F424839

General Info

Members Datasets Scaffolds Average Seq Length
368 251 736 162

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0094594|Ga0501033_0094594_322_909
Length 195
Sequence LQPHGWGRVTRLGEQRLSVKDYAIDKSGKEHDMDDAFDPAQHKRYETRWFEDFAVGEKFILPSRTMTDAIFLAFQAASGDNHPIHYDIEFCRARGMPHMLAHGYQILIQTAAGAGTFPFMTEDSLIGFLDQSSKFLAPVYVGDTLYGTLIIDEVKPGRTTGVVGMRTTVHNQNRKLVLEGTQRYLLRKRPAPTVA

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
130 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
131 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
135 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
136 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
137 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
157 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
158 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
225 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
226 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
227 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
229 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
241 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
244 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
245 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
246 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
247 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
251 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.43
Nodule 0
Rhizoplane 6.52
Rhizosphere 84.51
Stem 0
Stem Tuber 0
Unclassified 13.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0094594 3300049570 Bacteria 2185
2 Ga0070676_10226493 3300005328 Unclassified 1237
3 Ga0070683_100006154 3300005329 Bacteria 10062
4 Ga0070683_100037914 3300005329 Bacteria 4415
5 Ga0070680_100297820 3300005336 Bacteria 1367
6 Ga0070682_100371495 3300005337 Bacteria 1072
7 Ga0070682_100559645 3300005337 Bacteria 896
8 Ga0070660_100470002 3300005339 Bacteria 1044
9 Ga0070668_100242581 3300005347 Bacteria 1493
10 Ga0070673_100642542 3300005364 Bacteria 971
11 Ga0070673_101220157 3300005364 Bacteria 705
12 Ga0070688_100176120 3300005365 Bacteria 1480
13 Ga0070659_100715774 3300005366 Bacteria 866
14 Ga0070709_10035849 3300005434 Bacteria 3017
15 Ga0070714_100030255 3300005435 Bacteria 4505
16 Ga0070714_100061240 3300005435 Bacteria 3232
17 Ga0070713_100000902 3300005436 Bacteria 19026
18 Ga0070713_100157752 3300005436 Bacteria 2024
19 Ga0070713_100348233 3300005436 Bacteria 1374
20 Ga0070710_10079626 3300005437 Bacteria 1910
21 Ga0070701_10375408 3300005438 Bacteria 895
22 Ga0070711_100710392 3300005439 Bacteria 847
23 Ga0070700_100122554 3300005441 Unclassified 1744
24 Ga0070663_100040643 3300005455 Bacteria 3257
25 Ga0070678_100039282 3300005456 Bacteria 3337
26 Ga0070662_100721304 3300005457 Bacteria 844
27 Ga0070681_10062944 3300005458 Bacteria 3682
28 Ga0070681_11131077 3300005458 Bacteria 704
29 Ga0068867_101487711 3300005459 Unclassified 630
30 Ga0070685_10458104 3300005466 Bacteria 895
31 Ga0070706_100011221 3300005467 Bacteria 8321
32 Ga0070707_100311894 3300005468 Bacteria 1529
33 Ga0070707_100419330 3300005468 Unclassified 1299
34 Ga0070698_100006487 3300005471 Bacteria 12691
35 Ga0070699_100101469 3300005518 Bacteria 2522
36 Ga0070679_100063924 3300005530 Bacteria 3667
37 Ga0070679_100078947 3300005530 Bacteria 3280
38 Ga0070684_100028558 3300005535 Bacteria 4720
39 Ga0070684_101226389 3300005535 Bacteria 705
40 Ga0070697_101077142 3300005536 Unclassified 715
41 Ga0070697_101372252 3300005536 Unclassified 631
42 Ga0068853_100155490 3300005539 Bacteria 2060
43 Ga0070696_101322315 3300005546 Bacteria 612
44 Ga0070665_100108817 3300005548 Bacteria 2774
