F424808

General Info

Members Datasets Scaffolds Average Seq Length
368 203 736 242

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0611935|Ga0466967_0611935_34_825
Length 263
Sequence MTEEVRTPAPPLQQQGEDGVRVIYDPIADTPTSYLREPEGAHPPMDYEGYKSTALRHPKQPLIYLPQTITEITGPQLGPVLMGENDNDLTVQHEGEPIGERIVVSGRVFDTEGKPLRGTLVEIWQANSAGRYKHRWDRWPAPLDPNFTGAGRCITDDEGRYTFTTIKPGPYPWGNHYNAWRPAHIHFSLLGRAFTQRLVTQMYFPGDPFFAYDPIFNSVRDPRARERMVSSFSIHDTVPNWAHAYHFDIYLRGPGATPFEEAH

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
39 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
42 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
70 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
71 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
72 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
75 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
76 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
86 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
87 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
88 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
89 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
90 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
91 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
92 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
94 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
95 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
96 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
99 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
108 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
109 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
110 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
111 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
148 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
196 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
197 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
202 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
203 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 0.54
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.61
Rhizosphere 82.07
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0611935 3300045976 Bacteria 1076
2 JGI25406J46586_10018575 3300003203 Bacteria 2855
3 Ga0070683_100104923 3300005329 Bacteria 2664
4 Ga0070671_100106825 3300005355 Bacteria 2350
5 Ga0070709_10093046 3300005434 Bacteria 1992
6 Ga0070709_10108205 3300005434 Bacteria 1864
7 Ga0070714_100015071 3300005435 Bacteria 6216
8 Ga0070714_100017652 3300005435 Bacteria 5784
9 Ga0070714_100135208 3300005435 Bacteria 2207
10 Ga0070714_100255433 3300005435 Bacteria 1622
11 Ga0070714_100357512 3300005435 Bacteria 1372
12 Ga0070713_100014503 3300005436 Bacteria 5856
13 Ga0070713_100150593 3300005436 Bacteria 2069
14 Ga0070713_100330193 3300005436 Bacteria 1410
15 Ga0070713_100588732 3300005436 Bacteria 1056
16 Ga0070710_10205432 3300005437 Bacteria 1246
17 Ga0070711_100030696 3300005439 Bacteria 3561
18 Ga0070711_100521366 3300005439 Bacteria 982
19 Ga0070705_100048093 3300005440 Bacteria 2469
20 Ga0070681_10000239 3300005458 Bacteria 43301
21 Ga0070679_100006404 3300005530 Bacteria 10964
22 Ga0070665_100015743 3300005548 Bacteria 7598
23 Ga0068855_100316180 3300005563 Bacteria 1727
24 Ga0070664_100135151 3300005564 Bacteria 2168
25 Ga0070664_100275616 3300005564 Bacteria 1516
26 Ga0068856_100000782 3300005614 Bacteria 34475
27 Ga0068856_100018519 3300005614 Bacteria 6749
28 Ga0068856_100046784 3300005614 Bacteria 4261
29 Ga0068856_100385345 3300005614 Bacteria 1421
30 Ga0068863_100023974 3300005841 Bacteria 5823
31 Ga0068863_100080778 3300005841 Bacteria 3080
32 Ga0081540_1020575 3300005983 Bacteria 3962
33 Ga0081539_10000538 3300005985 Bacteria 78469
34 Ga0081539_10008330 3300005985 Bacteria 9064
35 Ga0070717_10003840 3300006028 Bacteria 10813
36 Ga0070717_10029257 3300006028 Bacteria 4417
37 Ga0070717_10044396 3300006028 Bacteria 3629
38 Ga0070717_10052292 3300006028 Bacteria 3365
