F424966

General Info

Members Datasets Scaffolds Average Seq Length
369 199 738 133

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100337565|Ga0070707_1003375652
Length 138
Sequence MGDPGPKRRVEGLIPVPFESLDFVYHPSRDVKRDVAYFTDVLGGRLRFAVEGMGARVAAIELAPADHVKGGTPILVYRVPHLSKTLASLAKHGWEEEATFEIPHGPICSFRAPGGQRLAIYELTRPGAAATFEGRRDF

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
108 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
109 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
110 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
111 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
112 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
117 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
126 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
127 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
128 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
129 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
135 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
140 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
147 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 11.11
Rhizosphere 88.08
Stem 0
Stem Tuber 0
Unclassified 23.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100337565 3300005468 Bacteria 1464
2 Ga0070683_101351159 3300005329 Bacteria 685
3 Ga0070683_101391685 3300005329 Bacteria 674
4 Ga0070670_100423659 3300005331 Bacteria 1177
5 Ga0068869_100568182 3300005334 Unclassified 955
6 Ga0068868_100846542 3300005338 Bacteria 828
7 Ga0070660_100968773 3300005339 Unclassified 718
8 Ga0070660_101116986 3300005339 Unclassified 667
9 Ga0070691_10949909 3300005341 Unclassified 533
10 Ga0070692_10144162 3300005345 Bacteria 1351
11 Ga0070669_100511178 3300005353 Bacteria 997
12 Ga0070674_100059469 3300005356 Bacteria 2660
13 Ga0070714_100024526 3300005435 Bacteria 4968
14 Ga0070714_100119692 3300005435 Unclassified 2341
15 Ga0070714_101061452 3300005435 Unclassified 789
16 Ga0070714_101736721 3300005435 Bacteria 609
17 Ga0070713_100139233 3300005436 Unclassified 2148
18 Ga0070705_100473231 3300005440 Bacteria 945
19 Ga0070700_100087740 3300005441 Bacteria 2023
20 Ga0070708_100011906 3300005445 Bacteria 7084
21 Ga0070708_100095352 3300005445 Bacteria 2716
22 Ga0070708_100265630 3300005445 Bacteria 1613
23 Ga0070678_100032032 3300005456 Unclassified 3634
24 Ga0068867_100278995 3300005459 Bacteria 1370
25 Ga0070706_100013676 3300005467 Bacteria 7503
26 Ga0070706_100047549 3300005467 Bacteria 3959
27 Ga0070706_100237506 3300005467 Bacteria 1702
28 Ga0070706_100733345 3300005467 Unclassified 916
29 Ga0070707_100018347 3300005468 Bacteria 6583
30 Ga0070707_101076383 3300005468 Bacteria 770
31 Ga0070698_100000793 3300005471 Bacteria 34351
32 Ga0070698_100066830 3300005471 Bacteria 3616
33 Ga0070698_100078969 3300005471 Bacteria 3288
34 Ga0070698_100254739 3300005471 Bacteria 1687
35 Ga0070698_100712483 3300005471 Bacteria 946
36 Ga0070698_101245973 3300005471 Bacteria 693
37 Ga0070699_100060149 3300005518 Bacteria 3291
38 Ga0070699_100096380 3300005518 Bacteria 2591
39 Ga0070699_101405050 3300005518 Unclassified 640
40 Ga0070684_100645488 3300005535 Bacteria 985
41 Ga0070684_102137176 3300005535 Bacteria 528
42 Ga0070697_100000707 3300005536 Bacteria 24894
43 Ga0070697_100002346 3300005536 Bacteria 14560
44 Ga0070697_100692979 3300005536 Bacteria 899
45 Ga0070697_100735896 3300005536 Bacteria 871
46 Ga0070697_100759574 3300005536 Bacteria 857
47 Ga0070697_101144728 3300005536 Bacteria 693
48 Ga0070697_101320271 3300005536 Bacteria 644
49 Ga0070686_100275100 3300005544 Bacteria 1239