45 Ga0068855_100049264 3300005563 Bacteria 4969
46 Ga0068855_100329913 3300005563 Bacteria 1684
47 Ga0070664_100149733 3300005564 Bacteria 2060
48 Ga0068857_100503530 3300005577 Bacteria 1137
49 Ga0068856_100128025 3300005614 Bacteria 2543
50 Ga0068864_100167587 3300005618 Bacteria 2001
51 Ga0068864_100437055 3300005618 Unclassified 1249
52 Ga0068860_100933038 3300005843 Unclassified 885
53 Ga0081455_10000108 3300005937 Bacteria 93068
54 Ga0081455_10031582 3300005937 Bacteria 4788
55 Ga0081538_10038625 3300005981 Bacteria 3076
56 Ga0081539_10000224 3300005985 Bacteria 133057
57 Ga0070717_10149471 3300006028 Bacteria 2020
58 Ga0070717_10339230 3300006028 Bacteria 1342
59 Ga0070717_10448068 3300006028 Bacteria 1163
60 Ga0075365_10070828 3300006038 Bacteria 2346
61 Ga0075363_100024415 3300006048 Bacteria 3073
62 Ga0075364_10284913 3300006051 Bacteria 1124
63 Ga0070715_10148401 3300006163 Bacteria 1146
64 Ga0070712_100085326 3300006175 Bacteria 2298
65 Ga0075362_10012302 3300006177 Bacteria 3397
66 Ga0075367_10016996 3300006178 Bacteria 3984
67 Ga0075366_10504648 3300006195 Bacteria 748
68 Ga0097621_100157236 3300006237 Bacteria 1952
69 Ga0068871_100542600 3300006358 Bacteria 1052
70 Ga0068871_101647428 3300006358 Bacteria 608
71 Ga0075428_100063941 3300006844 Bacteria 4029
72 Ga0075430_100379885 3300006846 Bacteria 1166
73 Ga0075431_100281004 3300006847 Bacteria 1685
74 Ga0075431_100609900 3300006847 Bacteria 1075
75 Ga0075431_100695485 3300006847 Bacteria 995
76 Ga0075431_101488526 3300006847 Unclassified 635
77 Ga0075433_10002838 3300006852 Bacteria 13267
78 Ga0075433_10332732 3300006852 Unclassified 1343
79 Ga0075434_100006125 3300006871 Bacteria 11012
80 Ga0075434_100274286 3300006871 Bacteria 1706
81 Ga0075434_101549191 3300006871 Bacteria 672
82 Ga0075429_100480828 3300006880 Bacteria 1088
83 Ga0075429_100594513 3300006880 Bacteria 970
84 Ga0075429_101236390 3300006880 Bacteria 652
85 Ga0099794_10502351 3300007265 Unclassified 638
86 Ga0105251_10106511 3300009011 Bacteria 1280
87 Ga0111539_10041494 3300009094 Bacteria 5532
88 Ga0111539_10042775 3300009094 Bacteria 5436
89 Ga0111539_10142634 3300009094 Unclassified 2804
90 Ga0111539_10429953 3300009094 Unclassified 1537
91 Ga0105245_10073288 3300009098 Bacteria 3113
92 Ga0105245_10600076 3300009098 Bacteria 1127
93 Ga0114129_10476347 3300009147 Bacteria 1634
94 Ga0105243_10453766 3300009148 Unclassified 1203
95 Ga0105241_11722975 3300009174 Bacteria 609
96 Ga0105242_10153878 3300009176 Bacteria 2007
97 Ga0105242_10755848 3300009176 Bacteria 957
98 Ga0105242_12001900 3300009176 Unclassified 621
99 Ga0105238_11773716 3300009551 Bacteria 649
100 Ga0105249_10942314 3300009553 Bacteria 931
101 Ga0105239_10742966 3300010375 Unclassified 1123
102 Ga0105239_12683005 3300010375 Bacteria 581
103 Ga0105246_10220315 3300011119 Bacteria 1487
104 Ga0157373_10324972 3300013100 Bacteria 1095
105 Ga0157374_10622775 3300013296 Bacteria 1090
106 Ga0163162_10949219 3300013306 Unclassified 971
107 Ga0163162_11723821 3300013306 Bacteria 716
108 Ga0157375_10088351 3300013308 Unclassified 3154
109 Ga0157375_10402790 3300013308 Bacteria 1535
110 Ga0163163_10013748 3300014325 Bacteria 7418
111 Ga0163163_10502790 3300014325 Unclassified 1274
112 Ga0163163_11499943 3300014325 Bacteria 735
113 Ga0157380_10461148 3300014326 Bacteria 1223
114 Ga0157380_10489242 3300014326 Bacteria 1192
115 Ga0182008_10022307 3300014497 Bacteria 3243
116 Ga0157377_10173401 3300014745 Bacteria 1351
117 Ga0157377_10458156 3300014745 Bacteria 882
118 Ga0157379_10272489 3300014968 Unclassified 1539
119 Ga0157379_10401570 3300014968 Bacteria 1260
120 Ga0157376_10005383 3300014969 Bacteria 8946
