Ga0068858_100000017 3300005842 Bacteria 186913
54 Ga0068858_100017638 3300005842 Bacteria 6692
55 Ga0068858_100024200 3300005842 Bacteria 5658
56 Ga0081455_10015495 3300005937 Bacteria 7403
57 Ga0081455_10024864 3300005937 Bacteria 5536
58 Ga0081455_10045954 3300005937 Bacteria 3794
59 Ga0081455_10049970 3300005937 Bacteria 3600
60 Ga0081538_10000030 3300005981 Bacteria 124321
61 Ga0081538_10000163 3300005981 Bacteria 70652
62 Ga0081538_10037195 3300005981 Bacteria 3163
63 Ga0081540_1000006 3300005983 Bacteria 208724
64 Ga0081540_1002460 3300005983 Bacteria 15089
65 Ga0081539_10017744 3300005985 Bacteria 4978
66 Ga0075365_10003588 3300006038 Bacteria 8029
67 Ga0075365_10017892 3300006038 Bacteria 4348
68 Ga0075365_10022998 3300006038 Bacteria 3914
69 Ga0075363_100008573 3300006048 Bacteria 4768
70 Ga0070715_10000001 3300006163 Bacteria 693690
71 Ga0070712_100004050 3300006175 Bacteria 8996
72 Ga0070712_100010641 3300006175 Bacteria 5811
73 Ga0075431_100005559 3300006847 Bacteria 12444
74 Ga0075431_100029237 3300006847 Bacteria 5670
75 Ga0075433_10000101 3300006852 Bacteria 41420
76 Ga0075434_100079672 3300006871 Bacteria 3272
77 Ga0075429_100067623 3300006880 Bacteria 3109
78 Ga0068865_100000101 3300006881 Bacteria 44302
79 Ga0105245_10000098 3300009098 Bacteria 84100
80 Ga0105245_10000969 3300009098 Bacteria 26182
81 Ga0105245_10002366 3300009098 Bacteria 17041
82 Ga0105245_10006628 3300009098 Bacteria 10169
83 Ga0105245_10074423 3300009098 Bacteria 3091
84 Ga0105247_10003405 3300009101 Bacteria 10392
85 Ga0114129_10098206 3300009147 Bacteria 4053
86 Ga0105242_10000357 3300009176 Bacteria 36537
87 Ga0105242_10000530 3300009176 Bacteria 30053
88 Ga0105248_10000032 3300009177 Bacteria 201114
89 Ga0105238_10000023 3300009551 Bacteria 196844
90 Ga0105249_10000074 3300009553 Bacteria 145235
91 Ga0105249_10010332 3300009553 Bacteria 8205
92 Ga0105239_10136771 3300010375 Bacteria 2728
93 Ga0157369_10000099 3300013105 Bacteria 120032
94 Ga0157374_10008010 3300013296 Bacteria 9031
95 Ga0157378_10005494 3300013297 Bacteria 11110
96 Ga0157378_10074133 3300013297 Bacteria 3062
97 Ga0157372_10016764 3300013307 Bacteria 7865
98 Ga0157375_10000194 3300013308 Bacteria 56860
99 Ga0157375_10005846 3300013308 Bacteria 10706
100 Ga0157375_10006986 3300013308 Bacteria 9856
101 Ga0157380_10000138 3300014326 Bacteria 40711
102 Ga0157380_10001287 3300014326 Bacteria 16323
103 Ga0163161_10000032 3300017792 Bacteria 165511
104 Ga0207656_10000325 3300025321 Bacteria 16400
105 Ga0207682_10000053 3300025893 Bacteria 49064
106 Ga0207642_10000006 3300025899 Bacteria 230268
107 Ga0207642_10000007 3300025899 Bacteria 226017
108 Ga0207710_10000369 3300025900 Bacteria 31539
109 Ga0207688_10006995 3300025901 Bacteria 6136
110 Ga0207680_10002853 3300025903 Bacteria 8086
111 Ga0207680_10005067 3300025903 Bacteria 6275
112 Ga0207685_10000011 3300025905 Bacteria 213430
113 Ga0207693_10005072 3300025915 Bacteria 11047
114 Ga0207693_10009297 3300025915 Bacteria 8020
115 Ga0207663_10003721 3300025916 Bacteria 7512
116 Ga0207657_10004970 3300025919 Bacteria 13991
117 Ga0207649_10000640 3300025920 Bacteria 23374
118 Ga0207652_10000549 3300025921 Bacteria 38051
119 Ga0207652_10002646 3300025921 Bacteria 15031
120 Ga0207694_10000004 3300025924 Bacteria 967075
121 Ga0207659_10000020 3300025926 Bacteria 151552
122 Ga0207687_10000007 3300025927 Bacteria 604185
123 Ga0207687_10000055 3300025927 Bacteria 88382
124 Ga0207687_10000256 3300025927 Bacteria 36154
125 Ga0207687_10003179 3300025927 Bacteria 11151
126 Ga0207687_10023282 3300025927 Bacteria 4127
127 Ga0207687_10037903 3300025927 Bacteria 3292
128 Ga0207700_10000070 3300025928 Bacteria 62833
129 Ga0207706_10000018 3300025933 Bacteria 168729
130 Ga0207686_10000438 3300025934 Bacteria 27955
131 Ga0207709_10009255 3300025935 Bacteria 5425
132 Ga0207670_10007284 3300025936 Bacteria 6161
133 Ga0207669_10000009 3300025937 Bacteria 168012
134 Ga0207704_10000025 3300025938 Bacteria 135523
135 Ga0207691_10000020 3300025940 Bacteria 133465
136 Ga0207711_10000020 3300025941 Bacteria 363325
137 Ga0207661_10002063 3300025944 Bacteria 13830
138 Ga0207661_10002734 3300025944 Bacteria 12142
139 Ga0207661_10010753 3300025944 Bacteria 6597
140 Ga0207661_10014223 3300025944 Bacteria 5826
141 Ga0207712_10000007 3300025961 Bacteria 539589
142 Ga0207640_10000285 3300025981 Bacteria 33957
143 Ga0207640_10004530 3300025981 Bacteria 7544
144 Ga0207658_10005129 3300025986 Bacteria 9021
145 Ga0207677_10000046 3300026023 Bacteria 105382
146 Ga0207677_10051302 3300026023 Bacteria 2796
147 Ga0207703_10000030 3300026035 Bacteria 199014
148 Ga0207703_10000740 3300026035 Bacteria 32186
149 Ga0207639_10002123 3300026041 Bacteria 13352
150 Ga0207678_10000994 3300026067 Bacteria 25831
151 Ga0207678_10003121 3300026067 Bacteria 14999
152 Ga0207708_10002546 3300026075 Bacteria 13408
153 Ga0207702_10000016 3300026078 Bacteria 226633
154 Ga0207702_10006752 3300026078 Bacteria 9850
155 Ga0207641_10000170 3300026088 Bacteria 91128
156 Ga0207648_10000931 3300026089 Bacteria 32948
157 Ga0207676_10000048 3300026095 Bacteria 147853
