F424784

General Info

Members Datasets Scaffolds Average Seq Length
368 206 736 118

Family's Representative Sequence

Representative Sequence 3300039453|Ga0436362_0744665|Ga0436362_0744665_484_915
Length 143
Sequence MWSQHRRHATPQSKLDLLQGTLDVMVLQALEVLGPLHGYGIARRIEQVSGNEVLLNQGTIYASLVRLQQRGWIAAKWGTSDNNRKAKFYSITKAGKKQLVEDTAYWQRLSEVTRRVLSCTARQVASDAFPSRSLQPNPLFLPQ

Samples

Sample ID Description Type Environment
1 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
74 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
120 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
121 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
124 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
178 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
179 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
206 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 3.53
Rhizosphere 90.49
Stem 0
Stem Tuber 0
Unclassified 29.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436362_0744665 3300039453 Bacteria 1366
2 Ga0070683_100089904 3300005329 Unclassified 2883
3 Ga0070670_100052000 3300005331 Unclassified 3518
4 Ga0068869_100017807 3300005334 Bacteria 4825
5 Ga0070666_10015688 3300005335 Bacteria 4835
6 Ga0070680_100098918 3300005336 Bacteria 2420
7 Ga0068868_100039514 3300005338 Bacteria 3666
8 Ga0068868_100188344 3300005338 Unclassified 1715
9 Ga0070668_100053166 3300005347 Bacteria 3123
10 Ga0070675_100108607 3300005354 Unclassified 2343
11 Ga0070671_100227547 3300005355 Bacteria 1582
12 Ga0070667_100035450 3300005367 Bacteria 4179
13 Ga0070709_10411937 3300005434 Unclassified 1011
14 Ga0070714_101275030 3300005435 Unclassified 717
15 Ga0070713_100191150 3300005436 Bacteria 1845
16 Ga0070713_100570227 3300005436 Bacteria 1073
17 Ga0070713_101256927 3300005436 Bacteria 717
18 Ga0070710_10126374 3300005437 Unclassified 1554
19 Ga0070710_10652730 3300005437 Unclassified 738
20 Ga0070711_100179748 3300005439 Bacteria 1619
21 Ga0070711_100182204 3300005439 Bacteria 1608
22 Ga0070708_100049089 3300005445 Bacteria 3733
23 Ga0070663_100028438 3300005455 Bacteria 3806
24 Ga0070678_100005029 3300005456 Bacteria 7583
25 Ga0070662_100036228 3300005457 Bacteria 3488
26 Ga0070681_10001183 3300005458 Bacteria 22563
27 Ga0070681_10050475 3300005458 Bacteria 4150
28 Ga0070681_10174333 3300005458 Unclassified 2072
29 Ga0070681_11917158 3300005458 Unclassified 520
30 Ga0070706_100092235 3300005467 Plasmid 2810
31 Ga0070707_100170731 3300005468 Unclassified 2119
32 Ga0070707_100578794 3300005468 Bacteria 1085
33 Ga0070698_100080726 3300005471 Unclassified 3247
34 Ga0070699_100045226 3300005518 Bacteria 3810
35 Ga0070679_100001523 3300005530 Bacteria 20647
36 Ga0070679_100005254 3300005530 Bacteria 11987
37 Ga0070679_100059090 3300005530 Unclassified 3822
38 Ga0070679_100192652 3300005530 Bacteria 2007
39 Ga0070684_100076948 3300005535 Unclassified 2946
40 Ga0070684_100083906 3300005535 Bacteria 2824