121 Ga0157376_10133096 3300014969 Bacteria 2222
122 Ga0163161_10775750 3300017792 Unclassified 804
123 Ga0213876_10366883 3300021384 Bacteria 766
124 Ga0213875_10422243 3300021388 Bacteria 637
125 Ga0209148_1019806 3300025254 Bacteria 1114
126 Ga0209564_1000810 3300025295 Bacteria 42727
127 Ga0207692_10100893 3300025898 Bacteria 1584
128 Ga0207688_10298155 3300025901 Bacteria 985
129 Ga0207647_10156192 3300025904 Bacteria 1332
130 Ga0207685_10041062 3300025905 Bacteria 1729
131 Ga0207699_10002653 3300025906 Bacteria 8441
132 Ga0207705_10288420 3300025909 Bacteria 1257
133 Ga0207707_10054240 3300025912 Bacteria 3490
134 Ga0207671_10515187 3300025914 Bacteria 954
135 Ga0207671_10728931 3300025914 Bacteria 788
136 Ga0207693_10014594 3300025915 Bacteria 6312
137 Ga0207663_10094200 3300025916 Bacteria 1995
138 Ga0207663_10106721 3300025916 Bacteria 1893
139 Ga0207660_10284887 3300025917 Bacteria 1312
140 Ga0207660_10470145 3300025917 Bacteria 1018
141 Ga0207657_10305123 3300025919 Bacteria 1261
142 Ga0207649_10127566 3300025920 Bacteria 1724
143 Ga0207652_10082917 3300025921 Bacteria 2806
144 Ga0207652_10480472 3300025921 Bacteria 1119
145 Ga0207652_10525265 3300025921 Bacteria 1065
146 Ga0207652_10828260 3300025921 Bacteria 820
147 Ga0207646_10044129 3300025922 Bacteria 4002
148 Ga0207646_11231877 3300025922 Bacteria 655
149 Ga0207694_10909920 3300025924 Bacteria 744
150 Ga0207687_10821542 3300025927 Bacteria 793
151 Ga0207700_10019290 3300025928 Bacteria 4603
152 Ga0207700_10029818 3300025928 Bacteria 3854
153 Ga0207700_10201945 3300025928 Bacteria 1676
154 Ga0207700_10255748 3300025928 Bacteria 1498
155 Ga0207700_10272938 3300025928 Bacteria 1452
156 Ga0207664_10010024 3300025929 Bacteria 6676
157 Ga0207664_10404535 3300025929 Bacteria 1214
158 Ga0207690_10482054 3300025932 Bacteria 1001
159 Ga0207686_10181819 3300025934 Bacteria 1492
160 Ga0207670_10125297 3300025936 Bacteria 1874
161 Ga0207704_10842989 3300025938 Bacteria 768
162 Ga0207665_10304262 3300025939 Unclassified 1192
163 Ga0207661_10001440 3300025944 Bacteria 16041
164 Ga0207661_10255604 3300025944 Bacteria 1559
165 Ga0207667_10015124 3300025949 Bacteria 8775
166 Ga0207677_10379771 3300026023 Bacteria 1192
167 Ga0207639_10513726 3300026041 Bacteria 1096
168 Ga0207678_10018024 3300026067 Bacteria 6203
169 Ga0207702_10230378 3300026078 Bacteria 1731
170 Ga0207648_11386034 3300026089 Unclassified 661
171 Ga0207676_10185619 3300026095 Bacteria 1825
172 Ga0207674_10023069 3300026116 Bacteria 6674
173 Ga0207675_100070040 3300026118 Unclassified 3278
174 Ga0207698_10197410 3300026142 Bacteria 1799
175 Ga0207428_10023340 3300027907 Bacteria 5203
176 Ga0207428_10216587 3300027907 Bacteria 1437
177 Ga0207428_10316632 3300027907 Bacteria 1153
178 Ga0268266_10190711 3300028379 Bacteria 1871
179 Ga0268264_10238898 3300028381 Bacteria 1682
180 Ga0268264_11239807 3300028381 Bacteria 756
181 Ga0265760_10162991 3300031090 Bacteria 737
182 Ga0307408_101528478 3300031548 Bacteria 632
183 Ga0307508_10000045 3300031616 Bacteria 142824
184 Ga0307416_100774290 3300032002 Bacteria 1054
185 Ga0373926_0030067 3300035083 Bacteria 1911
186 Ga0373951_0057041 3300035091 Bacteria 971
187 Ga0373923_0047126 3300035111 Bacteria 1795
188 Ga0373932_0248158 3300035112 Bacteria 649
189 Ga0373936_0051211 3300035113 Bacteria 1671
190 Ga0373936_0334439 3300035113 Bacteria 688
191 Ga0373939_0040669 3300035114 Bacteria 1397
192 Ga0373953_0009613 3300035117 Bacteria 3335
193 Ga0373956_0008333 3300035119 Bacteria 4196
194 Ga0373957_0193956 3300035120 Bacteria 845
195 Ga0373943_0028828 3300035170 Bacteria 2619
196 Ga0373943_0266928 3300035170 Bacteria 965