158 Ga0207675_100014368 3300026118 Bacteria 7383
159 Ga0207675_100030730 3300026118 Bacteria 5002
160 Ga0207683_10003046 3300026121 Bacteria 14655
161 Ga0207683_10018592 3300026121 Bacteria 5931
162 Ga0207698_10000012 3300026142 Bacteria 260061
163 Ga0207698_10008377 3300026142 Bacteria 6535
164 Ga0207698_10017631 3300026142 Bacteria 4851
165 Ga0268266_10000020 3300028379 Bacteria 527065
166 Ga0268266_10000216 3300028379 Bacteria 100792
167 Ga0268266_10000553 3300028379 Bacteria 52199
168 Ga0268264_10007146 3300028381 Bacteria 9357
169 Ga0265337_1000002 3300028556 Bacteria 139247
170 Ga0265326_10000007 3300028558 Bacteria 223057
171 Ga0265319_1000028 3300028563 Bacteria 135557
172 Ga0265322_10000001 3300028654 Bacteria 543854
173 Ga0265336_10001375 3300028666 Bacteria 11232
174 Ga0265338_10000230 3300028800 Bacteria 103891
175 Ga0265324_10000263 3300029957 Bacteria 39080
176 Ga0265328_10000841 3300031239 Bacteria 14232
177 Ga0265320_10000002 3300031240 Bacteria 542875
178 Ga0265339_10035244 3300031249 Bacteria 2809
179 Ga0265331_10003168 3300031250 Bacteria 10741
180 Ga0265327_10000011 3300031251 Bacteria 543807
181 Ga0265314_10000058 3300031711 Bacteria 167476
182 Ga0307415_100001131 3300032126 Bacteria 12469
183 Ga0316584_0029947 3300036712 Bacteria 4020
184 Ga0395899_0029559 3300037312 Bacteria 4122
185 Ga0395898_0007373 3300037466 Bacteria 11673
186 Ga0395905_0002784 3300037471 Bacteria 19150
187 Ga0395901_0023765 3300038443 Bacteria 6285
188 Ga0466963_0000200 3300044694 Bacteria 25265
189 Ga0466957_0002421 3300044842 Bacteria 10019
190 Ga0466967_0000046 3300045976 Bacteria 43911
191 Ga0466967_0002706 3300045976 Bacteria 11202
192 Ga0495592_0000109 3300046454 Bacteria 72116
193 Ga0495603_0000023 3300046455 Bacteria 63559
194 Ga0495603_0000203 3300046455 Bacteria 31050
195 Ga0495603_0008807 3300046455 Bacteria 6100
196 Ga0495629_0000218 3300046459 Bacteria 51219
197 Ga0495629_0005185 3300046459 Bacteria 9753
198 Ga0495629_0050036 3300046459 Bacteria 2928
199 Ga0495641_0000003 3300046461 Bacteria 242879
200 Ga0495641_0025816 3300046461 Bacteria 2878
201 Ga0495582_0000027 3300046473 Bacteria 79970
202 Ga0495662_0000131 3300046476 Bacteria 28301
203 Ga0495594_0000013 3300046499 Bacteria 103201
204 Ga0495606_0000211 3300046507 Bacteria 103386
205 Ga0495608_0000031 3300046511 Bacteria 145255
206 Ga0495608_0010361 3300046511 Bacteria 6506
207 Ga0495618_0000004 3300046514 Bacteria 245690
208 Ga0495620_0001873 3300046515 Bacteria 12382
209 Ga0495628_0000323 3300046516 Bacteria 43212
210 Ga0495628_0001939 3300046516 Bacteria 18762
211 Ga0495628_0022653 3300046516 Bacteria 5160
212 Ga0495630_0000018 3300046517 Bacteria 186064
213 Ga0495630_0000405 3300046517 Bacteria 33616
214 Ga0495644_0000602 3300046523 Bacteria 15094
215 Ga0495652_0000003 3300046529 Bacteria 597094
216 Ga0495652_0003014 3300046529 Bacteria 16901
217 Ga0495640_0007707 3300046533 Bacteria 8470
218 Ga0495586_0000871 3300046535 Bacteria 17305
219 Ga0495622_0000014 3300046557 Bacteria 182142
220 Ga0495633_0019147 3300046558 Bacteria 3464
221 Ga0495667_0000075 3300046559 Bacteria 73540
222 Ga0495656_0000581 3300046615 Bacteria 11854
223 Ga0495634_0000944 3300046642 Bacteria 27495
224 Ga0495634_0003347 3300046642 Bacteria 12880
225 Ga0495625_0000122 3300046660 Bacteria 121146
226 Ga0495635_0000042 3300046663 Bacteria 84550
227 Ga0495588_0000198 3300046674 Bacteria 60956
228 Ga0495657_0000024 3300046675 Bacteria 145255
229 Ga0495657_0002675 3300046675 Bacteria 14899
230 Ga0495599_0032554 3300046678 Bacteria 3272
231 Ga0495647_0000007 3300046681 Bacteria 103790
232 Ga0495647_0000731 3300046681 Bacteria 9714
233 Ga0495647_0002454 3300046681 Bacteria 5852
234 Ga0495658_0000025 3300046683 Bacteria 79910
235 Ga0495669_0000436 3300046684 Bacteria 19834
236 Ga0495613_0000042 3300046689 Bacteria 130403
237 Ga0495613_0007028 3300046689 Bacteria 8379
238 Ga0495624_0000009 3300046690 Bacteria 145026
239 Ga0495624_0006706 3300046690 Bacteria 8135
240 Ga0495624_0020306 3300046690 Bacteria 4425
241 Ga0495600_0003287 3300046809 Bacteria 9477
242 Ga0495600_0006488 3300046809 Bacteria 7121
243 Ga0495604_0000038 3300047317 Bacteria 123703
244 Ga0495604_0000073 3300047317 Bacteria 86844
245 Ga0495676_0008140 3300047321 Bacteria 9616
246 Ga0495680_0000196 3300047322 Bacteria 65437
247 Ga0495680_0001225 3300047322 Bacteria 28144
248 Ga0495680_0019926 3300047322 Bacteria 5654
249 Ga0495675_0000209 3300047444 Bacteria 42691
250 Ga0495679_003919 3300047446 Bacteria 7030
251 Ga0495685_005801 3300047447 Bacteria 4034
252 Ga0495602_0000228 3300048088 Bacteria 52649
253 Ga0495602_0007339 3300048088 Bacteria 11540
254 Ga0496100_0000002 3300048903 Bacteria 489057
255 Ga0496100_0000038 3300048903 Bacteria 94110
256 Ga0496100_0020612 3300048903 Bacteria 3956
257 Ga0496101_0000001 3300048904 Bacteria 489057
258 Ga0496101_0000010 3300048904 Bacteria 281990
259 Ga0496102_0000584 3300048905 Bacteria 38605
260 Ga0496102_0001245 3300048905 Bacteria 23002
261 Ga0496102_0015880 3300048905 Bacteria 6567
262 Ga0496103_0000043 3300048906 Bacteria 167983
263 Ga0496103_0008247 3300048906 Bacteria 6185