39 Ga0070716_100029036 3300006173 Bacteria 2986
40 Ga0070712_100061778 3300006175 Bacteria 2647
41 Ga0075434_100011970 3300006871 Bacteria 8207
42 Ga0075435_100182381 3300007076 Bacteria 1774
43 Ga0105240_10002678 3300009093 Bacteria 28344
44 Ga0105245_10048738 3300009098 Bacteria 3790
45 Ga0105241_10117861 3300009174 Bacteria 2134
46 Ga0105237_10305066 3300009545 Bacteria 1595
47 Ga0105238_10107709 3300009551 Bacteria 2768
48 Ga0105238_10155879 3300009551 Bacteria 2259
49 Ga0105238_10593205 3300009551 Bacteria 1115
50 Ga0105239_10049178 3300010375 Bacteria 4623
51 Ga0157369_10243764 3300013105 Bacteria 1877
52 Ga0157372_10206236 3300013307 Bacteria 2278
53 Ga0157372_11033440 3300013307 Bacteria 951
54 Ga0157375_10267966 3300013308 Bacteria 1870
55 Ga0157375_10480638 3300013308 Bacteria 1407
56 Ga0163163_10108711 3300014325 Bacteria 2800
57 Ga0163163_10420776 3300014325 Bacteria 1395
58 Ga0157379_10391035 3300014968 Bacteria 1277
59 Ga0197907_11488564 3300020069 Bacteria 1113
60 Ga0206354_10811441 3300020081 Bacteria 2846
61 Ga0213873_10113916 3300021358 Bacteria 788
62 Ga0213874_10000364 3300021377 Bacteria 8940
63 Ga0213874_10022884 3300021377 Bacteria 1738
64 Ga0213874_10099519 3300021377 Bacteria 965
65 Ga0213876_10002891 3300021384 Bacteria 9971
66 Ga0213876_10030950 3300021384 Bacteria 2824
67 Ga0213876_10035621 3300021384 Bacteria 2625
68 Ga0213876_10050692 3300021384 Bacteria 2193
69 Ga0213875_10000126 3300021388 Bacteria 84171
70 Ga0213875_10013612 3300021388 Bacteria 3986
71 Ga0213875_10020998 3300021388 Bacteria 3131
72 Ga0213875_10042098 3300021388 Bacteria 2147
73 Ga0213875_10044918 3300021388 Bacteria 2074
74 Ga0213875_10056178 3300021388 Bacteria 1844
75 Ga0207692_10009874 3300025898 Bacteria 4001
76 Ga0207654_10222385 3300025911 Bacteria 1253
77 Ga0207707_10009090 3300025912 Bacteria 8635
78 Ga0207707_10121438 3300025912 Bacteria 2284
79 Ga0207695_10304120 3300025913 Bacteria 1486
80 Ga0207693_10004284 3300025915 Bacteria 12093
81 Ga0207652_10022421 3300025921 Bacteria 5224
82 Ga0207694_10492132 3300025924 Bacteria 1026
83 Ga0207700_10013286 3300025928 Bacteria 5350
84 Ga0207700_10020375 3300025928 Bacteria 4503
85 Ga0207700_10066665 3300025928 Bacteria 2752
86 Ga0207664_10035499 3300025929 Bacteria 3847
87 Ga0207664_10060967 3300025929 Bacteria 3008
88 Ga0207664_10122323 3300025929 Bacteria 2180
89 Ga0207664_10169174 3300025929 Bacteria 1869
90 Ga0207644_10011665 3300025931 Bacteria 5820
91 Ga0207686_10220446 3300025934 Bacteria 1369
92 Ga0207709_10244899 3300025935 Bacteria 1306
93 Ga0207704_10184843 3300025938 Bacteria 1510
94 Ga0207665_10019804 3300025939 Bacteria 4421
95 Ga0207711_10198413 3300025941 Bacteria 1830
96 Ga0207679_10292817 3300025945 Bacteria 1400
97 Ga0207667_10189653 3300025949 Bacteria 2110
98 Ga0207667_10211928 3300025949 Bacteria 1986
99 Ga0207712_10039219 3300025961 Bacteria 3244
100 Ga0207640_10068541 3300025981 Bacteria 2378
101 Ga0207658_10139965 3300025986 Bacteria 1957
102 Ga0207708_10233482 3300026075 Bacteria 1477
103 Ga0207702_10008262 3300026078 Bacteria 8795
104 Ga0207702_10016101 3300026078 Bacteria 6189
105 Ga0207702_10018978 3300026078 Bacteria 5689
106 Ga0207702_10300741 3300026078 Bacteria 1522
107 Ga0207702_10439121 3300026078 Bacteria 1265
108 Ga0207641_10021776 3300026088 Bacteria 5269
109 Ga0207641_10026435 3300026088 Bacteria 4790
110 Ga0207648_10528980 3300026089 Bacteria 1081
111 Ga0207676_10071951 3300026095 Bacteria 2778
112 Ga0207674_10499833 3300026116 Bacteria 1175
113 Ga0268266_10017673 3300028379 Bacteria 6081
114 Ga0265337_1024396 3300028556 Bacteria 1851
115 Ga0265319_1000015 3300028563 Bacteria 176382
116 Ga0265319_1003260 3300028563 Bacteria 8540
117 Ga0265318_10008483 3300028577 Bacteria 4572
118 Ga0265322_10022190 3300028654 Bacteria 1817
119 Ga0265338_10006881 3300028800 Bacteria 14317
120 Ga0265330_10026610 3300031235 Bacteria 2616
121 Ga0265320_10015519 3300031240 Bacteria 4303
122 Ga0265320_10016527 3300031240 Bacteria 4131