197 Ga0373946_0346955 3300035171 Bacteria 742
198 Ga0373955_0014527 3300035172 Bacteria 3833
199 Ga0373962_0005606 3300035242 Unclassified 3032
200 Ga0373924_0018913 3300035410 Bacteria 2663
201 Ga0373924_0238028 3300035410 Bacteria 805
202 Ga0373931_0017756 3300035691 Bacteria 3524
203 Ga0373931_0289335 3300035691 Unclassified 1008
204 Ga0373935_0345088 3300035692 Unclassified 1060
205 Ga0373935_0400517 3300035692 Unclassified 986
206 Ga0373927_0512999 3300035695 Unclassified 792
207 Ga0373933_0039775 3300035724 Bacteria 2767
208 Ga0373933_0379327 3300035724 Bacteria 921
209 Ga0373933_0659367 3300035724 Bacteria 688
210 Ga0373947_0020571 3300035725 Bacteria 3811
211 Ga0373947_0143998 3300035725 Unclassified 1531
212 Ga0373947_0828408 3300035725 Unclassified 632
213 Ga0373937_0008439 3300036401 Bacteria 8954
214 Ga0373937_0013721 3300036401 Bacteria 7139
215 Ga0373937_0078471 3300036401 Bacteria 3051
216 Ga0373925_0022751 3300037068 Bacteria 4573
217 Ga0395899_0024256 3300037312 Bacteria 4587
218 Ga0395900_0337446 3300037418 Bacteria 1483
219 Ga0395900_0602220 3300037418 Bacteria 1039
220 Ga0395898_0208136 3300037466 Bacteria 1866
221 Ga0395898_0805672 3300037466 Bacteria 879
222 Ga0436364_0166625 3300037853 Unclassified 636
223 Ga0436364_0437914 3300037853 Bacteria 1567
224 Ga0436364_0972158 3300037853 Bacteria 2196
225 Ga0395901_0734645 3300038443 Bacteria 981
226 Ga0395901_1202928 3300038443 Bacteria 724
227 Ga0436365_0317556 3300039437 Bacteria 2671
228 Ga0436365_0377967 3300039437 Bacteria 8961
229 Ga0436360_0634798 3300039438 Bacteria 1427
230 Ga0436363_0782524 3300039450 Bacteria 605
231 Ga0436363_1008617 3300039450 Bacteria 861
232 Ga0436363_1250538 3300039450 Bacteria 1178
233 Ga0436362_0355862 3300039453 Bacteria 3204
234 Ga0451577_0058232 3300042876 Bacteria 3445
235 Ga0466963_0126367 3300044694 Bacteria 1763
236 Ga0453684_0378236 3300044712 Bacteria 1591
237 Ga0466970_0153256 3300044765 Bacteria 1273
238 Ga0466958_0225274 3300045836 Bacteria 1197
239 Ga0466958_0282696 3300045836 Bacteria 1064
240 Ga0466967_1465115 3300045976 Bacteria 680
241 Ga0495651_0247910 3300046462 Bacteria 1218
242 Ga0495582_0557512 3300046473 Unclassified 663
243 Ga0495664_0002079 3300046477 Bacteria 10704
244 Ga0495664_0027723 3300046477 Bacteria 3304
245 Ga0495608_0025530 3300046511 Bacteria 4033
246 Ga0495628_0048033 3300046516 Bacteria 3384
247 Ga0495630_0523525 3300046517 Unclassified 909
248 Ga0495652_0221128 3300046529 Bacteria 1423
249 Ga0495587_0017862 3300046536 Bacteria 4400
250 Ga0495645_0001819 3300046543 Bacteria 14500
251 Ga0495667_0045170 3300046559 Bacteria 2917
252 Ga0495635_0111126 3300046663 Bacteria 1872
253 Ga0495657_0209467 3300046675 Bacteria 1185
254 Ga0495599_0195070 3300046678 Bacteria 1245
255 Ga0495599_0641122 3300046678 Bacteria 616
256 Ga0495581_0475880 3300047315 Bacteria 727
257 Ga0495604_0027420 3300047317 Bacteria 4531
258 Ga0495674_1058126 3300047319 Bacteria 619
259 Ga0495680_0376517 3300047322 Bacteria 984
260 Ga0495675_0164931 3300047444 Bacteria 1363
261 Ga0495675_0199770 3300047444 Bacteria 1217
262 Ga0495684_0023253 3300047471 Bacteria 4765
263 Ga0495684_0183052 3300047471 Bacteria 1552
264 Ga0495602_0000513 3300048088 Bacteria 36136
265 Ga0496100_0008124 3300048903 Bacteria 5839
266 Ga0496100_0068265 3300048903 Bacteria 2364
267 Ga0496102_0055992 3300048905 Bacteria 3596
268 Ga0496103_0007418 3300048906 Bacteria 6536
269 Ga0496104_0010853 3300048907 Bacteria 8145
270 Ga0496104_0231293 3300048907 Bacteria 1760
271 Ga0496105_0170138 3300048908 Bacteria 1786
272 Ga0496106_0263156 3300048909 Unclassified 1380
273 Ga0496107_0137361 3300048910 Archaea 1806