264 Ga0496103_0023384 3300048906 Bacteria 3726
265 Ga0496104_0000002 3300048907 Bacteria 686017
266 Ga0496104_0000013 3300048907 Bacteria 397163
267 Ga0496104_0000576 3300048907 Bacteria 31360
268 Ga0496105_0000001 3300048908 Bacteria 1328178
269 Ga0496105_0000006 3300048908 Bacteria 393578
270 Ga0496105_0001456 3300048908 Bacteria 16668
271 Ga0496105_0003100 3300048908 Bacteria 12228
272 Ga0496105_0017909 3300048908 Bacteria 5684
273 Ga0496106_0000018 3300048909 Bacteria 175028
274 Ga0496106_0000022 3300048909 Bacteria 166339
275 Ga0496106_0002210 3300048909 Bacteria 14512
276 Ga0496107_0000016 3300048910 Bacteria 172319
277 Ga0496107_0000032 3300048910 Bacteria 99848
278 Ga0496107_0002031 3300048910 Bacteria 12927
279 Ga0496107_0014878 3300048910 Bacteria 5448
280 Ga0496108_0000001 3300048911 Bacteria 919044
281 Ga0496108_0000045 3300048911 Bacteria 137416
282 Ga0496108_0014730 3300048911 Bacteria 6381
283 Ga0496108_0021909 3300048911 Bacteria 5252
284 Ga0496108_0050753 3300048911 Bacteria 3474
285 Ga0496109_0000003 3300048912 Bacteria 420862
286 Ga0496109_0000028 3300048912 Bacteria 168138
287 Ga0496109_0000032 3300048912 Bacteria 162984
288 Ga0496109_0001390 3300048912 Bacteria 20071
289 Ga0496109_0005722 3300048912 Bacteria 10403
290 Ga0496109_0032357 3300048912 Bacteria 4701
291 Ga0496109_0054773 3300048912 Bacteria 3638
292 Ga0496110_0000033 3300048913 Bacteria 65539
293 Ga0496110_0008950 3300048913 Bacteria 8073
294 Ga0496110_0042884 3300048913 Bacteria 3949
295 Ga0496110_0088341 3300048913 Bacteria 2768
296 Ga0496111_0000125 3300048914 Bacteria 33642
297 Ga0496111_0019373 3300048914 Bacteria 4725
298 Ga0496112_0000003 3300048915 Bacteria 660147
299 Ga0496112_0022462 3300048915 Bacteria 6012
300 Ga0496112_0044540 3300048915 Bacteria 4348
301 Ga0496113_0000007 3300048916 Bacteria 95884
302 Ga0496113_0012950 3300048916 Bacteria 5626
303 Ga0496113_0027029 3300048916 Bacteria 4109
304 Ga0496113_0027415 3300048916 Bacteria 4084
305 Ga0496114_0000014 3300048917 Bacteria 297902
306 Ga0496115_0000020 3300048918 Bacteria 171995
307 Ga0496115_0000255 3300048918 Bacteria 47200
308 Ga0496115_0007706 3300048918 Bacteria 7940
309 Ga0496115_0017571 3300048918 Bacteria 5472
310 Ga0496116_0000819 3300048919 Bacteria 39388
311 Ga0496117_0039680 3300048920 Bacteria 3471
312 Ga0496118_0026309 3300048921 Bacteria 4960
313 Ga0496119_0007563 3300048922 Bacteria 9754
314 Ga0496119_0011308 3300048922 Bacteria 7411
315 Ga0496121_0017413 3300048924 Bacteria 7343
316 Ga0496125_0045651 3300048928 Bacteria 3684
317 Ga0496126_0033977 3300048929 Bacteria 4795
318 Ga0496126_0074659 3300048929 Bacteria 3011
319 Ga0501031_0006987 3300049568 Bacteria 7368
320 Ga0501032_0008813 3300049569 Bacteria 7338
321 Ga0501033_0003746 3300049570 Bacteria 12360
322 Ga0501034_0018180 3300049571 Bacteria 7210
323 Ga0501037_0008988 3300049573 Bacteria 7319
324 Ga0501038_0014853 3300049574 Bacteria 7091
325 Ga0501042_0022735 3300049578 Bacteria 4381
326 Ga0501043_0010860 3300049579 Bacteria 7130
327 Ga0501046_0005068 3300049580 Bacteria 11810
328 Ga0501047_0000263 3300049581 Bacteria 61685
329 Ga0501047_0012915 3300049581 Bacteria 7912
330 Ga0501047_0049211 3300049581 Bacteria 4070
331 Ga0501048_0008113 3300049582 Bacteria 7947
332 Ga0501070_0011700 3300049586 Bacteria 7409
333 Ga0501070_0040151 3300049586 Bacteria 3903
334 Ga0501072_0006551 3300049588 Bacteria 8869
335 Ga0501073_0001391 3300049589 Bacteria 17837
336 Ga0501074_0009221 3300049590 Bacteria 7171
337 Ga0501074_0045390 3300049590 Bacteria 3179
338 Ga0501075_0000407 3300049591 Bacteria 25084
339 Ga0501079_0003967 3300049741 Bacteria 10933
340 Ga0501079_0010723 3300049741 Bacteria 6979
341 Ga0501080_0074105 3300049742 Bacteria 3167
342 Ga0501081_0036759 3300049743 Bacteria 3339
343 Ga0501083_0013227 3300049744 Bacteria 5768
344 Ga0501035_0012860 3300049822 Bacteria 7727
345 Ga0501044_0006797 3300049823 Bacteria 12605
346 Ga0501045_0039742 3300049824 Bacteria 3424
347 nmdc:mga0yw44_6126_c1 3300050492 Bacteria 5776
348 nmdc:mga0yw44_8170_c1 3300050492 Bacteria 5199
349 nmdc:mga06r32_29855_c1 3300050510 Bacteria 5113
350 nmdc:mga0n895_8439_c1 3300050512 Bacteria 8919
351 nmdc:mga0rr50_53610_c1 3300050513 Bacteria 3000
352 nmdc:mga0a205_1439_c1 3300050515 Bacteria 20255
353 nmdc:mga0a205_2175_c1 3300050515 Bacteria 17244
354 Ga0495601_0000072 3300053077 Bacteria 56009
355 Ga0495601_0000097 3300053077 Bacteria 48380
356 Ga0495612_0000228 3300053078 Bacteria 23756
357 Ga0495612_0009307 3300053078 Bacteria 3986
358 Ga0495655_0000011 3300053083 Bacteria 118490
359 Ga0495595_0000014 3300053084 Bacteria 145255
360 Ga0495595_0000126 3300053084 Bacteria 33076
361 Ga0495619_0000001 3300053085 Bacteria 586054
362 Ga0495619_0000022 3300053085 Bacteria 184144
363 Ga0495619_0000319 3300053085 Bacteria 33678
364 Ga0495619_0002408 3300053085 Bacteria 12284
365 Ga0500566_0014140 3300053094 Bacteria 4691
366 Ga0500614_004439 3300053123 Bacteria 2962
367 Ga0500628_000058 3300053129 Bacteria 32870
368 Ga0501084_0023555 3300054114 Bacteria 5135
369 Ga0501082_0015415 3300060353 Bacteria 6578