50 Ga0070686_101488955 3300005544 Unclassified 570
51 Ga0070696_100103390 3300005546 Unclassified 2044
52 Ga0070664_100359330 3300005564 Bacteria 1326
53 Ga0070664_101043580 3300005564 Unclassified 769
54 Ga0068854_100752106 3300005578 Bacteria 846
55 Ga0068856_100644927 3300005614 Bacteria 1080
56 Ga0070702_100677132 3300005615 Bacteria 783
57 Ga0070702_100772134 3300005615 Bacteria 740
58 Ga0068852_100845399 3300005616 Bacteria 931
59 Ga0068864_100249363 3300005618 Unclassified 1648
60 Ga0068861_100839486 3300005719 Bacteria 865
61 Ga0081455_10044868 3300005937 Bacteria 3851
62 Ga0081539_10033496 3300005985 Bacteria 3127
63 Ga0070717_10032507 3300006028 Bacteria 4205
64 Ga0075432_10009612 3300006058 Bacteria 3293
65 Ga0075432_10047734 3300006058 Bacteria 1505
66 Ga0075432_10522414 3300006058 Unclassified 532
67 Ga0070716_100016152 3300006173 Bacteria 3848
68 Ga0070716_100401434 3300006173 Bacteria 986
69 Ga0070712_101070781 3300006175 Unclassified 699
70 Ga0075428_100099569 3300006844 Bacteria 3169
71 Ga0075428_100133101 3300006844 Unclassified 2704
72 Ga0075428_100226094 3300006844 Bacteria 2020
73 Ga0075431_100132873 3300006847 Bacteria 2566
74 Ga0075434_100028369 3300006871 Bacteria 5499
75 Ga0075434_100057456 3300006871 Unclassified 3867
76 Ga0075434_100736734 3300006871 Bacteria 1003
77 Ga0075429_100060886 3300006880 Bacteria 3288
78 Ga0075429_101455856 3300006880 Bacteria 596
79 Ga0068865_100783176 3300006881 Unclassified 821
80 Ga0075435_100019502 3300007076 Bacteria 5182
81 Ga0111539_10062948 3300009094 Bacteria 4390
82 Ga0111539_10104224 3300009094 Bacteria 3328
83 Ga0111539_10537635 3300009094 Bacteria 1361
84 Ga0105245_10000966 3300009098 Bacteria 26196
85 Ga0105245_10208765 3300009098 Bacteria 1879
86 Ga0105245_11373720 3300009098 Bacteria 756
87 Ga0114129_10149625 3300009147 Bacteria 3195
88 Ga0114129_10159701 3300009147 Unclassified 3081
89 Ga0105243_10028866 3300009148 Bacteria 4262
90 Ga0105243_10095302 3300009148 Bacteria 2459
91 Ga0105242_10848924 3300009176 Unclassified 908
92 Ga0105248_10801617 3300009177 Unclassified 1063
93 Ga0105239_10021023 3300010375 Bacteria 7202
94 Ga0105246_10477372 3300011119 Unclassified 1054
95 Ga0157374_10036149 3300013296 Bacteria 4523
96 Ga0157374_10691092 3300013296 Unclassified 1033
97 Ga0157378_10158608 3300013297 Unclassified 2114
98 Ga0157378_11567756 3300013297 Unclassified 704
99 Ga0157378_12496179 3300013297 Unclassified 569
100 Ga0163162_10277078 3300013306 Bacteria 1809
101 Ga0157375_10907055 3300013308 Unclassified 1025
102 Ga0157375_11265265 3300013308 Bacteria 867
103 Ga0163163_10217502 3300014325 Bacteria 1959
104 Ga0163163_10239843 3300014325 Unclassified 1863
105 Ga0163163_10391760 3300014325 Bacteria 1447
106 Ga0163163_10827350 3300014325 Bacteria 989
107 Ga0157380_10332302 3300014326 Unclassified 1414
108 Ga0157380_10767582 3300014326 Unclassified 977
109 Ga0157379_10191401 3300014968 Unclassified 1849
110 Ga0157379_12305658 3300014968 Unclassified 536
111 Ga0207699_10200849 3300025906 Bacteria 1351
112 Ga0207684_10029887 3300025910 Bacteria 4639
113 Ga0207684_10167006 3300025910 Bacteria 1896
114 Ga0207684_10397803 3300025910 Bacteria 1184
115 Ga0207657_10871820 3300025919 Unclassified 694
116 Ga0207646_10008789 3300025922 Bacteria 10080
117 Ga0207646_10516579 3300025922 Bacteria 1075
118 Ga0207659_11549318 3300025926 Unclassified 566
119 Ga0207687_10011454 3300025927 Bacteria 5796
120 Ga0207687_11690386 3300025927 Bacteria 543
121 Ga0207700_10062502 3300025928 Unclassified 2829
122 Ga0207664_10028513 3300025929 Bacteria 4244
123 Ga0207664_10106150 3300025929 Unclassified 2328