274 Ga0496108_0045307 3300048911 Bacteria 3674
275 Ga0496108_0386517 3300048911 Bacteria 1222
276 Ga0496109_0149522 3300048912 Bacteria 2186
277 Ga0496110_0135943 3300048913 Bacteria 2221
278 Ga0496110_0150056 3300048913 Bacteria 2110
279 Ga0496111_0233107 3300048914 Bacteria 1367
280 Ga0496111_0363209 3300048914 Bacteria 1071
281 Ga0496112_0053738 3300048915 Bacteria 3956
282 Ga0496112_0446531 3300048915 Bacteria 1231
283 Ga0496113_0115345 3300048916 Bacteria 2095
284 Ga0496113_0397557 3300048916 Unclassified 1106
285 Ga0496113_0535955 3300048916 Bacteria 939
286 Ga0496114_0034205 3300048917 Bacteria 4191
287 Ga0496115_0000743 3300048918 Bacteria 24064
288 Ga0496115_0232904 3300048918 Bacteria 1518
289 Ga0496121_0533893 3300048924 Bacteria 737
290 Ga0496126_0278887 3300048929 Unclassified 1385
291 Ga0501032_0130271 3300049569 Bacteria 1660
292 Ga0501034_0177296 3300049571 Unclassified 2097
293 Ga0501034_0563566 3300049571 Bacteria 1048
294 Ga0501036_0208142 3300049572 Bacteria 1644
295 Ga0501037_0498555 3300049573 Bacteria 826
296 Ga0501038_0545797 3300049574 Bacteria 882
297 Ga0501046_0216160 3300049580 Bacteria 1421
298 Ga0501047_0070509 3300049581 Bacteria 3365
299 Ga0501047_0928859 3300049581 Unclassified 683
300 Ga0501048_0764181 3300049582 Bacteria 694
301 Ga0501067_0037037 3300049583 Bacteria 2709
302 Ga0501070_0034052 3300049586 Bacteria 4261
303 Ga0501070_1237987 3300049586 Bacteria 572
304 Ga0501071_1060728 3300049587 Unclassified 626
305 Ga0501071_1529205 3300049587 Bacteria 515
306 Ga0501072_0172316 3300049588 Bacteria 1727
307 Ga0501072_0365050 3300049588 Bacteria 1146
308 Ga0501072_0613872 3300049588 Bacteria 857
309 Ga0501072_1507597 3300049588 Bacteria 519
310 Ga0501074_0044144 3300049590 Bacteria 3227
311 Ga0501076_0016262 3300049592 Bacteria 5638
312 Ga0501076_0151656 3300049592 Unclassified 1885
313 Ga0501077_0019362 3300049593 Bacteria 4306
314 Ga0501079_0035882 3300049741 Bacteria 3818
315 Ga0501080_0438586 3300049742 Bacteria 1172
316 Ga0501081_0520602 3300049743 Bacteria 887
317 Ga0501081_1133580 3300049743 Unclassified 592
318 Ga0501083_0652973 3300049744 Bacteria 684
319 Ga0501035_0248460 3300049822 Bacteria 1511
320 Ga0501044_0133500 3300049823 Bacteria 2475
321 Ga0501044_0184676 3300049823 Unclassified 2051
322 Ga0501044_0261400 3300049823 Bacteria 1669
323 Ga0501045_0072933 3300049824 Bacteria 2528
324 nmdc:mga03683_4811_c1 3300050489 Bacteria 4508
325 nmdc:mga03683_86780_c1 3300050489 Bacteria 1359
326 nmdc:mga03n38_67117_c1 3300050490 Bacteria 1650
327 nmdc:mga00v17_14462_c1 3300050491 Bacteria 4404
328 nmdc:mga0yw44_10099_c1 3300050492 Bacteria 4807
329 nmdc:mga06z11_90109_c1 3300050494 Bacteria 1663
330 nmdc:mga04h51_159941_c1 3300050495 Bacteria 866
331 nmdc:mga05p37_173068_c1 3300050507 Bacteria 2632
332 nmdc:mga05p37_984388_c1 3300050507 Bacteria 898
333 nmdc:mga09592_222979_c1 3300050508 Bacteria 1633
334 nmdc:mga09592_963757_c1 3300050508 Bacteria 714
335 nmdc:mga0qj67_6905_c1 3300050509 Bacteria 8355
336 nmdc:mga06r32_1139_c1 3300050510 Bacteria 23882
337 nmdc:mga06r32_30717_c1 3300050510 Bacteria 5043
338 nmdc:mga06r32_689141_c1 3300050510 Bacteria 988
339 nmdc:mga06r32_808254_c1 3300050510 Bacteria 898
340 nmdc:mga08y16_1202492_c1 3300050511 Bacteria 729
341 nmdc:mga08y16_45046_c1 3300050511 Bacteria 4622
342 nmdc:mga08y16_584754_c1 3300050511 Unclassified 1127
343 nmdc:mga08y16_71088_c1 3300050511 Bacteria 3627
344 nmdc:mga0n895_9028_c1 3300050512 Bacteria 8695
345 nmdc:mga0n895_9830_c1 3300050512 Bacteria 8410
346 nmdc:mga0rr50_15058_c1 3300050513 Bacteria 5095
347 nmdc:mga08x19_237028_c1 3300050514 Bacteria 1257
348 nmdc:mga0a205_258756_c1 3300050515 Bacteria 1618