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046511 Ga0495608_0010361 Ga0495608_0010361_4512_6491 607
2 3300025935 Ga0207709_10009255 Ga0207709_100092554 611
3 3300048916 Ga0496113_0027415 Ga0496113_0027415_11_2212 632
4 3300005341 Ga0070691_10000054 Ga0070691_1000005422 656
5 3300045976 Ga0466967_0002706 Ga0466967_0002706_5918_8191 660
6 3300005983 Ga0081540_1002460 Ga0081540_100246016 672
7 3300046459 Ga0495629_0005185 Ga0495629_0005185_3522_5930 675
8 3300048912 Ga0496109_0054773 Ga0496109_0054773_440_2914 675
9 3300048914 Ga0496111_0019373 Ga0496111_0019373_222_2696 675
10 3300048913 Ga0496110_0042884 Ga0496110_0042884_1035_3509 676
11 3300048903 Ga0496100_0000038 Ga0496100_0000038_73101_75509 682
12 3300048904 Ga0496101_0000010 Ga0496101_0000010_4017_6425 682
13 3300048905 Ga0496102_0001245 Ga0496102_0001245_19619_22069 682
14 3300048909 Ga0496106_0000018 Ga0496106_0000018_66854_69262 682
15 3300048910 Ga0496107_0000032 Ga0496107_0000032_93472_95880 682
16 3300048920 Ga0496117_0039680 Ga0496117_0039680_487_2937 682
17 3300048921 Ga0496118_0026309 Ga0496118_0026309_2342_4792 682
18 3300005981 Ga0081538_10037195 Ga0081538_100371953 683
19 3300048088 Ga0495602_0000228 Ga0495602_0000228_11897_14332 687
20 3300048903 Ga0496100_0020612 Ga0496100_0020612_266_2638 687
21 3300046642 Ga0495634_0003347 Ga0495634_0003347_6471_8906 690
22 3300026142 Ga0207698_10008377 Ga0207698_100083772 692
23 3300049588 Ga0501072_0006551 Ga0501072_0006551_5794_8295 692
24 3300049741 Ga0501079_0003967 Ga0501079_0003967_4735_7236 692
25 3300049743 Ga0501081_0036759 Ga0501081_0036759_563_3064 692
26 3300054114 Ga0501084_0023555 Ga0501084_0023555_394_2895 692
27 3300048915 Ga0496112_0022462 Ga0496112_0022462_3389_5800 693
28 3300053085 Ga0495619_0000022 Ga0495619_0000022_139032_141425 694
29 3300046615 Ga0495656_0000581 Ga0495656_0000581_9400_11829 696
30 3300009101 Ga0105247_10003405 Ga0105247_100034055 697
31 3300013297 Ga0157378_10074133 Ga0157378_100741332 697
32 3300025900 Ga0207710_10000369 Ga0207710_100003696 697
33 3300006038 Ga0075365_10022998 Ga0075365_100229982 698
34 3300048906 Ga0496103_0023384 Ga0496103_0023384_967_3408 698
35 3300048911 Ga0496108_0000001 Ga0496108_0000001_371521_373950 698
36 3300048912 Ga0496109_0000003 Ga0496109_0000003_46067_48496 698
37 3300050492 nmdc:mga0yw44_8170_c1 nmdc:mga0yw44_8170_c1_307_2808 698
38 3300001979 JGI24740J21852_10002564 JGI24740J21852_100025647 699
39 3300047321 Ga0495676_0008140 Ga0495676_0008140_6537_8945 700
40 3300050515 nmdc:mga0a205_1439_c1 nmdc:mga0a205_1439_c1_3525_5849 700
41 3300005365 Ga0070688_100002866 Ga0070688_1000028664 701
42 3300005578 Ga0068854_100006441 Ga0068854_1000064414 701
43 3300025981 Ga0207640_10004530 Ga0207640_100045304 701
44 3300053077 Ga0495601_0000097 Ga0495601_0000097_4984_7419 701
45 3300005937 Ga0081455_10045954 Ga0081455_100459541 702
46 3300006847 Ga0075431_100029237 Ga0075431_1000292372 702
47 3300006880 Ga0075429_100067623 Ga0075429_1000676232 702
48 3300048924 Ga0496121_0017413 Ga0496121_0017413_80_2530 702
49 3300050510 nmdc:mga06r32_29855_c1 nmdc:mga06r32_29855_c1_1143_3638 702
50 3300048919 Ga0496116_0000819 Ga0496116_0000819_28120_30567 703
51 3300048922 Ga0496119_0007563 Ga0496119_0007563_7070_9517 703
52 3300049586 Ga0501070_0040151 Ga0501070_0040151_1276_3726 703
53 3300048916 Ga0496113_0000007 Ga0496113_0000007_80608_83019 704
54 3300005548 Ga0070665_100007985 Ga0070665_1000079855 705
55 3300005578 Ga0068854_100001335 Ga0068854_1000013354 705
56 3300025981 Ga0207640_10000285 Ga0207640_1000028521 705
57 3300026118 Ga0207675_100014368 Ga0207675_1000143684 705
58 3300028379 Ga0268266_10000553 Ga0268266_1000055346 705
59 3300046681 Ga0495647_0002454 Ga0495647_0002454_2021_4420 705
60 3300005329 Ga0070683_100017862 Ga0070683_1000178625 706
61 3300025944 Ga0207661_10002063 Ga0207661_100020637 706
62 3300005337 Ga0070682_100000080 Ga0070682_10000008070 707
63 3300005354 Ga0070675_100000058 Ga0070675_10000005862 707
64 3300005539 Ga0068853_100011379 Ga0068853_1000113792 707
65 3300005937 Ga0081455_10024864 Ga0081455_100248645 707
66 3300025926 Ga0207659_10000020 Ga0207659_1000002044 707
67 3300025927 Ga0207687_10003179 Ga0207687_100031797 707
68 3300026041 Ga0207639_10002123 Ga0207639_100021232 707
69 3300048911 Ga0496108_0014730 Ga0496108_0014730_374_2791 707
70 3300048911 Ga0496108_0050753 Ga0496108_0050753_980_3370 707
71 3300048912 Ga0496109_0000028 Ga0496109_0000028_143170_145587 707
72 3300048916 Ga0496113_0027029 Ga0496113_0027029_1624_4014 707
73 3300005436 Ga0070713_100001783 Ga0070713_1000017837 708
74 3300005618 Ga0068864_100000024 Ga0068864_100000024233 708
75 3300013307 Ga0157372_10016764 Ga0157372_100167643 708