123 Ga0265339_10105376 3300031249 Bacteria 1464
124 Ga0265316_10201666 3300031344 Bacteria 1474
125 Ga0307513_10078779 3300031456 Bacteria 3407
126 Ga0307508_10383818 3300031616 Bacteria 996
127 Ga0265314_10041302 3300031711 Bacteria 3303
128 Ga0307410_10373766 3300031852 Bacteria 1145
129 Ga0307406_10207597 3300031901 Bacteria 1447
130 Ga0307409_100550646 3300031995 Bacteria 1132
131 Ga0307409_100661219 3300031995 Bacteria 1040
132 Ga0307416_100016676 3300032002 Bacteria 5115
133 Ga0373930_0003309 3300034816 Bacteria 2547
134 Ga0373958_0050193 3300034819 Bacteria 879
135 Ga0373929_0024622 3300035085 Bacteria 1245
136 Ga0373934_0037538 3300035086 Bacteria 1907
137 Ga0373940_0000672 3300035088 Bacteria 5478
138 Ga0373944_0040579 3300035089 Bacteria 1437
139 Ga0373952_0002724 3300035092 Bacteria 3192
140 Ga0373923_0008487 3300035111 Bacteria 3666
141 Ga0373939_0015411 3300035114 Bacteria 2000
142 Ga0373953_0008010 3300035117 Bacteria 3569
143 Ga0373954_0084111 3300035118 Bacteria 1523
144 Ga0373956_0017211 3300035119 Bacteria 3045
145 Ga0373955_0051300 3300035172 Bacteria 2246
146 Ga0373962_0033392 3300035242 Bacteria 1420
147 Ga0373924_0005965 3300035410 Bacteria 4345
148 Ga0373924_0091248 3300035410 Bacteria 1303
149 Ga0373931_0091612 3300035691 Bacteria 1694
150 Ga0373933_0000604 3300035724 Bacteria 22424
151 Ga0373947_0151765 3300035725 Bacteria 1493
152 Ga0373937_0001588 3300036401 Bacteria 19105
153 Ga0373937_0490187 3300036401 Bacteria 1167
154 Ga0395898_0003208 3300037466 Bacteria 18407
155 Ga0395898_0286870 3300037466 Bacteria 1570
156 Ga0395898_0479234 3300037466 Bacteria 1184
157 Ga0436364_0035595 3300037853 Bacteria 2608
158 Ga0436364_0072848 3300037853 Bacteria 133330
159 Ga0436364_0089703 3300037853 Bacteria 40773
160 Ga0436364_0121332 3300037853 Bacteria 9965
161 Ga0436364_0776180 3300037853 Bacteria 4416
162 Ga0436364_0801981 3300037853 Bacteria 2218
163 Ga0436364_0861621 3300037853 Bacteria 10615
164 Ga0436364_1065157 3300037853 Bacteria 8792
165 Ga0436365_0975062 3300039437 Bacteria 5484
166 Ga0436365_1006535 3300039437 Bacteria 11823
167 Ga0436365_1102108 3300039437 Bacteria 21525
168 Ga0436365_1113241 3300039437 Bacteria 17498
169 Ga0436365_1209233 3300039437 Bacteria 6417
170 Ga0436365_1227779 3300039437 Bacteria 8332
171 Ga0436365_1309855 3300039437 Bacteria 2495
172 Ga0436365_1335065 3300039437 Bacteria 10076
173 Ga0436365_1885561 3300039437 Bacteria 3132
174 Ga0436360_1125491 3300039438 Bacteria 1691
175 Ga0436363_0156650 3300039450 Bacteria 1969
176 Ga0436363_0544204 3300039450 Bacteria 6184
177 Ga0436363_0858966 3300039450 Bacteria 1980
178 Ga0436363_1329056 3300039450 Bacteria 4991
179 Ga0436363_1680632 3300039450 Bacteria 2877
180 Ga0436362_0009472 3300039453 Bacteria 1662
181 Ga0436362_0049551 3300039453 Bacteria 3484
182 Ga0436362_1183667 3300039453 Bacteria 3237
183 Ga0436362_1200922 3300039453 Bacteria 2669
184 Ga0436362_1278865 3300039453 Bacteria 1267
185 Ga0451807_1249833 3300041486 Bacteria 995
186 Ga0466969_0048968 3300044656 Bacteria 2087
187 Ga0466969_0050670 3300044656 Bacteria 2046
188 Ga0466969_0066607 3300044656 Bacteria 1738
189 Ga0466965_0005938 3300044683 Bacteria 5517
190 Ga0466965_0049169 3300044683 Bacteria 2090
191 Ga0466965_0061198 3300044683 Bacteria 1882
192 Ga0466965_0076913 3300044683 Bacteria 1685
193 Ga0466965_0281876 3300044683 Bacteria 898
194 Ga0466966_0036134 3300044684 Bacteria 3191
195 Ga0466966_0087421 3300044684 Bacteria 1937
196 Ga0466961_0007626 3300044693 Bacteria 6894
197 Ga0466961_0123286 3300044693 Bacteria 1626
198 Ga0466961_0204344 3300044693 Bacteria 1221
199 Ga0466961_0209719 3300044693 Bacteria 1203
200 Ga0466961_0213079 3300044693 Bacteria 1192
201 Ga0466961_0317975 3300044693 Bacteria 950
202 Ga0466961_0367053 3300044693 Bacteria 875
203 Ga0466963_0003404 3300044694 Bacteria 9100
204 Ga0466963_0017466 3300044694 Bacteria 4472
205 Ga0466963_0018209 3300044694 Bacteria 4387
206 Ga0466963_0026344 3300044694 Bacteria 3718