349 nmdc:mga0a205_2817_c1 3300050515 Bacteria 15380
350 nmdc:mga0a205_472851_c1 3300050515 Unclassified 1112
351 Ga0495601_0013222 3300053077 Bacteria 4963
352 Ga0495612_0000204 3300053078 Bacteria 25372
353 Ga0495595_0103269 3300053084 Bacteria 1377
354 Ga0495595_0225715 3300053084 Bacteria 935
355 Ga0495619_0116210 3300053085 Bacteria 1831
356 Ga0500658_0024160 3300053134 Bacteria 2327
357 Ga0500559_0000186 3300053136 Bacteria 49470
358 Ga0500568_0001571 3300053139 Bacteria 14447
359 Ga0500576_054675 3300053725 Bacteria 1761
360 Ga0500645_044490 3300053730 Bacteria 1306
361 Ga0501084_0182410 3300054114 Bacteria 1772
362 Ga0501084_0434820 3300054114 Bacteria 1109
363 Ga0501084_1263684 3300054114 Unclassified 619
364 Ga0587066_009221 3300059490 Bacteria 1393
365 Ga0501082_0112661 3300060353 Unclassified 2355
366 Ga0501082_0751524 3300060353 Unclassified 853
367 Ga0501082_0800077 3300060353 Bacteria 825
368 Ga0530510_0017394 3300061734 Bacteria 5096
369 Ga0501033_0094594
370 Ga0070676_10226493
371 Ga0070683_100006154
372 Ga0070683_100037914
373 Ga0070680_100297820
374 Ga0070682_100371495
375 Ga0070682_100559645
376 Ga0070660_100470002
377 Ga0070668_100242581
378 Ga0070673_100642542
379 Ga0070673_101220157
380 Ga0070688_100176120
381 Ga0070659_100715774
382 Ga0070709_10035849
383 Ga0070714_100030255
384 Ga0070714_100061240
385 Ga0070713_100000902
386 Ga0070713_100157752
387 Ga0070713_100348233
388 Ga0070710_10079626
389 Ga0070701_10375408
390 Ga0070711_100710392
391 Ga0070700_100122554
392 Ga0070663_100040643
393 Ga0070678_100039282
394 Ga0070662_100721304
395 Ga0070681_10062944
396 Ga0070681_11131077
397 Ga0068867_101487711
398 Ga0070685_10458104
399 Ga0070706_100011221
400 Ga0070707_100311894
401 Ga0070707_100419330
402 Ga0070698_100006487
403 Ga0070699_100101469
404 Ga0070679_100063924
405 Ga0070679_100078947
406 Ga0070684_100028558
407 Ga0070684_101226389
408 Ga0070697_101077142
409 Ga0070697_101372252
410 Ga0068853_100155490
411 Ga0070696_101322315
412 Ga0070665_100108817
413 Ga0068855_100049264
414 Ga0068855_100329913
415 Ga0070664_100149733
416 Ga0068857_100503530
417 Ga0068856_100128025
418 Ga0068864_100167587
419 Ga0068864_100437055
420 Ga0068860_100933038
421 Ga0081455_10000108
422 Ga0081455_10031582
423 Ga0081538_10038625
424 Ga0081539_10000224
425 Ga0070717_10149471
426 Ga0070717_10339230
427 Ga0070717_10448068
428 Ga0075365_10070828
429 Ga0075363_100024415
430 Ga0075364_10284913
431 Ga0070715_10148401
432 Ga0070712_100085326
433 Ga0075362_10012302
434 Ga0075367_10016996
435 Ga0075366_10504648
436 Ga0097621_100157236
437 Ga0068871_100542600
438 Ga0068871_101647428
439 Ga0075428_100063941
440 Ga0075430_100379885
441 Ga0075431_100281004
442 Ga0075431_100609900
443 Ga0075431_100695485
444 Ga0075431_101488526
445 Ga0075433_10002838
446 Ga0075433_10332732
447 Ga0075434_100006125
448 Ga0075434_100274286
449 Ga0075434_101549191
450 Ga0075429_100480828
451 Ga0075429_100594513
452 Ga0075429_101236390
453 Ga0099794_10502351
454 Ga0105251_10106511
455 Ga0111539_10041494
456 Ga0111539_10042775
457 Ga0111539_10142634
458 Ga0111539_10429953
459 Ga0105245_10073288
460 Ga0105245_10600076
461 Ga0114129_10476347
462 Ga0105243_10453766
463 Ga0105241_11722975
464 Ga0105242_10153878
465 Ga0105242_10755848
466 Ga0105242_12001900
467 Ga0105238_11773716
468 Ga0105249_10942314
469 Ga0105239_10742966
470 Ga0105239_12683005
471 Ga0105246_10220315
472 Ga0157373_10324972
473 Ga0157374_10622775
474 Ga0163162_10949219
475 Ga0163162_11723821
476 Ga0157375_10088351
477 Ga0157375_10402790
478 Ga0163163_10013748
479 Ga0163163_10502790
480 Ga0163163_11499943
481 Ga0157380_10461148
482 Ga0157380_10489242
483 Ga0182008_10022307