41 Ga0070684_101373247 3300005535 Unclassified 665
42 Ga0068853_100134418 3300005539 Unclassified 2216
43 Ga0068853_100421804 3300005539 Bacteria 1251
44 Ga0068853_100626925 3300005539 Bacteria 1022
45 Ga0070672_100216230 3300005543 Bacteria 1606
46 Ga0070665_100003678 3300005548 Bacteria 16256
47 Ga0070665_100216639 3300005548 Bacteria 1915
48 Ga0070665_101804641 3300005548 Bacteria 618
49 Ga0068855_100000518 3300005563 Bacteria 47531
50 Ga0068855_100002017 3300005563 Bacteria 25189
51 Ga0068855_100048501 3300005563 Bacteria 5011
52 Ga0068855_100553199 3300005563 Unclassified 1245
53 Ga0068855_101773832 3300005563 Unclassified 628
54 Ga0070664_100271808 3300005564 Bacteria 1527
55 Ga0070664_101259495 3300005564 Unclassified 698
56 Ga0068857_100006486 3300005577 Bacteria 10035
57 Ga0068854_100263758 3300005578 Bacteria 1380
58 Ga0068856_100005181 3300005614 Bacteria 12869
59 Ga0068856_100166343 3300005614 Bacteria 2216
60 Ga0068856_100167044 3300005614 Bacteria 2211
61 Ga0068856_101590058 3300005614 Unclassified 667
62 Ga0068852_100050619 3300005616 Bacteria 3560
63 Ga0068852_100060185 3300005616 Bacteria 3297
64 Ga0068852_100404575 3300005616 Bacteria 1343
65 Ga0068859_100067527 3300005617 Bacteria 3610
66 Ga0068859_101759972 3300005617 Unclassified 684
67 Ga0068864_100190753 3300005618 Bacteria 1879
68 Ga0068864_102064141 3300005618 Unclassified 576
69 Ga0068858_100102311 3300005842 Bacteria 2672
70 Ga0081455_10050532 3300005937 Unclassified 3575
71 Ga0081455_10126528 3300005937 Unclassified 2005
72 Ga0070717_10115664 3300006028 Bacteria 2292
73 Ga0070717_10139796 3300006028 Bacteria 2088
74 Ga0070717_10966992 3300006028 Unclassified 775
75 Ga0070717_11910153 3300006028 Unclassified 536
76 Ga0070715_10038264 3300006163 Bacteria 1990
77 Ga0070716_100434344 3300006173 Unclassified 953
78 Ga0070716_100817071 3300006173 Unclassified 723
79 Ga0070712_100170852 3300006175 Bacteria 1687
80 Ga0070712_100292332 3300006175 Unclassified 1316
81 Ga0070712_100311863 3300006175 Unclassified 1277
82 Ga0097621_100000893 3300006237 Bacteria 20904
83 Ga0097621_100003634 3300006237 Bacteria 10659
84 Ga0097621_101335786 3300006237 Bacteria 678
85 Ga0068871_100000140 3300006358 Bacteria 46678
86 Ga0068871_100053796 3300006358 Bacteria 3264
87 Ga0068871_100120801 3300006358 Bacteria 2213
88 Ga0068871_100143294 3300006358 Bacteria 2033
89 Ga0075428_100672894 3300006844 Unclassified 1103
90 Ga0075428_101151456 3300006844 Unclassified 818
91 Ga0075428_101481768 3300006844 Unclassified 711
92 Ga0068865_100381654 3300006881 Bacteria 1149
93 Ga0075436_100329833 3300006914 Bacteria 1097
94 Ga0097620_100067526 3300006931 Bacteria 3610
95 Ga0097620_101760504 3300006931 Unclassified 684
96 Ga0105240_10015029 3300009093 Bacteria 10540
97 Ga0105240_10029102 3300009093 Bacteria 7203
98 Ga0105240_10082392 3300009093 Unclassified 3951
99 Ga0105240_10819783 3300009093 Archaea 1007