76 3300025928 Ga0207700_10000070 Ga0207700_1000007043 708
77 3300026095 Ga0207676_10000048 Ga0207676_1000004820 708
78 3300046517 Ga0495630_0000018 Ga0495630_0000018_12436_14835 708
79 3300005329 Ga0070683_100029458 Ga0070683_1000294584 709
80 3300025944 Ga0207661_10010753 Ga0207661_100107534 709
81 3300026121 Ga0207683_10018592 Ga0207683_100185925 709
82 3300046517 Ga0495630_0000405 Ga0495630_0000405_7038_9524 709
83 3300046690 Ga0495624_0006706 Ga0495624_0006706_4065_6461 709
84 3300006175 Ga0070712_100010641 Ga0070712_1000106412 710
85 3300013297 Ga0157378_10005494 Ga0157378_100054942 710
86 3300025915 Ga0207693_10009297 Ga0207693_100092975 710
87 3300046511 Ga0495608_0000031 Ga0495608_0000031_19551_21950 710
88 3300046675 Ga0495657_0000024 Ga0495657_0000024_19551_21950 710
89 3300047444 Ga0495675_0000209 Ga0495675_0000209_19554_21953 710
90 3300048929 Ga0496126_0033977 Ga0496126_0033977_52_2502 710
91 3300053084 Ga0495595_0000014 Ga0495595_0000014_123306_125705 710
92 3300053085 Ga0495619_0000319 Ga0495619_0000319_11729_14128 710
93 3300005327 Ga0070658_10008167 Ga0070658_100081674 711
94 3300005338 Ga0068868_100005092 Ga0068868_1000050926 711
95 3300005339 Ga0070660_100000656 Ga0070660_1000006568 711
96 3300005366 Ga0070659_100005040 Ga0070659_1000050403 711
97 3300005441 Ga0070700_100000869 Ga0070700_1000008694 711
98 3300005455 Ga0070663_100008958 Ga0070663_1000089585 711
99 3300005548 Ga0070665_100046474 Ga0070665_1000464743 711
100 3300005719 Ga0068861_100018544 Ga0068861_1000185444 711
101 3300005834 Ga0068851_10001094 Ga0068851_100010947 711
102 3300005834 Ga0068851_10008651 Ga0068851_100086512 711
103 3300005981 Ga0081538_10000030 Ga0081538_1000003022 711
104 3300006038 Ga0075365_10017892 Ga0075365_100178922 711
105 3300009098 Ga0105245_10074423 Ga0105245_100744232 711
106 3300009553 Ga0105249_10010332 Ga0105249_100103325 711
107 3300013308 Ga0157375_10006986 Ga0157375_100069864 711
108 3300025321 Ga0207656_10000325 Ga0207656_100003257 711
109 3300025901 Ga0207688_10006995 Ga0207688_100069954 711
110 3300025919 Ga0207657_10004970 Ga0207657_1000497010 711
111 3300025927 Ga0207687_10023282 Ga0207687_100232822 711
112 3300025944 Ga0207661_10014223 Ga0207661_100142232 711
113 3300026067 Ga0207678_10000994 Ga0207678_1000099417 711
114 3300026075 Ga0207708_10002546 Ga0207708_100025469 711
115 3300026118 Ga0207675_100030730 Ga0207675_1000307304 711
116 3300026142 Ga0207698_10017631 Ga0207698_100176313 711
117 3300046461 Ga0495641_0025816 Ga0495641_0025816_28_2466 711
118 3300046529 Ga0495652_0003014 Ga0495652_0003014_13422_15860 711
119 3300048909 Ga0496106_0002210 Ga0496106_0002210_10534_13047 711
120 3300048912 Ga0496109_0001390 Ga0496109_0001390_14884_17397 711
121 3300049581 Ga0501047_0012915 Ga0501047_0012915_4173_6635 711
122 3300025986 Ga0207658_10005129 Ga0207658_100051294 712
123 3300046674 Ga0495588_0000198 Ga0495588_0000198_10774_13194 712
124 3300048908 Ga0496105_0017909 Ga0496105_0017909_2530_4962 712
125 3300048913 Ga0496110_0000033 Ga0496110_0000033_49312_51720 712
126 3300048914 Ga0496111_0000125 Ga0496111_0000125_10707_13115 712
127 3300049590 Ga0501074_0045390 Ga0501074_0045390_442_2895 712
128 3300049741 Ga0501079_0010723 Ga0501079_0010723_1712_4165 712
129 3300053078 Ga0495612_0000228 Ga0495612_0000228_12767_15196 712
130 3300053085 Ga0495619_0002408 Ga0495619_0002408_1007_3493 712
131 3300009098 Ga0105245_10006628 Ga0105245_100066284 713
132 3300009551 Ga0105238_10000023 Ga0105238_1000002327 713
133 3300013105 Ga0157369_10000099 Ga0157369_1000009912 713
134 3300025903 Ga0207680_10005067 Ga0207680_100050673 713
135 3300025924 Ga0207694_10000004 Ga0207694_10000004715 713
136 3300025927 Ga0207687_10000007 Ga0207687_10000007127 713
137 3300028379 Ga0268266_10000216 Ga0268266_1000021697 713
138 3300046689 Ga0495613_0007028 Ga0495613_0007028_1396_3831 713
139 3300048929 Ga0496126_0074659 Ga0496126_0074659_448_2913 713
140 3300049591 Ga0501075_0000407 Ga0501075_0000407_4016_6418 713
141 3300005455 Ga0070663_100027668 Ga0070663_1000276682 714
142 3300005530 Ga0070679_100003123 Ga0070679_10000312313 714
143 3300005937 Ga0081455_10015495 Ga0081455_100154953 714
144 3300025921 Ga0207652_10002646 Ga0207652_1000264613 714
145 3300026067 Ga0207678_10003121 Ga0207678_1000312113 714
146 3300046535 Ga0495586_0000871 Ga0495586_0000871_6413_8842 714
147 3300050492 nmdc:mga0yw44_6126_c1 nmdc:mga0yw44_6126_c1_24_2411 714
148 3300014326 Ga0157380_10001287 Ga0157380_1000128711 715
149 3300047317 Ga0495604_0000073 Ga0495604_0000073_1415_3850 715
150 3300048908 Ga0496105_0001456 Ga0496105_0001456_7797_10256 715
151 3300048928 Ga0496125_0045651 Ga0496125_0045651_14_2473 715
152 3300006852 Ga0075433_10000101 Ga0075433_1000010113 716