484 Ga0157377_10173401
485 Ga0157377_10458156
486 Ga0157379_10272489
487 Ga0157379_10401570
488 Ga0157376_10005383
489 Ga0157376_10133096
490 Ga0163161_10775750
491 Ga0213876_10366883
492 Ga0213875_10422243
493 Ga0209148_1019806
494 Ga0209564_1000810
495 Ga0207692_10100893
496 Ga0207688_10298155
497 Ga0207647_10156192
498 Ga0207685_10041062
499 Ga0207699_10002653
500 Ga0207705_10288420
501 Ga0207707_10054240
502 Ga0207671_10515187
503 Ga0207671_10728931
504 Ga0207693_10014594
505 Ga0207663_10094200
506 Ga0207663_10106721
507 Ga0207660_10284887
508 Ga0207660_10470145
509 Ga0207657_10305123
510 Ga0207649_10127566
511 Ga0207652_10082917
512 Ga0207652_10480472
513 Ga0207652_10525265
514 Ga0207652_10828260
515 Ga0207646_10044129
516 Ga0207646_11231877
517 Ga0207694_10909920
518 Ga0207687_10821542
519 Ga0207700_10019290
520 Ga0207700_10029818
521 Ga0207700_10201945
522 Ga0207700_10255748
523 Ga0207700_10272938
524 Ga0207664_10010024
525 Ga0207664_10404535
526 Ga0207690_10482054
527 Ga0207686_10181819
528 Ga0207670_10125297
529 Ga0207704_10842989
530 Ga0207665_10304262
531 Ga0207661_10001440
532 Ga0207661_10255604
533 Ga0207667_10015124
534 Ga0207677_10379771
535 Ga0207639_10513726
536 Ga0207678_10018024
537 Ga0207702_10230378
538 Ga0207648_11386034
539 Ga0207676_10185619
540 Ga0207674_10023069
541 Ga0207675_100070040
542 Ga0207698_10197410
543 Ga0207428_10023340
544 Ga0207428_10216587
545 Ga0207428_10316632
546 Ga0268266_10190711
547 Ga0268264_10238898
548 Ga0268264_11239807
549 Ga0265760_10162991
550 Ga0307408_101528478
551 Ga0307508_10000045
552 Ga0307416_100774290
553 Ga0373926_0030067
554 Ga0373951_0057041
555 Ga0373923_0047126
556 Ga0373932_0248158
557 Ga0373936_0051211
558 Ga0373936_0334439
559 Ga0373939_0040669
560 Ga0373953_0009613
561 Ga0373956_0008333
562 Ga0373957_0193956
563 Ga0373943_0028828
564 Ga0373943_0266928
565 Ga0373946_0346955
566 Ga0373955_0014527
567 Ga0373962_0005606
568 Ga0373924_0018913
569 Ga0373924_0238028
570 Ga0373931_0017756
571 Ga0373931_0289335
572 Ga0373935_0345088
573 Ga0373935_0400517
574 Ga0373927_0512999
575 Ga0373933_0039775
576 Ga0373933_0379327
577 Ga0373933_0659367
578 Ga0373947_0020571
579 Ga0373947_0143998
580 Ga0373947_0828408
581 Ga0373937_0008439
582 Ga0373937_0013721
583 Ga0373937_0078471
584 Ga0373925_0022751
585 Ga0395899_0024256
586 Ga0395900_0337446
587 Ga0395900_0602220
588 Ga0395898_0208136
589 Ga0395898_0805672
590 Ga0436364_0166625
591 Ga0436364_0437914
592 Ga0436364_0972158
593 Ga0395901_0734645
594 Ga0395901_1202928
595 Ga0436365_0317556
596 Ga0436365_0377967
597 Ga0436360_0634798
598 Ga0436363_0782524
599 Ga0436363_1008617
600 Ga0436363_1250538
601 Ga0436362_0355862
602 Ga0451577_0058232
603 Ga0466963_0126367
604 Ga0453684_0378236
605 Ga0466970_0153256
606 Ga0466958_0225274
607 Ga0466958_0282696
608 Ga0466967_1465115
609 Ga0495651_0247910
610 Ga0495582_0557512
611 Ga0495664_0002079
612 Ga0495664_0027723
613 Ga0495608_0025530
614 Ga0495628_0048033
615 Ga0495630_0523525
616 Ga0495652_0221128
617 Ga0495587_0017862
618 Ga0495645_0001819
619 Ga0495667_0045170
620 Ga0495635_0111126
621 Ga0495657_0209467
622 Ga0495599_0195070
623 Ga0495599_0641122
624 Ga0495581_0475880
625 Ga0495604_0027420
626 Ga0495674_1058126
627 Ga0495680_0376517
628 Ga0495675_0164931
629 Ga0495675_0199770
630 Ga0495684_0023253
631 Ga0495684_0183052
632 Ga0495602_0000513
633 Ga0496100_0008124
634 Ga0496100_0068265
635 Ga0496102_0055992
636 Ga0496103_0007418
637 Ga0496104_0010853
638 Ga0496104_0231293
639 Ga0496105_0170138
640 Ga0496106_0263156
641 Ga0496107_0137361
642 Ga0496108_0045307
643 Ga0496108_0386517
644 Ga0496109_0149522
645 Ga0496110_0135943
646 Ga0496110_0150056