100 Ga0111539_10289091 3300009094 Bacteria 1908
101 Ga0105245_10014683 3300009098 Bacteria 6821
102 Ga0105245_10801736 3300009098 Unclassified 980
103 Ga0105245_11306611 3300009098 Bacteria 774
104 Ga0105247_10119451 3300009101 Bacteria 1706
105 Ga0105247_10131731 3300009101 Bacteria 1630
106 Ga0105241_10030918 3300009174 Bacteria 4005
107 Ga0105241_10032669 3300009174 Bacteria 3903
108 Ga0105241_10121995 3300009174 Bacteria 2100
109 Ga0105242_10095212 3300009176 Bacteria 2513
110 Ga0105248_10030884 3300009177 Bacteria 5985
111 Ga0105248_10082754 3300009177 Bacteria 3610
112 Ga0105237_10034476 3300009545 Bacteria 5124
113 Ga0105237_10196996 3300009545 Bacteria 2014
114 Ga0105237_10697279 3300009545 Unclassified 1022
115 Ga0105237_10910726 3300009545 Unclassified 886
116 Ga0105238_10021453 3300009551 Bacteria 6578
117 Ga0105238_10574425 3300009551 Unclassified 1133
118 Ga0105239_10005929 3300010375 Bacteria 14221
119 Ga0105239_10088807 3300010375 Unclassified 3408
120 Ga0105239_10233144 3300010375 Bacteria 2065
121 Ga0105239_10854181 3300010375 Unclassified 1044
122 Ga0105246_10037789 3300011119 Bacteria 3241
123 Ga0157373_10035845 3300013100 Bacteria 3561
124 Ga0157373_10085914 3300013100 Bacteria 2217
125 Ga0157370_10035474 3300013104 Bacteria 4847
126 Ga0157370_11513753 3300013104 Unclassified 603
127 Ga0157369_10000569 3300013105 Bacteria 48601
128 Ga0157369_10200480 3300013105 Bacteria 2095
129 Ga0157369_10335226 3300013105 Unclassified 1571
130 Ga0157369_10456389 3300013105 Archaea 1323
131 Ga0157369_10576082 3300013105 Bacteria 1163
132 Ga0157369_10674641 3300013105 Bacteria 1065
133 Ga0157374_10000284 3300013296 Bacteria 46945
134 Ga0157374_10089675 3300013296 Bacteria 2930
135 Ga0157378_10012485 3300013297 Bacteria 7438
136 Ga0157378_10049364 3300013297 Bacteria 3743
137 Ga0157378_10306501 3300013297 Unclassified 1539
138 Ga0157378_10333668 3300013297 Bacteria 1476
139 Ga0157372_10000265 3300013307 Bacteria 58016
140 Ga0157372_10013619 3300013307 Bacteria 8693
141 Ga0157372_10123147 3300013307 Bacteria 2980
142 Ga0157372_10486108 3300013307 Bacteria 1439
143 Ga0157372_10520929 3300013307 Bacteria 1386
144 Ga0157375_10448704 3300013308 Bacteria 1455
145 Ga0157380_10431473 3300014326 Bacteria 1260
146 Ga0157380_12196737 3300014326 Bacteria 616
147 Ga0157380_13320779 3300014326 Bacteria 514
148 Ga0157379_10117500 3300014968 Bacteria 2392
149 Ga0157376_10032578 3300014969 Bacteria 4185
150 Ga0157376_10048480 3300014969 Bacteria 3512
151 Ga0163161_10039714 3300017792 Bacteria 3380
152 Ga0213872_10327934 3300021361 Bacteria 631
153 Ga0213874_10442476 3300021377 Unclassified 512
154 Ga0213876_10097548 3300021384 Unclassified 1557
155 Ga0213875_10050665 3300021388 Unclassified 1945
156 Ga0213875_10428475 3300021388 Bacteria 632
157 Ga0213875_10449778 3300021388 Unclassified 616
158 Ga0207685_10065730 3300025905 Unclassified 1453
159 Ga0207699_10353951 3300025906 Unclassified 1037