124 Ga0207690_10824781 3300025932 Bacteria 767
125 Ga0207686_10071319 3300025934 Unclassified 2235
126 Ga0207709_10031729 3300025935 Bacteria 3089
127 Ga0207669_10007346 3300025937 Bacteria 5090
128 Ga0207704_10158051 3300025938 Bacteria 1609
129 Ga0207665_10141056 3300025939 Bacteria 1718
130 Ga0207665_10212503 3300025939 Bacteria 1414
131 Ga0207711_10641932 3300025941 Bacteria 990
132 Ga0207689_10892402 3300025942 Bacteria 750
133 Ga0207661_10457778 3300025944 Bacteria 1163
134 Ga0207679_10461105 3300025945 Bacteria 1128
135 Ga0207679_12132005 3300025945 Bacteria 509
136 Ga0207668_11624087 3300025972 Unclassified 584
137 Ga0207677_10073138 3300026023 Bacteria 2426
138 Ga0207708_10113349 3300026075 Bacteria 2107
139 Ga0207702_10967316 3300026078 Bacteria 844
140 Ga0207641_10538148 3300026088 Unclassified 1138
141 Ga0207648_10006294 3300026089 Bacteria 11813
142 Ga0207648_11184303 3300026089 Unclassified 717
143 Ga0207648_11952281 3300026089 Bacteria 548
144 Ga0207676_10285031 3300026095 Unclassified 1501
145 Ga0207683_10017759 3300026121 Bacteria 6067
146 Ga0207683_10086426 3300026121 Bacteria 2788
147 Ga0207698_10431685 3300026142 Bacteria 1267
148 Ga0209983_1021299 3300027665 Bacteria 1355
149 Ga0207428_10037671 3300027907 Bacteria 3934
150 Ga0207428_10296411 3300027907 Bacteria 1197
151 Ga0207428_10510020 3300027907 Bacteria 873
152 Ga0307408_100045631 3300031548 Bacteria 3131
153 Ga0307408_100115934 3300031548 Bacteria 2067
154 Ga0307405_10256162 3300031731 Unclassified 1304
155 Ga0307405_10292658 3300031731 Bacteria 1231
156 Ga0307410_10288851 3300031852 Bacteria 1290
157 Ga0307406_10122242 3300031901 Bacteria 1812
158 Ga0307406_10376640 3300031901 Unclassified 1117
159 Ga0307407_10063957 3300031903 Unclassified 2160
160 Ga0307412_10127103 3300031911 Unclassified 1845
161 Ga0307409_100034613 3300031995 Bacteria 3691
162 Ga0307409_100346743 3300031995 Unclassified 1399
163 Ga0307416_100052219 3300032002 Bacteria 3272
164 Ga0307416_100102305 3300032002 Bacteria 2497
165 Ga0307416_100601299 3300032002 Bacteria 1179
166 Ga0307416_101184210 3300032002 Bacteria 869
167 Ga0307411_10300214 3300032005 Unclassified 1287
168 Ga0307411_10387480 3300032005 Bacteria 1151
169 Ga0307415_100003459 3300032126 Bacteria 8039
170 Ga0307415_100013225 3300032126 Bacteria 4810
171 Ga0307415_100148907 3300032126 Bacteria 1799
172 Ga0307415_100591996 3300032126 Bacteria 985
173 Ga0307415_100611342 3300032126 Bacteria 971
174 Ga0373935_0456690 3300035692 Unclassified 923
175 Ga0373927_0679157 3300035695 Unclassified 680
176 Ga0373947_0006881 3300035725 Bacteria 6590
177 Ga0373925_0162183 3300037068 Bacteria 1761
178 Ga0395899_0331311 3300037312 Bacteria 1023
179 Ga0395900_0051528 3300037418 Bacteria 4239
180 Ga0395900_0123988 3300037418 Bacteria 2650
181 Ga0395900_0509336 3300037418 Bacteria 1153
182 Ga0395898_0043594 3300037466 Bacteria 4420
183 Ga0395898_0183545 3300037466 Bacteria 1999
184 Ga0395898_0907967 3300037466 Unclassified 819
185 Ga0395905_0086252 3300037471 Bacteria 2942
186 Ga0395905_0457060 3300037471 Bacteria 1175
187 Ga0395901_0107792 3300038443 Bacteria 2924
188 Ga0395901_0281181 3300038443 Bacteria 1729
189 Ga0395901_0648691 3300038443 Bacteria 1059
190 Ga0451798_0524296 3300041458 Unclassified 893
191 Ga0451800_0790779 3300041459 Bacteria 770
192 Ga0451851_0046736 3300041507 Bacteria 620
193 Ga0451853_2563032 3300041512 Unclassified 1303
194 Ga0439448_0084603 3300042005 Bacteria 1068
195 Ga0439459_0037404 3300042438 Bacteria 1017
196 Ga0451577_0055582 3300042876 Bacteria 3531
197 Ga0439440_0042302 3300042993 Bacteria 1114
198 Ga0453684_1361899 3300044712 Bacteria 738