207 Ga0466963_0038703 3300044694 Bacteria 3120
208 Ga0466964_0017045 3300044706 Bacteria 2779
209 Ga0466971_0001238 3300044719 Bacteria 10622
210 Ga0466971_0007606 3300044719 Bacteria 4724
211 Ga0466971_0009599 3300044719 Bacteria 4223
212 Ga0466968_0191678 3300044735 Bacteria 954
213 Ga0466970_0013111 3300044765 Bacteria 4248
214 Ga0466970_0077594 3300044765 Bacteria 1791
215 Ga0466970_0207797 3300044765 Bacteria 1090
216 Ga0466970_0210423 3300044765 Bacteria 1083
217 Ga0466957_0024386 3300044842 Bacteria 3580
218 Ga0466957_0115618 3300044842 Bacteria 1706
219 Ga0466960_0003790 3300044901 Bacteria 5856
220 Ga0466959_0003575 3300045049 Bacteria 10232
221 Ga0466959_0006221 3300045049 Bacteria 8251
222 Ga0466959_0045094 3300045049 Bacteria 3248
223 Ga0466959_0065995 3300045049 Bacteria 2625
224 Ga0466959_0089471 3300045049 Bacteria 2212
225 Ga0466959_0126292 3300045049 Bacteria 1815
226 Ga0466959_0166301 3300045049 Bacteria 1549
227 Ga0466959_0175913 3300045049 Bacteria 1499
228 Ga0466959_0229639 3300045049 Bacteria 1285
229 Ga0466958_0001053 3300045836 Bacteria 12637
230 Ga0466958_0002662 3300045836 Bacteria 9034
231 Ga0466958_0006976 3300045836 Bacteria 6178
232 Ga0466958_0082236 3300045836 Bacteria 1983
233 Ga0466958_0098973 3300045836 Bacteria 1811
234 Ga0466958_0202356 3300045836 Bacteria 1264
235 Ga0466958_0227353 3300045836 Bacteria 1191
236 Ga0466958_0263183 3300045836 Bacteria 1104
237 Ga0466967_0008304 3300045976 Bacteria 7593
238 Ga0466967_0010928 3300045976 Bacteria 6843
239 Ga0466967_0059886 3300045976 Bacteria 3372
240 Ga0466967_0117096 3300045976 Bacteria 2456
241 Ga0466967_0169868 3300045976 Bacteria 2051
242 Ga0466967_0299625 3300045976 Bacteria 1547
243 Ga0466967_0426436 3300045976 Bacteria 1293
244 Ga0495592_0026781 3300046454 Bacteria 4370
245 Ga0495603_0190146 3300046455 Bacteria 1187
246 Ga0495603_0207013 3300046455 Bacteria 1133
247 Ga0495629_0006528 3300046459 Bacteria 8642
248 Ga0495641_0079064 3300046461 Bacteria 1473
249 Ga0495651_0052365 3300046462 Bacteria 3144
250 Ga0495653_0110525 3300046463 Bacteria 1975
251 Ga0495650_0024535 3300046471 Bacteria 2845
252 Ga0495664_0120076 3300046477 Bacteria 1590
253 Ga0495664_0244776 3300046477 Bacteria 1084
254 Ga0495608_0036454 3300046511 Bacteria 3311
255 Ga0495608_0089322 3300046511 Bacteria 1994
256 Ga0495618_0021602 3300046514 Bacteria 3968
257 Ga0495618_0156648 3300046514 Bacteria 1453
258 Ga0495628_0023178 3300046516 Bacteria 5098
259 Ga0495666_0017475 3300046526 Bacteria 3572
260 Ga0495652_0130101 3300046529 Bacteria 1994
261 Ga0495652_0156584 3300046529 Bacteria 1773
262 Ga0495665_0002424 3300046531 Bacteria 10076
263 Ga0495665_0239749 3300046531 Bacteria 935
264 Ga0495640_0107231 3300046533 Bacteria 1828
265 Ga0495640_0297176 3300046533 Bacteria 1003
266 Ga0495586_0122329 3300046535 Bacteria 1454
267 Ga0495587_0253593 3300046536 Bacteria 989
268 Ga0495645_0121262 3300046543 Bacteria 1841
269 Ga0495645_0221960 3300046543 Bacteria 1271
270 Ga0495667_0040521 3300046559 Bacteria 3092
271 Ga0495667_0185899 3300046559 Bacteria 1332
272 Ga0495634_0012224 3300046642 Bacteria 6223
273 Ga0495634_0184806 3300046642 Bacteria 1303
274 Ga0495635_0044143 3300046663 Bacteria 3075
275 Ga0495635_0052394 3300046663 Bacteria 2811
276 Ga0495657_0032465 3300046675 Bacteria 3642
277 Ga0495599_0071699 3300046678 Bacteria 2162
278 Ga0495623_0021519 3300046679 Bacteria 4164
279 Ga0495623_0111402 3300046679 Bacteria 1658
280 Ga0495646_0020057 3300046680 Bacteria 4227
281 Ga0495658_0199230 3300046683 Bacteria 1247
282 Ga0495658_0246201 3300046683 Bacteria 1123
283 Ga0495613_0114545 3300046689 Bacteria 1940
284 Ga0495613_0161958 3300046689 Bacteria 1591
285 Ga0495613_0258321 3300046689 Bacteria 1214
286 Ga0495600_0226260 3300046809 Bacteria 1195
287 Ga0495581_0019981 3300047315 Bacteria 3889
288 Ga0495581_0031906 3300047315 Bacteria 3052
289 Ga0495604_0043400 3300047317 Bacteria 3520
290 Ga0495604_0550339 3300047317 Bacteria 744