153 3300049568 Ga0501031_0006987 Ga0501031_0006987_837_3296 716
154 3300049569 Ga0501032_0008813 Ga0501032_0008813_4087_6546 716
155 3300049570 Ga0501033_0003746 Ga0501033_0003746_9105_11564 716
156 3300049571 Ga0501034_0018180 Ga0501034_0018180_980_3439 716
157 3300049573 Ga0501037_0008988 Ga0501037_0008988_776_3235 716
158 3300049574 Ga0501038_0014853 Ga0501038_0014853_4304_6763 716
159 3300049579 Ga0501043_0010860 Ga0501043_0010860_377_2836 716
160 3300049580 Ga0501046_0005068 Ga0501046_0005068_5270_7729 716
161 3300049581 Ga0501047_0000263 Ga0501047_0000263_58247_60706 716
162 3300049582 Ga0501048_0008113 Ga0501048_0008113_4509_6968 716
163 3300049586 Ga0501070_0011700 Ga0501070_0011700_3971_6430 716
164 3300049589 Ga0501073_0001391 Ga0501073_0001391_4453_6912 716
165 3300049590 Ga0501074_0009221 Ga0501074_0009221_762_3221 716
166 3300049742 Ga0501080_0074105 Ga0501080_0074105_370_2829 716
167 3300049744 Ga0501083_0013227 Ga0501083_0013227_112_2571 716
168 3300049822 Ga0501035_0012860 Ga0501035_0012860_980_3439 716
169 3300049823 Ga0501044_0006797 Ga0501044_0006797_980_3439 716
170 3300050515 nmdc:mga0a205_2175_c1 nmdc:mga0a205_2175_c1_12380_14785 716
171 3300053078 Ga0495612_0009307 Ga0495612_0009307_618_3014 716
172 3300060353 Ga0501082_0015415 Ga0501082_0015415_137_2596 716
173 3300005344 Ga0070661_100003829 Ga0070661_1000038296 717
174 3300025920 Ga0207649_10000640 Ga0207649_100006406 717
175 3300046507 Ga0495606_0000211 Ga0495606_0000211_47740_50136 717
176 3300046663 Ga0495635_0000042 Ga0495635_0000042_32976_35360 717
177 3300005329 Ga0070683_100004875 Ga0070683_1000048752 718
178 3300005937 Ga0081455_10049970 Ga0081455_100499702 718
179 3300006038 Ga0075365_10003588 Ga0075365_100035884 718
180 3300025944 Ga0207661_10002734 Ga0207661_1000273415 718
181 3300038443 Ga0395901_0023765 Ga0395901_0023765_3131_5596 718
182 3300046809 Ga0495600_0003287 Ga0495600_0003287_1379_3814 718
183 3300049581 Ga0501047_0049211 Ga0501047_0049211_1200_3665 718
184 3300048913 Ga0496110_0088341 Ga0496110_0088341_55_2478 719
185 3300053094 Ga0500566_0014140 Ga0500566_0014140_2223_4631 719
186 3300045976 Ga0466967_0000046 Ga0466967_0000046_23889_26303 720
187 3300048918 Ga0496115_0000020 Ga0496115_0000020_44000_46411 720
188 3300013308 Ga0157375_10005846 Ga0157375_100058466 721
189 3300046455 Ga0495603_0008807 Ga0495603_0008807_3661_6045 721
190 3300005439 Ga0070711_100010844 Ga0070711_1000108442 722
191 3300005456 Ga0070678_100001346 Ga0070678_1000013463 722
192 3300005544 Ga0070686_100025795 Ga0070686_1000257952 722
193 3300006175 Ga0070712_100004050 Ga0070712_1000040502 722
194 3300009098 Ga0105245_10002366 Ga0105245_1000236611 722
195 3300010375 Ga0105239_10136771 Ga0105239_101367711 722
196 3300025915 Ga0207693_10005072 Ga0207693_100050725 722
197 3300025916 Ga0207663_10003721 Ga0207663_100037212 722
198 3300025927 Ga0207687_10037903 Ga0207687_100379032 722
199 3300026023 Ga0207677_10051302 Ga0207677_100513022 722
200 3300026121 Ga0207683_10003046 Ga0207683_100030469 722
201 3300028556 Ga0265337_1000002 Ga0265337_1000002123 722
202 3300028558 Ga0265326_10000007 Ga0265326_10000007181 722
203 3300028654 Ga0265322_10000001 Ga0265322_10000001122 722
204 3300028666 Ga0265336_10001375 Ga0265336_100013753 722
205 3300029957 Ga0265324_10000263 Ga0265324_1000026315 722
206 3300031239 Ga0265328_10000841 Ga0265328_1000084112 722
207 3300031240 Ga0265320_10000002 Ga0265320_10000002122 722
208 3300031249 Ga0265339_10035244 Ga0265339_100352441 722
209 3300031250 Ga0265331_10003168 Ga0265331_100031685 722
210 3300031251 Ga0265327_10000011 Ga0265327_10000011122 722
211 3300031711 Ga0265314_10000058 Ga0265314_1000005829 722
212 3300046516 Ga0495628_0001939 Ga0495628_0001939_4198_6606 722
213 3300048905 Ga0496102_0015880 Ga0496102_0015880_2807_5224 722
214 3300048906 Ga0496103_0008247 Ga0496103_0008247_3135_5552 722
215 3300048910 Ga0496107_0002031 Ga0496107_0002031_7889_10306 722
216 3300048912 Ga0496109_0032357 Ga0496109_0032357_890_3307 722
217 3300048913 Ga0496110_0008950 Ga0496110_0008950_2605_5022 722
218 3300048915 Ga0496112_0044540 Ga0496112_0044540_813_3230 722
219 3300048918 Ga0496115_0007706 Ga0496115_0007706_3732_6149 722
220 3300053084 Ga0495595_0000126 Ga0495595_0000126_3971_6346 722
221 3300005530 Ga0070679_100001155 Ga0070679_10000115513 723
222 3300025921 Ga0207652_10000549 Ga0207652_1000054913 723
223 3300005329 Ga0070683_100112700 Ga0070683_1001127002 724
224 3300005356 Ga0070674_100000025 Ga0070674_10000002559 724
225 3300005457 Ga0070662_100000007 Ga0070662_100000007132 724
226 3300005459 Ga0068867_100001633 Ga0068867_10000163310 724
227 3300005547 Ga0070693_100007000 Ga0070693_1000070003 724