199 Ga0495617_125402 3300046452 Unclassified 826
200 Ga0495627_079463 3300046453 Bacteria 952
201 Ga0495592_0105265 3300046454 Bacteria 2004
202 Ga0495603_0133111 3300046455 Unclassified 1447
203 Ga0495629_0000311 3300046459 Bacteria 41767
204 Ga0495629_0561724 3300046459 Unclassified 765
205 Ga0495629_0920435 3300046459 Bacteria 572
206 Ga0495641_0065817 3300046461 Bacteria 1631
207 Ga0495641_0218254 3300046461 Unclassified 855
208 Ga0495651_0047656 3300046462 Bacteria 3312
209 Ga0495580_0054203 3300046472 Bacteria 2829
210 Ga0495582_0001098 3300046473 Bacteria 15184
211 Ga0495605_0074099 3300046474 Bacteria 1603
212 Ga0495639_0002204 3300046475 Bacteria 8577
213 Ga0495662_0131038 3300046476 Bacteria 1233
214 Ga0495585_0088644 3300046492 Bacteria 1669
215 Ga0495607_0113289 3300046501 Bacteria 1435
216 Ga0495608_0361414 3300046511 Unclassified 892
217 Ga0495618_0171094 3300046514 Bacteria 1382
218 Ga0495628_0106263 3300046516 Bacteria 2162
219 Ga0495630_0041193 3300046517 Bacteria 3449
220 Ga0495630_0254736 3300046517 Unclassified 1341
221 Ga0495644_0200991 3300046523 Bacteria 768
222 Ga0495642_0064775 3300046528 Bacteria 1521
223 Ga0495665_0112838 3300046531 Bacteria 1425
224 Ga0495640_0294527 3300046533 Unclassified 1009
225 Ga0495586_0840198 3300046535 Bacteria 529
226 Ga0495598_0005320 3300046537 Bacteria 2845
227 Ga0495609_0103424 3300046538 Unclassified 1233
228 Ga0495645_0101247 3300046543 Bacteria 2048
229 Ga0495645_0838805 3300046543 Unclassified 549
230 Ga0495656_0150756 3300046615 Bacteria 1123
231 Ga0495634_0213842 3300046642 Bacteria 1192
232 Ga0495634_0680373 3300046642 Bacteria 593
233 Ga0495659_0335884 3300046664 Bacteria 643
234 Ga0495588_0062837 3300046674 Unclassified 1925
235 Ga0495588_0191298 3300046674 Unclassified 1081
236 Ga0495647_0013527 3300046681 Bacteria 2829
237 Ga0495647_0149525 3300046681 Unclassified 1000
238 Ga0495658_0002301 3300046683 Bacteria 9634
239 Ga0495658_0100295 3300046683 Bacteria 1728
240 Ga0495658_0246016 3300046683 Bacteria 1124
241 Ga0495581_0003795 3300047315 Bacteria 8694
242 Ga0495674_0464225 3300047319 Bacteria 1016
243 Ga0495676_0030314 3300047321 Bacteria 4594
244 Ga0495676_0371607 3300047321 Unclassified 953
245 Ga0495680_0110800 3300047322 Bacteria 2034
246 Ga0495677_0095826 3300047445 Bacteria 1121
247 Ga0495677_0325473 3300047445 Bacteria 606
248 Ga0496100_0138484 3300048903 Bacteria 1722
249 Ga0496104_0102149 3300048907 Bacteria 2746
250 Ga0496104_0105431 3300048907 Bacteria 2701
251 Ga0496104_0173251 3300048907 Bacteria 2068
252 Ga0496104_0251997 3300048907 Bacteria 1678
253 Ga0496104_0563617 3300048907 Unclassified 1050
254 Ga0496104_1103662 3300048907 Unclassified 697
255 Ga0496105_0054134 3300048908 Bacteria 3313
256 Ga0496105_0111517 3300048908 Unclassified 2257
257 Ga0496105_0418392 3300048908 Unclassified 1061
258 Ga0496106_0108622 3300048909 Bacteria 2158
259 Ga0496108_0008794 3300048911 Bacteria 8185
260 Ga0496108_0216365 3300048911 Bacteria 1664
261 Ga0496108_0342914 3300048911 Unclassified 1303
262 Ga0496108_0381392 3300048911 Unclassified 1231
263 Ga0496108_0708755 3300048911 Bacteria 872
264 Ga0496108_0740470 3300048911 Bacteria 851
265 Ga0496109_0001649 3300048912 Bacteria 18646
266 Ga0496109_0002753 3300048912 Bacteria 14742
267 Ga0496109_0031507 3300048912 Bacteria 4758
268 Ga0496109_0091464 3300048912 Bacteria 2814
269 Ga0496109_0092807 3300048912 Bacteria 2792
270 Ga0496109_0347035 3300048912 Bacteria 1402
271 Ga0496110_0126560 3300048913 Bacteria 2305
272 Ga0496110_0671142 3300048913 Bacteria 937
273 Ga0496111_0011953 3300048914 Bacteria 5867
274 Ga0496111_0068221 3300048914 Bacteria 2584