291 Ga0495674_0037226 3300047319 Bacteria 4372
292 Ga0495676_0071256 3300047321 Bacteria 2672
293 Ga0495680_0053727 3300047322 Bacteria 3132
294 Ga0495680_0317782 3300047322 Bacteria 1090
295 Ga0495675_0082210 3300047444 Bacteria 2028
296 Ga0495675_0171576 3300047444 Bacteria 1332
297 Ga0495684_0012449 3300047471 Bacteria 6557
298 Ga0495684_0112564 3300047471 Bacteria 2052
299 Ga0495593_0014823 3300047673 Bacteria 4428
300 Ga0495602_0067909 3300048088 Bacteria 3064
301 Ga0495602_0152439 3300048088 Bacteria 1815
302 Ga0496102_0116602 3300048905 Bacteria 2492
303 Ga0496104_0084546 3300048907 Bacteria 3028
304 Ga0496105_0024475 3300048908 Bacteria 4906
305 Ga0496105_0280659 3300048908 Bacteria 1343
306 Ga0496106_0142110 3300048909 Bacteria 1888
307 Ga0496107_0337241 3300048910 Bacteria 1122
308 Ga0496108_0038983 3300048911 Bacteria 3960
309 Ga0496108_0729821 3300048911 Bacteria 858
310 Ga0496109_0018773 3300048912 Bacteria 6082
311 Ga0496109_0203608 3300048912 Bacteria 1861
312 Ga0496110_0100534 3300048913 Bacteria 2592
313 Ga0496110_0156556 3300048913 Bacteria 2064
314 Ga0496111_0070183 3300048914 Bacteria 2548
315 Ga0496111_0193314 3300048914 Bacteria 1513
316 Ga0496111_0487464 3300048914 Bacteria 908
317 Ga0496112_0005596 3300048915 Bacteria 10894
318 Ga0496112_0007783 3300048915 Bacteria 9538
319 Ga0496112_0019993 3300048915 Bacteria 6338
320 Ga0496112_0901887 3300048915 Bacteria 806
321 Ga0496113_0023338 3300048916 Bacteria 4387
322 Ga0496113_0054205 3300048916 Bacteria 3000
323 Ga0496113_0061471 3300048916 Bacteria 2834
324 Ga0496113_0076135 3300048916 Bacteria 2563
325 Ga0496113_0371433 3300048916 Bacteria 1148
326 Ga0496114_0018952 3300048917 Bacteria 5573
327 Ga0496114_0083164 3300048917 Bacteria 2708
328 Ga0496115_0083449 3300048918 Bacteria 2604
329 Ga0501031_0010138 3300049568 Bacteria 6141
330 Ga0501032_0024367 3300049569 Bacteria 4179
331 Ga0501033_0232017 3300049570 Bacteria 1311
332 Ga0501034_0012214 3300049571 Bacteria 8879
333 Ga0501034_0040532 3300049571 Bacteria 4714
334 Ga0501034_0057559 3300049571 Bacteria 3908
335 Ga0501036_0002342 3300049572 Bacteria 14811
336 Ga0501037_0004444 3300049573 Bacteria 10182
337 Ga0501038_0002437 3300049574 Bacteria 17323
338 Ga0501038_0030197 3300049574 Bacteria 4798
339 Ga0501039_0080293 3300049575 Bacteria 2538
340 Ga0501039_0551521 3300049575 Bacteria 904
341 Ga0501043_0007838 3300049579 Bacteria 8442
342 Ga0501046_0001378 3300049580 Bacteria 23382
343 Ga0501046_0075256 3300049580 Bacteria 2618
344 Ga0501047_0002036 3300049581 Bacteria 19313
345 Ga0501048_0001227 3300049582 Bacteria 19414
346 Ga0501069_0226018 3300049585 Bacteria 1089
347 Ga0501070_0022653 3300049586 Bacteria 5260
348 Ga0501070_0063197 3300049586 Bacteria 3067
349 Ga0501079_0082741 3300049741 Bacteria 2483
350 Ga0501080_0007104 3300049742 Bacteria 10110
351 Ga0501080_0405519 3300049742 Bacteria 1226
352 Ga0501083_0002204 3300049744 Bacteria 13324
353 Ga0501035_0009511 3300049822 Bacteria 9039
354 Ga0501044_0004445 3300049823 Bacteria 15684
355 Ga0501044_0020494 3300049823 Bacteria 7060
356 nmdc:mga0n895_46977_c1 3300050512 Bacteria 4220
357 nmdc:mga0a205_277161_c1 3300050515 Bacteria 1553
358 Ga0495601_0013731 3300053077 Bacteria 4873
359 Ga0495601_0217485 3300053077 Bacteria 1248
360 Ga0495612_0117601 3300053078 Bacteria 1142
361 Ga0495595_0061545 3300053084 Bacteria 1758
362 Ga0495595_0129962 3300053084 Bacteria 1231
363 Ga0495619_0084825 3300053085 Bacteria 2138
364 Ga0501084_0264281 3300054114 Bacteria 1453
365 Ga0501082_0169672 3300060353 Bacteria 1897
366 Ga0466962_0048995 3300061719 Bacteria 2019
367 2816509351 2816332139 Bacteria 9138787
368 8054472279 8054472261 Bacteria 7464355
369 Ga0466967_0611935
370 JGI25406J46586_10018575
371 Ga0070683_100104923
372 Ga0070671_100106825
373 Ga0070709_10093046
374 Ga0070709_10108205
375 Ga0070714_100015071
376 Ga0070714_100017652
377 Ga0070714_100135208
378 Ga0070714_100255433
379 Ga0070714_100357512
380 Ga0070713_100014503
381 Ga0070713_100150593