160 Ga0207699_11036926 3300025906 Bacteria 607
161 Ga0207705_10760821 3300025909 Bacteria 752
162 Ga0207684_10769153 3300025910 Bacteria 815
163 Ga0207654_10017605 3300025911 Bacteria 3740
164 Ga0207654_10105482 3300025911 Bacteria 1744
165 Ga0207654_10270558 3300025911 Unclassified 1146
166 Ga0207707_10006372 3300025912 Bacteria 10300
167 Ga0207707_10418843 3300025912 Bacteria 1149
168 Ga0207707_10478537 3300025912 Bacteria 1064
169 Ga0207707_11541534 3300025912 Unclassified 525
170 Ga0207695_10028307 3300025913 Bacteria 6218
171 Ga0207695_10076012 3300025913 Bacteria 3415
172 Ga0207695_10260622 3300025913 Bacteria 1631
173 Ga0207671_10150956 3300025914 Bacteria 1795
174 Ga0207693_10042301 3300025915 Bacteria 3586
175 Ga0207693_10235902 3300025915 Unclassified 1436
176 Ga0207663_10141215 3300025916 Unclassified 1678
177 Ga0207663_10169963 3300025916 Unclassified 1547
178 Ga0207660_10006320 3300025917 Bacteria 7680
179 Ga0207660_10077850 3300025917 Bacteria 2429
180 Ga0207657_10262437 3300025919 Bacteria 1374
181 Ga0207652_10000522 3300025921 Bacteria 39021
182 Ga0207652_10000995 3300025921 Bacteria 26201
183 Ga0207652_10165676 3300025921 Unclassified 1982
184 Ga0207646_10046043 3300025922 Bacteria 3915
185 Ga0207646_10253673 3300025922 Bacteria 1589
186 Ga0207646_10310561 3300025922 Unclassified 1424
187 Ga0207694_10011705 3300025924 Bacteria 6618
188 Ga0207694_10290122 3300025924 Unclassified 1345
189 Ga0207694_10927959 3300025924 Unclassified 736
190 Ga0207687_10033604 3300025927 Bacteria 3479
191 Ga0207700_10044618 3300025928 Unclassified 3265
192 Ga0207700_10238727 3300025928 Bacteria 1548
193 Ga0207700_11546805 3300025928 Unclassified 588
194 Ga0207664_11132658 3300025929 Unclassified 699
195 Ga0207706_10002468 3300025933 Bacteria 18023
196 Ga0207665_10142339 3300025939 Bacteria 1711
197 Ga0207665_10146433 3300025939 Unclassified 1688
198 Ga0207665_10487377 3300025939 Unclassified 951
199 Ga0207691_10030797 3300025940 Bacteria 5011
200 Ga0207711_10042125 3300025941 Bacteria 3889
201 Ga0207711_10157539 3300025941 Bacteria 2053
202 Ga0207689_10315735 3300025942 Unclassified 1296
203 Ga0207667_10001624 3300025949 Bacteria 28284
204 Ga0207667_10515285 3300025949 Unclassified 1212
205 Ga0207667_11016450 3300025949 Unclassified 816
206 Ga0207668_10378856 3300025972 Bacteria 1190
207 Ga0207640_10250756 3300025981 Unclassified 1374
208 Ga0207640_10914376 3300025981 Bacteria 767
209 Ga0207658_10108074 3300025986 Bacteria 2193
210 Ga0207677_10482138 3300026023 Bacteria 1069
211 Ga0207703_11195082 3300026035 Unclassified 731
212 Ga0207639_10113096 3300026041 Unclassified 2217
213 Ga0207639_11497612 3300026041 Bacteria 633
214 Ga0207678_10268442 3300026067 Bacteria 1463
215 Ga0207678_10370714 3300026067 Bacteria 1237
216 Ga0207702_10000354 3300026078 Bacteria 52521
217 Ga0207702_10211746 3300026078 Bacteria 1802
218 Ga0207702_11387115 3300026078 Unclassified 697