275 Ga0496111_0353966 3300048914 Bacteria 1087
276 Ga0496112_0055758 3300048915 Bacteria 3887
277 Ga0496112_0244622 3300048915 Bacteria 1746
278 Ga0496112_0462937 3300048915 Bacteria 1205
279 Ga0496112_1104310 3300048915 Bacteria 711
280 Ga0496113_0012749 3300048916 Bacteria 5662
281 Ga0496113_0016967 3300048916 Bacteria 5041
282 Ga0496113_0090509 3300048916 Bacteria 2357
283 Ga0496113_0451995 3300048916 Bacteria 1032
284 Ga0496113_0931478 3300048916 Bacteria 686
285 Ga0496114_0090834 3300048917 Bacteria 2593
286 Ga0496114_0580209 3300048917 Bacteria 990
287 Ga0501031_0170376 3300049568 Bacteria 1423
288 Ga0501032_0431635 3300049569 Bacteria 845
289 Ga0501032_0484497 3300049569 Bacteria 791
290 Ga0501033_0919608 3300049570 Bacteria 587
291 Ga0501036_0068439 3300049572 Bacteria 3005
292 Ga0501036_0268176 3300049572 Bacteria 1430
293 Ga0501036_0619394 3300049572 Unclassified 897
294 Ga0501038_0141402 3300049574 Bacteria 1969
295 Ga0501038_0258605 3300049574 Bacteria 1377
296 Ga0501039_0873243 3300049575 Bacteria 701
297 Ga0501040_0120119 3300049576 Bacteria 1844
298 Ga0501040_0457616 3300049576 Bacteria 919
299 Ga0501041_0502728 3300049577 Bacteria 771
300 Ga0501042_0491042 3300049578 Bacteria 891
301 Ga0501043_0699250 3300049579 Bacteria 741
302 Ga0501046_0602557 3300049580 Bacteria 779
303 Ga0501046_0711390 3300049580 Bacteria 707
304 Ga0501046_0765261 3300049580 Bacteria 678
305 Ga0501048_0443883 3300049582 Bacteria 929
306 Ga0501048_0746257 3300049582 Unclassified 703
307 Ga0501068_0160981 3300049584 Unclassified 1415
308 Ga0501068_0310601 3300049584 Unclassified 1010
309 Ga0501071_0008639 3300049587 Bacteria 6734
310 Ga0501071_0050773 3300049587 Bacteria 2988
311 Ga0501071_0083843 3300049587 Bacteria 2335
312 Ga0501071_0378700 3300049587 Bacteria 1079
313 Ga0501072_0060449 3300049588 Bacteria 2988
314 Ga0501072_0154211 3300049588 Bacteria 1832
315 Ga0501072_0253688 3300049588 Bacteria 1401
316 Ga0501072_0351406 3300049588 Bacteria 1170
317 Ga0501072_0351436 3300049588 Bacteria 1170
318 Ga0501074_0602961 3300049590 Bacteria 777
319 Ga0501074_0826794 3300049590 Bacteria 652
320 Ga0501075_0130174 3300049591 Bacteria 1917
321 Ga0501075_0168444 3300049591 Bacteria 1671
322 Ga0501075_0224215 3300049591 Bacteria 1434
323 Ga0501075_0244361 3300049591 Unclassified 1368
324 Ga0501075_1310895 3300049591 Unclassified 549
325 Ga0501076_0016441 3300049592 Bacteria 5610
326 Ga0501076_0081038 3300049592 Bacteria 2606
327 Ga0501076_0146807 3300049592 Bacteria 1918
328 Ga0501076_0171974 3300049592 Bacteria 1766
329 Ga0501076_0261123 3300049592 Bacteria 1418
330 Ga0501077_0133432 3300049593 Bacteria 1575
331 Ga0501077_0226606 3300049593 Bacteria 1188
332 Ga0501077_0300651 3300049593 Bacteria 1022
333 Ga0501077_0818511 3300049593 Unclassified 599
334 Ga0501079_0022422 3300049741 Bacteria 4842
335 Ga0501079_0029858 3300049741 Bacteria 4188
336 Ga0501079_0783673 3300049741 Bacteria 750
337 Ga0501080_0230505 3300049742 Bacteria 1693
338 Ga0501080_0600578 3300049742 Bacteria 977
339 Ga0501081_0021130 3300049743 Bacteria 4344
340 Ga0501081_0880584 3300049743 Bacteria 675
341 Ga0501035_0609399 3300049822 Bacteria 889
342 Ga0501045_0107056 3300049824 Bacteria 2072
343 Ga0501045_0191135 3300049824 Bacteria 1526
344 Ga0501045_0316759 3300049824 Bacteria 1161
345 Ga0501045_0769151 3300049824 Unclassified 709
346 nmdc:mga06z11_369080_c1 3300050494 Unclassified 861
347 nmdc:mga05p37_1323746_c1 3300050507 Bacteria 732
348 nmdc:mga05p37_133878_c1 3300050507 Unclassified 3040
349 nmdc:mga05p37_40343_c1 3300050507 Bacteria 5732
350 nmdc:mga09592_678333_c1 3300050508 Bacteria 878