647 Ga0496111_0233107
648 Ga0496111_0363209
649 Ga0496112_0053738
650 Ga0496112_0446531
651 Ga0496113_0115345
652 Ga0496113_0397557
653 Ga0496113_0535955
654 Ga0496114_0034205
655 Ga0496115_0000743
656 Ga0496115_0232904
657 Ga0496121_0533893
658 Ga0496126_0278887
659 Ga0501032_0130271
660 Ga0501034_0177296
661 Ga0501034_0563566
662 Ga0501036_0208142
663 Ga0501037_0498555
664 Ga0501038_0545797
665 Ga0501046_0216160
666 Ga0501047_0070509
667 Ga0501047_0928859
668 Ga0501048_0764181
669 Ga0501067_0037037
670 Ga0501070_0034052
671 Ga0501070_1237987
672 Ga0501071_1060728
673 Ga0501071_1529205
674 Ga0501072_0172316
675 Ga0501072_0365050
676 Ga0501072_0613872
677 Ga0501072_1507597
678 Ga0501074_0044144
679 Ga0501076_0016262
680 Ga0501076_0151656
681 Ga0501077_0019362
682 Ga0501079_0035882
683 Ga0501080_0438586
684 Ga0501081_0520602
685 Ga0501081_1133580
686 Ga0501083_0652973
687 Ga0501035_0248460
688 Ga0501044_0133500
689 Ga0501044_0184676
690 Ga0501044_0261400
691 Ga0501045_0072933
692 nmdc:mga03683_4811_c1
693 nmdc:mga03683_86780_c1
694 nmdc:mga03n38_67117_c1
695 nmdc:mga00v17_14462_c1
696 nmdc:mga0yw44_10099_c1
697 nmdc:mga06z11_90109_c1
698 nmdc:mga04h51_159941_c1
699 nmdc:mga05p37_173068_c1
700 nmdc:mga05p37_984388_c1
701 nmdc:mga09592_222979_c1
702 nmdc:mga09592_963757_c1
703 nmdc:mga0qj67_6905_c1
704 nmdc:mga06r32_1139_c1
705 nmdc:mga06r32_30717_c1
706 nmdc:mga06r32_689141_c1
707 nmdc:mga06r32_808254_c1
708 nmdc:mga08y16_1202492_c1
709 nmdc:mga08y16_45046_c1
710 nmdc:mga08y16_584754_c1
711 nmdc:mga08y16_71088_c1
712 nmdc:mga0n895_9028_c1
713 nmdc:mga0n895_9830_c1
714 nmdc:mga0rr50_15058_c1
715 nmdc:mga08x19_237028_c1
716 nmdc:mga0a205_258756_c1
717 nmdc:mga0a205_2817_c1
718 nmdc:mga0a205_472851_c1
719 Ga0495601_0013222
720 Ga0495612_0000204
721 Ga0495595_0103269
722 Ga0495595_0225715
723 Ga0495619_0116210
724 Ga0500658_0024160
725 Ga0500559_0000186
726 Ga0500568_0001571
727 Ga0500576_054675
728 Ga0500645_044490
729 Ga0501084_0182410
730 Ga0501084_0434820
731 Ga0501084_1263684
732 Ga0587066_009221
733 Ga0501082_0112661
734 Ga0501082_0751524
735 Ga0501082_0800077
736 Ga0530510_0017394

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

52

173

0.83

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

54

180

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1q6w-assembly2.cif.gz_C x-ray structure of monoamine oxidase regulatory protein from archaeoglobus fulgius 0.9091 15 158
4qda-assembly4.cif.gz_F crystal structure of mutant thioesterase pa1618 (e64a) from pseudomonas aeruginosa 0.8796 95 154
5cpg-assembly1.cif.gz_B r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form 0.8763 17 157
1q6w-assembly2.cif.gz_C x-ray structure of monoamine oxidase regulatory protein from archaeoglobus fulgius 0.8532 15 158
1iq6-assembly1.cif.gz_A (r)-hydratase from a. caviae involved in pha biosynthesis 0.8451 19 157
ID Description Score Start End Superfamily
af_Q556W3_248_405_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8776 95 154 3.10.129.10
5cpgB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8763 17 157 3.10.129.10
af_P77455_520_674_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8483 16 156 3.10.129.10
af_Q9W439_57_173_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8467 95 154 3.10.129.10
1iq6A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8451 19 157 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A848EH57-F1-model_v4 MaoC family dehydratase 0.9896 15 159
AF-A0A7Y4K7T7-F1-model_v4 deleted 0.9894 10 159
AF-A0A1E4QW55-F1-model_v4 deleted 0.9855 10 158
AF-A0A080NSR6-F1-model_v4 deleted 0.9844 34 159
AF-A0A4Q2L8A4-F1-model_v4 deleted 0.9812 68 159

Map