382 Ga0070713_100330193
383 Ga0070713_100588732
384 Ga0070710_10205432
385 Ga0070711_100030696
386 Ga0070711_100521366
387 Ga0070705_100048093
388 Ga0070681_10000239
389 Ga0070679_100006404
390 Ga0070665_100015743
391 Ga0068855_100316180
392 Ga0070664_100135151
393 Ga0070664_100275616
394 Ga0068856_100000782
395 Ga0068856_100018519
396 Ga0068856_100046784
397 Ga0068856_100385345
398 Ga0068863_100023974
399 Ga0068863_100080778
400 Ga0081540_1020575
401 Ga0081539_10000538
402 Ga0081539_10008330
403 Ga0070717_10003840
404 Ga0070717_10029257
405 Ga0070717_10044396
406 Ga0070717_10052292
407 Ga0070716_100029036
408 Ga0070712_100061778
409 Ga0075434_100011970
410 Ga0075435_100182381
411 Ga0105240_10002678
412 Ga0105245_10048738
413 Ga0105241_10117861
414 Ga0105237_10305066
415 Ga0105238_10107709
416 Ga0105238_10155879
417 Ga0105238_10593205
418 Ga0105239_10049178
419 Ga0157369_10243764
420 Ga0157372_10206236
421 Ga0157372_11033440
422 Ga0157375_10267966
423 Ga0157375_10480638
424 Ga0163163_10108711
425 Ga0163163_10420776
426 Ga0157379_10391035
427 Ga0197907_11488564
428 Ga0206354_10811441
429 Ga0213873_10113916
430 Ga0213874_10000364
431 Ga0213874_10022884
432 Ga0213874_10099519
433 Ga0213876_10002891
434 Ga0213876_10030950
435 Ga0213876_10035621
436 Ga0213876_10050692
437 Ga0213875_10000126
438 Ga0213875_10013612
439 Ga0213875_10020998
440 Ga0213875_10042098
441 Ga0213875_10044918
442 Ga0213875_10056178
443 Ga0207692_10009874
444 Ga0207654_10222385
445 Ga0207707_10009090
446 Ga0207707_10121438
447 Ga0207695_10304120
448 Ga0207693_10004284
449 Ga0207652_10022421
450 Ga0207694_10492132
451 Ga0207700_10013286
452 Ga0207700_10020375
453 Ga0207700_10066665
454 Ga0207664_10035499
455 Ga0207664_10060967
456 Ga0207664_10122323
457 Ga0207664_10169174
458 Ga0207644_10011665
459 Ga0207686_10220446
460 Ga0207709_10244899
461 Ga0207704_10184843
462 Ga0207665_10019804
463 Ga0207711_10198413
464 Ga0207679_10292817
465 Ga0207667_10189653
466 Ga0207667_10211928
467 Ga0207712_10039219
468 Ga0207640_10068541
469 Ga0207658_10139965
470 Ga0207708_10233482
471 Ga0207702_10008262
472 Ga0207702_10016101
473 Ga0207702_10018978
474 Ga0207702_10300741
475 Ga0207702_10439121
476 Ga0207641_10021776
477 Ga0207641_10026435
478 Ga0207648_10528980
479 Ga0207676_10071951
480 Ga0207674_10499833
481 Ga0268266_10017673
482 Ga0265337_1024396
483 Ga0265319_1000015
484 Ga0265319_1003260
485 Ga0265318_10008483
486 Ga0265322_10022190
487 Ga0265338_10006881
488 Ga0265330_10026610
489 Ga0265320_10015519
490 Ga0265320_10016527
491 Ga0265339_10105376
492 Ga0265316_10201666
493 Ga0307513_10078779
494 Ga0307508_10383818
495 Ga0265314_10041302
496 Ga0307410_10373766
497 Ga0307406_10207597
498 Ga0307409_100550646
499 Ga0307409_100661219
500 Ga0307416_100016676
501 Ga0373930_0003309
502 Ga0373958_0050193
503 Ga0373929_0024622
504 Ga0373934_0037538
505 Ga0373940_0000672
506 Ga0373944_0040579
507 Ga0373952_0002724
508 Ga0373923_0008487
509 Ga0373939_0015411
510 Ga0373953_0008010
511 Ga0373954_0084111
512 Ga0373956_0017211
513 Ga0373955_0051300
514 Ga0373962_0033392
515 Ga0373924_0005965
516 Ga0373924_0091248
517 Ga0373931_0091612
518 Ga0373933_0000604
519 Ga0373947_0151765
520 Ga0373937_0001588
521 Ga0373937_0490187
522 Ga0395898_0003208
523 Ga0395898_0286870
524 Ga0395898_0479234
525 Ga0436364_0035595
526 Ga0436364_0072848
527 Ga0436364_0089703
528 Ga0436364_0121332
529 Ga0436364_0776180
530 Ga0436364_0801981
531 Ga0436364_0861621
532 Ga0436364_1065157
533 Ga0436365_0975062
534 Ga0436365_1006535
535 Ga0436365_1102108
536 Ga0436365_1113241
537 Ga0436365_1209233
538 Ga0436365_1227779
539 Ga0436365_1309855
540 Ga0436365_1335065
541 Ga0436365_1885561
542 Ga0436360_1125491
543 Ga0436363_0156650
544 Ga0436363_0544204
545 Ga0436363_0858966
546 Ga0436363_1329056
547 Ga0436363_1680632
548 Ga0436362_0009472
549 Ga0436362_0049551
550 Ga0436362_1183667
551 Ga0436362_1200922
552 Ga0436362_1278865
553 Ga0451807_1249833
554 Ga0466969_0048968
555 Ga0466969_0050670