351 nmdc:mga08y16_263716_c1 3300050511 Bacteria 1779
352 nmdc:mga08y16_32444_c1 3300050511 Bacteria 5490
353 nmdc:mga08y16_439270_c1 3300050511 Bacteria 1332
354 nmdc:mga08y16_97079_c1 3300050511 Bacteria 3069
355 nmdc:mga0n895_176620_c1 3300050512 Unclassified 2166
356 nmdc:mga0n895_41522_c1 3300050512 Bacteria 4473
357 nmdc:mga08x19_111124_c1 3300050514 Bacteria 1828
358 Ga0495601_0000812 3300053077 Bacteria 16905
359 Ga0495601_0135110 3300053077 Archaea 1608
360 Ga0495595_0024581 3300053084 Bacteria 2662
361 Ga0495619_0077112 3300053085 Bacteria 2238
362 Ga0501084_0259932 3300054114 Bacteria 1466
363 Ga0501084_0448105 3300054114 Bacteria 1091
364 Ga0501084_0454086 3300054114 Unclassified 1083
365 Ga0501084_1136874 3300054114 Bacteria 655
366 Ga0501082_0821004 3300060353 Bacteria 813
367 Ga0501082_1109922 3300060353 Bacteria 691
368 Ga0530510_0207354 3300061734 Unclassified 1456
369 Ga0530510_1366205 3300061734 Unclassified 543
370 Ga0070707_100337565
371 Ga0070683_101351159
372 Ga0070683_101391685
373 Ga0070670_100423659
374 Ga0068869_100568182
375 Ga0068868_100846542
376 Ga0070660_100968773
377 Ga0070660_101116986
378 Ga0070691_10949909
379 Ga0070692_10144162
380 Ga0070669_100511178
381 Ga0070674_100059469
382 Ga0070714_100024526
383 Ga0070714_100119692
384 Ga0070714_101061452
385 Ga0070714_101736721
386 Ga0070713_100139233
387 Ga0070705_100473231
388 Ga0070700_100087740
389 Ga0070708_100011906
390 Ga0070708_100095352
391 Ga0070708_100265630
392 Ga0070678_100032032
393 Ga0068867_100278995
394 Ga0070706_100013676
395 Ga0070706_100047549
396 Ga0070706_100237506
397 Ga0070706_100733345
398 Ga0070707_100018347
399 Ga0070707_101076383
400 Ga0070698_100000793
401 Ga0070698_100066830
402 Ga0070698_100078969
403 Ga0070698_100254739
404 Ga0070698_100712483
405 Ga0070698_101245973
406 Ga0070699_100060149
407 Ga0070699_100096380
408 Ga0070699_101405050
409 Ga0070684_100645488
410 Ga0070684_102137176
411 Ga0070697_100000707
412 Ga0070697_100002346
413 Ga0070697_100692979
414 Ga0070697_100735896
415 Ga0070697_100759574
416 Ga0070697_101144728
417 Ga0070697_101320271
418 Ga0070686_100275100
419 Ga0070686_101488955
420 Ga0070696_100103390
421 Ga0070664_100359330
422 Ga0070664_101043580
423 Ga0068854_100752106
424 Ga0068856_100644927
425 Ga0070702_100677132
426 Ga0070702_100772134
427 Ga0068852_100845399
428 Ga0068864_100249363
429 Ga0068861_100839486
430 Ga0081455_10044868
431 Ga0081539_10033496
432 Ga0070717_10032507
433 Ga0075432_10009612
434 Ga0075432_10047734
435 Ga0075432_10522414
436 Ga0070716_100016152
437 Ga0070716_100401434
438 Ga0070712_101070781
439 Ga0075428_100099569
440 Ga0075428_100133101
441 Ga0075428_100226094
442 Ga0075431_100132873
443 Ga0075434_100028369
444 Ga0075434_100057456
445 Ga0075434_100736734
446 Ga0075429_100060886
447 Ga0075429_101455856
448 Ga0068865_100783176
449 Ga0075435_100019502
450 Ga0111539_10062948
451 Ga0111539_10104224
452 Ga0111539_10537635
453 Ga0105245_10000966
454 Ga0105245_10208765
455 Ga0105245_11373720
456 Ga0114129_10149625
457 Ga0114129_10159701
458 Ga0105243_10028866
459 Ga0105243_10095302
460 Ga0105242_10848924
461 Ga0105248_10801617
462 Ga0105239_10021023
463 Ga0105246_10477372
464 Ga0157374_10036149
465 Ga0157374_10691092
466 Ga0157378_10158608
467 Ga0157378_11567756
468 Ga0157378_12496179
469 Ga0163162_10277078
470 Ga0157375_10907055
471 Ga0157375_11265265
472 Ga0163163_10217502
473 Ga0163163_10239843
474 Ga0163163_10391760
475 Ga0163163_10827350
476 Ga0157380_10332302
477 Ga0157380_10767582
478 Ga0157379_10191401
479 Ga0157379_12305658
480 Ga0207699_10200849
481 Ga0207684_10029887
482 Ga0207684_10167006