228 3300005718 Ga0068866_10000001 Ga0068866_10000001118 724
229 3300006847 Ga0075431_100005559 Ga0075431_1000055597 724
230 3300006871 Ga0075434_100079672 Ga0075434_1000796722 724
231 3300025899 Ga0207642_10000006 Ga0207642_10000006121 724
232 3300025899 Ga0207642_10000007 Ga0207642_10000007114 724
233 3300025933 Ga0207706_10000018 Ga0207706_1000001854 724
234 3300025937 Ga0207669_10000009 Ga0207669_10000009117 724
235 3300026089 Ga0207648_10000931 Ga0207648_1000093121 724
236 3300037312 Ga0395899_0029559 Ga0395899_0029559_751_3174 724
237 3300037466 Ga0395898_0007373 Ga0395898_0007373_3943_6366 724
238 3300037471 Ga0395905_0002784 Ga0395905_0002784_5262_7685 724
239 3300044694 Ga0466963_0000200 Ga0466963_0000200_18896_21307 724
240 3300046455 Ga0495603_0000023 Ga0495603_0000023_10648_13044 724
241 3300046499 Ga0495594_0000013 Ga0495594_0000013_45355_47757 724
242 3300047317 Ga0495604_0000038 Ga0495604_0000038_71625_74012 724
243 3300048910 Ga0496107_0014878 Ga0496107_0014878_137_2641 724
244 3300050512 nmdc:mga0n895_8439_c1 nmdc:mga0n895_8439_c1_6155_8578 724
245 3300050513 nmdc:mga0rr50_53610_c1 nmdc:mga0rr50_53610_c1_85_2517 724
246 3300009177 Ga0105248_10000032 Ga0105248_10000032124 725
247 3300014326 Ga0157380_10000138 Ga0157380_1000013828 725
248 3300025941 Ga0207711_10000020 Ga0207711_10000020250 725
249 3300046455 Ga0495603_0000203 Ga0495603_0000203_13431_15815 725
250 3300046459 Ga0495629_0050036 Ga0495629_0050036_445_2883 725
251 3300046533 Ga0495640_0007707 Ga0495640_0007707_2473_4866 725
252 3300046675 Ga0495657_0002675 Ga0495657_0002675_5743_8136 725
253 3300048911 Ga0496108_0021909 Ga0496108_0021909_1290_3701 725
254 3300048912 Ga0496109_0005722 Ga0496109_0005722_6453_8864 725
255 3300046454 Ga0495592_0000109 Ga0495592_0000109_33893_36289 726
256 3300046523 Ga0495644_0000602 Ga0495644_0000602_3877_6309 726
257 3300046529 Ga0495652_0000003 Ga0495652_0000003_25084_27510 726
258 3300046557 Ga0495622_0000014 Ga0495622_0000014_109486_111930 726
259 3300046681 Ga0495647_0000731 Ga0495647_0000731_3261_5657 726
260 3300047322 Ga0495680_0001225 Ga0495680_0001225_8264_10672 726
261 3300005338 Ga0068868_100002781 Ga0068868_10000278112 727
262 3300005340 Ga0070689_100041665 Ga0070689_1000416652 727
263 3300005364 Ga0070673_100016085 Ga0070673_1000160852 727
264 3300005365 Ga0070688_100032977 Ga0070688_1000329772 727
265 3300005466 Ga0070685_10000018 Ga0070685_1000001898 727
266 3300005548 Ga0070665_100000202 Ga0070665_10000020263 727
267 3300005842 Ga0068858_100017638 Ga0068858_1000176382 727
268 3300009098 Ga0105245_10000098 Ga0105245_100000986 727
269 3300009176 Ga0105242_10000530 Ga0105242_100005303 727
270 3300025927 Ga0207687_10000256 Ga0207687_1000025646 727
271 3300025936 Ga0207670_10007284 Ga0207670_100072843 727
272 3300026023 Ga0207677_10000046 Ga0207677_100000465 727
273 3300026035 Ga0207703_10000740 Ga0207703_100007407 727
274 3300026078 Ga0207702_10006752 Ga0207702_100067526 727
275 3300028379 Ga0268266_10000020 Ga0268266_10000020154 727
276 3300028563 Ga0265319_1000028 Ga0265319_1000028114 727
277 3300028800 Ga0265338_10000230 Ga0265338_1000023038 727
278 3300032126 Ga0307415_100001131 Ga0307415_10000113113 727
279 3300046461 Ga0495641_0000003 Ga0495641_0000003_112465_114873 727
280 3300046516 Ga0495628_0022653 Ga0495628_0022653_654_3062 727
281 3300046678 Ga0495599_0032554 Ga0495599_0032554_82_2490 727
282 3300047322 Ga0495680_0000196 Ga0495680_0000196_13176_15584 727
283 3300047446 Ga0495679_003919 Ga0495679_003919_3489_5897 727
284 3300048905 Ga0496102_0000584 Ga0496102_0000584_18547_20970 727
285 3300048906 Ga0496103_0000043 Ga0496103_0000043_91006_93429 727
286 3300048907 Ga0496104_0000576 Ga0496104_0000576_7242_9656 727
287 3300048908 Ga0496105_0003100 Ga0496105_0003100_5080_7494 727
288 3300048917 Ga0496114_0000014 Ga0496114_0000014_41798_44203 727
289 3300048918 Ga0496115_0000255 Ga0496115_0000255_35624_38029 727
290 3300048918 Ga0496115_0017571 Ga0496115_0017571_1808_4210 727
291 3300049824 Ga0501045_0039742 Ga0501045_0039742_966_3404 727
292 3300053077 Ga0495601_0000072 Ga0495601_0000072_21915_24323 727
293 3300053083 Ga0495655_0000011 Ga0495655_0000011_67285_69708 727
294 3300053123 Ga0500614_004439 Ga0500614_004439_285_2693 727
295 3300053129 Ga0500628_000058 Ga0500628_000058_15192_17615 727
296 3300005333 Ga0070677_10000001 Ga0070677_1000000134 728
297 3300005335 Ga0070666_10015658 Ga0070666_100156583 728
298 3300005337 Ga0070682_100000028 Ga0070682_10000002835 728
299 3300005366 Ga0070659_100012109 Ga0070659_1000121091 728
300 3300005543 Ga0070672_100000004 Ga0070672_10000000497 728
301 3300005616 Ga0068852_100000012 Ga0068852_100000012102 728
302 3300005841 Ga0068863_100000004 Ga0068863_100000004222 728