556 Ga0466969_0066607
557 Ga0466965_0005938
558 Ga0466965_0049169
559 Ga0466965_0061198
560 Ga0466965_0076913
561 Ga0466965_0281876
562 Ga0466966_0036134
563 Ga0466966_0087421
564 Ga0466961_0007626
565 Ga0466961_0123286
566 Ga0466961_0204344
567 Ga0466961_0209719
568 Ga0466961_0213079
569 Ga0466961_0317975
570 Ga0466961_0367053
571 Ga0466963_0003404
572 Ga0466963_0017466
573 Ga0466963_0018209
574 Ga0466963_0026344
575 Ga0466963_0038703
576 Ga0466964_0017045
577 Ga0466971_0001238
578 Ga0466971_0007606
579 Ga0466971_0009599
580 Ga0466968_0191678
581 Ga0466970_0013111
582 Ga0466970_0077594
583 Ga0466970_0207797
584 Ga0466970_0210423
585 Ga0466957_0024386
586 Ga0466957_0115618
587 Ga0466960_0003790
588 Ga0466959_0003575
589 Ga0466959_0006221
590 Ga0466959_0045094
591 Ga0466959_0065995
592 Ga0466959_0089471
593 Ga0466959_0126292
594 Ga0466959_0166301
595 Ga0466959_0175913
596 Ga0466959_0229639
597 Ga0466958_0001053
598 Ga0466958_0002662
599 Ga0466958_0006976
600 Ga0466958_0082236
601 Ga0466958_0098973
602 Ga0466958_0202356
603 Ga0466958_0227353
604 Ga0466958_0263183
605 Ga0466967_0008304
606 Ga0466967_0010928
607 Ga0466967_0059886
608 Ga0466967_0117096
609 Ga0466967_0169868
610 Ga0466967_0299625
611 Ga0466967_0426436
612 Ga0495592_0026781
613 Ga0495603_0190146
614 Ga0495603_0207013
615 Ga0495629_0006528
616 Ga0495641_0079064
617 Ga0495651_0052365
618 Ga0495653_0110525
619 Ga0495650_0024535
620 Ga0495664_0120076
621 Ga0495664_0244776
622 Ga0495608_0036454
623 Ga0495608_0089322
624 Ga0495618_0021602
625 Ga0495618_0156648
626 Ga0495628_0023178
627 Ga0495666_0017475
628 Ga0495652_0130101
629 Ga0495652_0156584
630 Ga0495665_0002424
631 Ga0495665_0239749
632 Ga0495640_0107231
633 Ga0495640_0297176
634 Ga0495586_0122329
635 Ga0495587_0253593
636 Ga0495645_0121262
637 Ga0495645_0221960
638 Ga0495667_0040521
639 Ga0495667_0185899
640 Ga0495634_0012224
641 Ga0495634_0184806
642 Ga0495635_0044143
643 Ga0495635_0052394
644 Ga0495657_0032465
645 Ga0495599_0071699
646 Ga0495623_0021519
647 Ga0495623_0111402
648 Ga0495646_0020057
649 Ga0495658_0199230
650 Ga0495658_0246201
651 Ga0495613_0114545
652 Ga0495613_0161958
653 Ga0495613_0258321
654 Ga0495600_0226260
655 Ga0495581_0019981
656 Ga0495581_0031906
657 Ga0495604_0043400
658 Ga0495604_0550339
659 Ga0495674_0037226
660 Ga0495676_0071256
661 Ga0495680_0053727
662 Ga0495680_0317782
663 Ga0495675_0082210
664 Ga0495675_0171576
665 Ga0495684_0012449
666 Ga0495684_0112564
667 Ga0495593_0014823
668 Ga0495602_0067909
669 Ga0495602_0152439
670 Ga0496102_0116602
671 Ga0496104_0084546
672 Ga0496105_0024475
673 Ga0496105_0280659
674 Ga0496106_0142110
675 Ga0496107_0337241
676 Ga0496108_0038983
677 Ga0496108_0729821
678 Ga0496109_0018773
679 Ga0496109_0203608
680 Ga0496110_0100534
681 Ga0496110_0156556
682 Ga0496111_0070183
683 Ga0496111_0193314
684 Ga0496111_0487464
685 Ga0496112_0005596
686 Ga0496112_0007783
687 Ga0496112_0019993
688 Ga0496112_0901887
689 Ga0496113_0023338
690 Ga0496113_0054205
691 Ga0496113_0061471
692 Ga0496113_0076135
693 Ga0496113_0371433
694 Ga0496114_0018952
695 Ga0496114_0083164
696 Ga0496115_0083449
697 Ga0501031_0010138
698 Ga0501032_0024367
699 Ga0501033_0232017
700 Ga0501034_0012214
701 Ga0501034_0040532
702 Ga0501034_0057559
703 Ga0501036_0002342
704 Ga0501037_0004444
705 Ga0501038_0002437
706 Ga0501038_0030197
707 Ga0501039_0080293
708 Ga0501039_0551521
709 Ga0501043_0007838
710 Ga0501046_0001378
711 Ga0501046_0075256
712 Ga0501047_0002036
713 Ga0501048_0001227
714 Ga0501069_0226018
715 Ga0501070_0022653
716 Ga0501070_0063197
717 Ga0501079_0082741
718 Ga0501080_0007104
719 Ga0501080_0405519
720 Ga0501083_0002204
721 Ga0501035_0009511
722 Ga0501044_0004445
723 Ga0501044_0020494
724 nmdc:mga0n895_46977_c1
725 nmdc:mga0a205_277161_c1
726 Ga0495601_0013731
727 Ga0495601_0217485
728 Ga0495612_0117601
729 Ga0495595_0061545
730 Ga0495595_0129962
731 Ga0495619_0084825
732 Ga0501084_0264281
733 Ga0501082_0169672
734 Ga0466962_0048995
735 2816509351
736 8054472279