483 Ga0207684_10397803
484 Ga0207657_10871820
485 Ga0207646_10008789
486 Ga0207646_10516579
487 Ga0207659_11549318
488 Ga0207687_10011454
489 Ga0207687_11690386
490 Ga0207700_10062502
491 Ga0207664_10028513
492 Ga0207664_10106150
493 Ga0207690_10824781
494 Ga0207686_10071319
495 Ga0207709_10031729
496 Ga0207669_10007346
497 Ga0207704_10158051
498 Ga0207665_10141056
499 Ga0207665_10212503
500 Ga0207711_10641932
501 Ga0207689_10892402
502 Ga0207661_10457778
503 Ga0207679_10461105
504 Ga0207679_12132005
505 Ga0207668_11624087
506 Ga0207677_10073138
507 Ga0207708_10113349
508 Ga0207702_10967316
509 Ga0207641_10538148
510 Ga0207648_10006294
511 Ga0207648_11184303
512 Ga0207648_11952281
513 Ga0207676_10285031
514 Ga0207683_10017759
515 Ga0207683_10086426
516 Ga0207698_10431685
517 Ga0209983_1021299
518 Ga0207428_10037671
519 Ga0207428_10296411
520 Ga0207428_10510020
521 Ga0307408_100045631
522 Ga0307408_100115934
523 Ga0307405_10256162
524 Ga0307405_10292658
525 Ga0307410_10288851
526 Ga0307406_10122242
527 Ga0307406_10376640
528 Ga0307407_10063957
529 Ga0307412_10127103
530 Ga0307409_100034613
531 Ga0307409_100346743
532 Ga0307416_100052219
533 Ga0307416_100102305
534 Ga0307416_100601299
535 Ga0307416_101184210
536 Ga0307411_10300214
537 Ga0307411_10387480
538 Ga0307415_100003459
539 Ga0307415_100013225
540 Ga0307415_100148907
541 Ga0307415_100591996
542 Ga0307415_100611342
543 Ga0373935_0456690
544 Ga0373927_0679157
545 Ga0373947_0006881
546 Ga0373925_0162183
547 Ga0395899_0331311
548 Ga0395900_0051528
549 Ga0395900_0123988
550 Ga0395900_0509336
551 Ga0395898_0043594
552 Ga0395898_0183545
553 Ga0395898_0907967
554 Ga0395905_0086252
555 Ga0395905_0457060
556 Ga0395901_0107792
557 Ga0395901_0281181
558 Ga0395901_0648691
559 Ga0451798_0524296
560 Ga0451800_0790779
561 Ga0451851_0046736
562 Ga0451853_2563032
563 Ga0439448_0084603
564 Ga0439459_0037404
565 Ga0451577_0055582
566 Ga0439440_0042302
567 Ga0453684_1361899
568 Ga0495617_125402
569 Ga0495627_079463
570 Ga0495592_0105265
571 Ga0495603_0133111
572 Ga0495629_0000311
573 Ga0495629_0561724
574 Ga0495629_0920435
575 Ga0495641_0065817
576 Ga0495641_0218254
577 Ga0495651_0047656
578 Ga0495580_0054203
579 Ga0495582_0001098
580 Ga0495605_0074099
581 Ga0495639_0002204
582 Ga0495662_0131038
583 Ga0495585_0088644
584 Ga0495607_0113289
585 Ga0495608_0361414
586 Ga0495618_0171094
587 Ga0495628_0106263
588 Ga0495630_0041193
589 Ga0495630_0254736
590 Ga0495644_0200991
591 Ga0495642_0064775
592 Ga0495665_0112838
593 Ga0495640_0294527
594 Ga0495586_0840198
595 Ga0495598_0005320
596 Ga0495609_0103424
597 Ga0495645_0101247
598 Ga0495645_0838805
599 Ga0495656_0150756
600 Ga0495634_0213842
601 Ga0495634_0680373
602 Ga0495659_0335884
603 Ga0495588_0062837
604 Ga0495588_0191298
605 Ga0495647_0013527
606 Ga0495647_0149525
607 Ga0495658_0002301
608 Ga0495658_0100295
609 Ga0495658_0246016
610 Ga0495581_0003795
611 Ga0495674_0464225
612 Ga0495676_0030314
613 Ga0495676_0371607
614 Ga0495680_0110800
615 Ga0495677_0095826
616 Ga0495677_0325473
617 Ga0496100_0138484
618 Ga0496104_0102149
619 Ga0496104_0105431
620 Ga0496104_0173251
621 Ga0496104_0251997
622 Ga0496104_0563617
623 Ga0496104_1103662
624 Ga0496105_0054134
625 Ga0496105_0111517
626 Ga0496105_0418392
627 Ga0496106_0108622
628 Ga0496108_0008794
629 Ga0496108_0216365
630 Ga0496108_0342914
631 Ga0496108_0381392
632 Ga0496108_0708755
633 Ga0496108_0740470
634 Ga0496109_0001649
635 Ga0496109_0002753
636 Ga0496109_0031507
637 Ga0496109_0091464
638 Ga0496109_0092807
639 Ga0496109_0347035
640 Ga0496110_0126560
641 Ga0496110_0671142
642 Ga0496111_0011953
643 Ga0496111_0068221