303 3300005842 Ga0068858_100000017 Ga0068858_10000001713 728
304 3300005842 Ga0068858_100024200 Ga0068858_1000242005 728
305 3300005983 Ga0081540_1000006 Ga0081540_100000695 728
306 3300006048 Ga0075363_100008573 Ga0075363_1000085732 728
307 3300006163 Ga0070715_10000001 Ga0070715_1000000192 728
308 3300006881 Ga0068865_100000101 Ga0068865_10000010126 728
309 3300009098 Ga0105245_10000969 Ga0105245_100009695 728
310 3300009553 Ga0105249_10000074 Ga0105249_1000007498 728
311 3300013296 Ga0157374_10008010 Ga0157374_100080101 728
312 3300013308 Ga0157375_10000194 Ga0157375_1000019441 728
313 3300017792 Ga0163161_10000032 Ga0163161_1000003210 728
314 3300025893 Ga0207682_10000053 Ga0207682_1000005316 728
315 3300025903 Ga0207680_10002853 Ga0207680_100028537 728
316 3300025905 Ga0207685_10000011 Ga0207685_1000001192 728
317 3300025927 Ga0207687_10000055 Ga0207687_1000005534 728
318 3300025938 Ga0207704_10000025 Ga0207704_10000025113 728
319 3300025940 Ga0207691_10000020 Ga0207691_1000002029 728
320 3300025961 Ga0207712_10000007 Ga0207712_10000007100 728
321 3300026035 Ga0207703_10000030 Ga0207703_1000003014 728
322 3300026088 Ga0207641_10000170 Ga0207641_1000017072 728
323 3300026142 Ga0207698_10000012 Ga0207698_10000012221 728
324 3300028381 Ga0268264_10007146 Ga0268264_100071465 728
325 3300044842 Ga0466957_0002421 Ga0466957_0002421_137_2584 728
326 3300046459 Ga0495629_0000218 Ga0495629_0000218_48555_50978 728
327 3300046473 Ga0495582_0000027 Ga0495582_0000027_13571_15994 728
328 3300046476 Ga0495662_0000131 Ga0495662_0000131_19133_21544 728
329 3300046514 Ga0495618_0000004 Ga0495618_0000004_205756_208167 728
330 3300046515 Ga0495620_0001873 Ga0495620_0001873_4041_6470 728
331 3300046516 Ga0495628_0000323 Ga0495628_0000323_15940_18369 728
332 3300046558 Ga0495633_0019147 Ga0495633_0019147_92_2497 728
333 3300046559 Ga0495667_0000075 Ga0495667_0000075_44999_47431 728
334 3300046642 Ga0495634_0000944 Ga0495634_0000944_8377_10806 728
335 3300046681 Ga0495647_0000007 Ga0495647_0000007_90664_93072 728
336 3300046683 Ga0495658_0000025 Ga0495658_0000025_13571_15994 728
337 3300046684 Ga0495669_0000436 Ga0495669_0000436_14961_17390 728
338 3300046689 Ga0495613_0000042 Ga0495613_0000042_22556_24967 728
339 3300046690 Ga0495624_0000009 Ga0495624_0000009_18068_20476 728
340 3300046690 Ga0495624_0020306 Ga0495624_0020306_436_2847 728
341 3300046809 Ga0495600_0006488 Ga0495600_0006488_3831_6242 728
342 3300047322 Ga0495680_0019926 Ga0495680_0019926_2829_5261 728
343 3300047447 Ga0495685_005801 Ga0495685_005801_549_2954 728
344 3300048088 Ga0495602_0007339 Ga0495602_0007339_8264_10693 728
345 3300048907 Ga0496104_0000013 Ga0496104_0000013_328069_330498 728
346 3300048908 Ga0496105_0000006 Ga0496105_0000006_66666_69095 728
347 3300048911 Ga0496108_0000045 Ga0496108_0000045_127626_130073 728
348 3300048912 Ga0496109_0000032 Ga0496109_0000032_7353_9800 728
349 3300048915 Ga0496112_0000003 Ga0496112_0000003_247915_250323 728
350 3300048916 Ga0496113_0012950 Ga0496113_0012950_14_2443 728
351 3300049578 Ga0501042_0022735 Ga0501042_0022735_677_3100 728
352 3300053085 Ga0495619_0000001 Ga0495619_0000001_194979_197405 728
353 3300009147 Ga0114129_10098206 Ga0114129_100982063 729
354 3300009176 Ga0105242_10000357 Ga0105242_1000035722 729
355 3300025934 Ga0207686_10000438 Ga0207686_1000043818 729
356 3300048907 Ga0496104_0000002 Ga0496104_0000002_655600_658047 729
357 3300048908 Ga0496105_0000001 Ga0496105_0000001_670132_672579 729
358 3300048922 Ga0496119_0011308 Ga0496119_0011308_3477_5924 729
359 3300036712 Ga0316584_0029947 Ga0316584_0029947_81_2594 730
360 3300001977 JGI24746J21847_1000829 JGI24746J21847_10008292 731
361 3300005614 Ga0068856_100011258 Ga0068856_1000112585 731
362 3300005981 Ga0081538_10000163 Ga0081538_100001636 731
363 3300005985 Ga0081539_10017744 Ga0081539_100177442 731
364 3300026078 Ga0207702_10000016 Ga0207702_10000016116 731
365 3300046660 Ga0495625_0000122 Ga0495625_0000122_111448_113919 731
366 3300048903 Ga0496100_0000002 Ga0496100_0000002_45031_47475 731
367 3300048904 Ga0496101_0000001 Ga0496101_0000001_45031_47475 731
368 3300048909 Ga0496106_0000022 Ga0496106_0000022_39311_41755 731
369 3300048910 Ga0496107_0000016 Ga0496107_0000016_124845_127289 731

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00122

E1-E2_ATPase

E1-E2 ATPase

98

279

0.99

PF08282

Hydrolase_3

haloacid dehalogenase-like hydrolase

529

583

0.92

PF00689

Cation_ATPase_C

Cation transporting ATPase, C-terminus

628

790

0.84

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

295

559

0.67

Feature Viewer

pLDDT pTM Quality
73.09 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map