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00775

Dioxygenase_C

Dioxygenase

72

253

0.97

PF12391

PCDO_beta_N

Protocatechuate 3,4-dioxygenase beta subunit N terminal

34

68

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1eo9-assembly1.cif.gz_A crystal structure of acinetobacter sp. adp1 protocatechuate 3,4-dioxygenase at ph < 7.0 0.8485 70 230
2bux-assembly1.cif.gz_A crystal structure of protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 mutant r133h 0.8391 70 229
2bum-assembly1.cif.gz_A crystal structure of wild-type protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 0.8286 70 230
5vxt-assembly1.cif.gz_A crystal structure of catechol 1,2-dioxygenase from burkholderia ambifaria 0.7709 71 226
4ilt-assembly2.cif.gz_B structure of the dioxygenase domain of sacte_2871, a novel dioxygenase carbohydrate-binding protein fusion from the cellulolytic bacterium streptomyces sp. sirexaa-e 0.7673 63 229
ID Description Score Start End Superfamily
2boyB00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7639 66 226 2.60.130.10
1tmxA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.761 81 226 2.60.130.10
4iltA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7504 57 227 2.60.130.10
1eo2B00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7412 20 238 2.60.130.10
5umhB00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7403 72 231 2.60.130.10
ID Description Score Start End GO Terms
AF-A0A656K1J9-F1-model_v4 Protocatechuate 3,4-dioxygenase subunit beta 0.9724 78 160 GO:0008199
GO:0016702
AF-A0A7H4ML90-F1-model_v4 Protocatechuate 34-dioxygenase subunit beta (EC 1.13.11.3) 0.9446 100 178 GO:0008199
GO:0018578
AF-D7H720-F1-model_v4 deleted 0.9418 66 187
AF-F8UVH2-F1-model_v4 Putative protocatechuate 3,4-dioxygenase alpha chain 0.9386 82 189 GO:0008199
GO:0009056
GO:0018578
AF-A0A2I1MKP1-F1-model_v4 Protocatechuate 3,4-dioxygenase subunit beta 0.933 70 234 GO:0008199
GO:0016702

Map