644 Ga0496111_0353966
645 Ga0496112_0055758
646 Ga0496112_0244622
647 Ga0496112_0462937
648 Ga0496112_1104310
649 Ga0496113_0012749
650 Ga0496113_0016967
651 Ga0496113_0090509
652 Ga0496113_0451995
653 Ga0496113_0931478
654 Ga0496114_0090834
655 Ga0496114_0580209
656 Ga0501031_0170376
657 Ga0501032_0431635
658 Ga0501032_0484497
659 Ga0501033_0919608
660 Ga0501036_0068439
661 Ga0501036_0268176
662 Ga0501036_0619394
663 Ga0501038_0141402
664 Ga0501038_0258605
665 Ga0501039_0873243
666 Ga0501040_0120119
667 Ga0501040_0457616
668 Ga0501041_0502728
669 Ga0501042_0491042
670 Ga0501043_0699250
671 Ga0501046_0602557
672 Ga0501046_0711390
673 Ga0501046_0765261
674 Ga0501048_0443883
675 Ga0501048_0746257
676 Ga0501068_0160981
677 Ga0501068_0310601
678 Ga0501071_0008639
679 Ga0501071_0050773
680 Ga0501071_0083843
681 Ga0501071_0378700
682 Ga0501072_0060449
683 Ga0501072_0154211
684 Ga0501072_0253688
685 Ga0501072_0351406
686 Ga0501072_0351436
687 Ga0501074_0602961
688 Ga0501074_0826794
689 Ga0501075_0130174
690 Ga0501075_0168444
691 Ga0501075_0224215
692 Ga0501075_0244361
693 Ga0501075_1310895
694 Ga0501076_0016441
695 Ga0501076_0081038
696 Ga0501076_0146807
697 Ga0501076_0171974
698 Ga0501076_0261123
699 Ga0501077_0133432
700 Ga0501077_0226606
701 Ga0501077_0300651
702 Ga0501077_0818511
703 Ga0501079_0022422
704 Ga0501079_0029858
705 Ga0501079_0783673
706 Ga0501080_0230505
707 Ga0501080_0600578
708 Ga0501081_0021130
709 Ga0501081_0880584
710 Ga0501035_0609399
711 Ga0501045_0107056
712 Ga0501045_0191135
713 Ga0501045_0316759
714 Ga0501045_0769151
715 nmdc:mga06z11_369080_c1
716 nmdc:mga05p37_1323746_c1
717 nmdc:mga05p37_133878_c1
718 nmdc:mga05p37_40343_c1
719 nmdc:mga09592_678333_c1
720 nmdc:mga08y16_263716_c1
721 nmdc:mga08y16_32444_c1
722 nmdc:mga08y16_439270_c1
723 nmdc:mga08y16_97079_c1
724 nmdc:mga0n895_176620_c1
725 nmdc:mga0n895_41522_c1
726 nmdc:mga08x19_111124_c1
727 Ga0495601_0000812
728 Ga0495601_0135110
729 Ga0495595_0024581
730 Ga0495619_0077112
731 Ga0501084_0259932
732 Ga0501084_0448105
733 Ga0501084_0454086
734 Ga0501084_1136874
735 Ga0501082_0821004
736 Ga0501082_1109922
737 Ga0530510_0207354
738 Ga0530510_1366205

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oa4-assembly1.cif.gz_A-2 crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125 0.8092 11 123
5ywg-assembly1.cif.gz_A crystal structure of arabidopsis thaliana hppd complexed with mesotrione 0.8083 6 122
6qh4-assembly2.cif.gz_B crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant 0.808 9 120
5ywk-assembly1.cif.gz_B crystal structure of arabidopsis thaliana hppd complexed with benquitrione-methyl 0.8065 6 122
5xgk-assembly2.cif.gz_D crystal structure of arabidopsis thaliana 4-hydroxyphenylpyruvate dioxygenase (athppd) complexed with its substrate 4-hydroxyphenylpyruvate acid (hppa) 0.8048 6 121
ID Description Score Start End Superfamily
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8608 10 64 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8581 72 123 3.30.720.110
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8114 11 120 3.10.180.10
af_I6XA34_134_256_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8111 11 122 3.10.180.10
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.809 72 123 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A536I0V4-F1-model_v4 VOC family protein 0.9922 9 77
AF-A0A535Z3E1-F1-model_v4 VOC domain-containing protein 0.9786 9 136
AF-A0A536BT00-F1-model_v4 VOC domain-containing protein 0.9728 9 136
AF-A0A1Q7UN43-F1-model_v4 VOC domain-containing protein 0.9655 9 136
AF-A0A536NPZ1-F1-model_v4 VOC family protein 0.964 4 136

Map