219 Ga0207648_11963159 3300026089 Unclassified 547
220 Ga0207676_10242410 3300026095 Bacteria 1618
221 Ga0207674_10003732 3300026116 Bacteria 18591
222 Ga0207683_10002472 3300026121 Bacteria 16127
223 Ga0207698_10151655 3300026142 Bacteria 2013
224 Ga0268266_10000267 3300028379 Bacteria 86736
225 Ga0268266_10695932 3300028379 Bacteria 979
226 Ga0265338_10652362 3300028800 Bacteria 729
227 Ga0265760_10017252 3300031090 Unclassified 2073
228 Ga0265325_10028795 3300031241 Unclassified 2990
229 Ga0265331_10028324 3300031250 Bacteria 2802
230 Ga0307510_10184065 3300033180 Bacteria 1647
231 Ga0307510_10281579 3300033180 Bacteria 1133
232 Ga0373934_0004046 3300035086 Bacteria 5401
233 Ga0373923_0104038 3300035111 Bacteria 1255
234 Ga0373954_0002912 3300035118 Bacteria 7220
235 Ga0373956_0002158 3300035119 Bacteria 8131
236 Ga0373957_0257943 3300035120 Bacteria 734
237 Ga0373955_0000159 3300035172 Bacteria 27173
238 Ga0373924_0258405 3300035410 Bacteria 772
239 Ga0373931_0136719 3300035691 Bacteria 1415
240 Ga0373935_0507241 3300035692 Bacteria 876
241 Ga0373935_1195420 3300035692 Bacteria 567
242 Ga0373933_0015068 3300035724 Unclassified 4309
243 Ga0373947_0528838 3300035725 Unclassified 802
244 Ga0373947_0830496 3300035725 Bacteria 631
245 Ga0373937_0002331 3300036401 Bacteria 15854
246 Ga0373937_0087363 3300036401 Plasmid 2886
247 Ga0373937_1212060 3300036401 Bacteria 703
248 Ga0373925_0189658 3300037068 Viruses 1630
249 Ga0373925_0266968 3300037068 Bacteria 1376
250 Ga0373925_0467588 3300037068 Bacteria 1034
251 Ga0395900_0486849 3300037418 Bacteria 1185
252 Ga0395900_1583625 3300037418 Unclassified 567
253 Ga0395898_0460821 3300037466 Bacteria 1210
254 Ga0436364_0056456 3300037853 Bacteria 2637
255 Ga0436364_0403566 3300037853 Bacteria 587
256 Ga0436364_0671096 3300037853 Bacteria 3506
257 Ga0436364_1025202 3300037853 Bacteria 1656
258 Ga0436364_1301999 3300037853 Unclassified 842
259 Ga0395901_1084088 3300038443 Bacteria 772
260 Ga0436365_1136890 3300039437 Bacteria 1895
261 Ga0436365_1551220 3300039437 Unclassified 1432
262 Ga0436365_1866606 3300039437 Bacteria 982
263 Ga0436365_1871597 3300039437 Bacteria 514
264 Ga0436360_0341971 3300039438 Unclassified 531
265 Ga0436361_0212413 3300039447 Bacteria 5257
266 Ga0436363_0125554 3300039450 Bacteria 1054
267 Ga0436363_1030659 3300039450 Bacteria 10719
268 Ga0436363_1628206 3300039450 Unclassified 903
269 Ga0436362_0963920 3300039453 Unclassified 728
270 Ga0466965_0923733 3300044683 Unclassified 510
271 Ga0466966_0304458 3300044684 Archaea 958
272 Ga0466961_0305786 3300044693 Unclassified 971
273 Ga0466963_0120549 3300044694 Unclassified 1805
274 Ga0466963_0578665 3300044694 Unclassified 793
275 Ga0466968_0255053 3300044735 Bacteria 834
276 Ga0466968_0554254 3300044735 Bacteria 577
277 Ga0466959_0126355 3300045049 Bacteria 1815
278 Ga0466959_0464278 3300045049 Bacteria 858
279 Ga0451576_0289271 3300045051 Bacteria 1713
280 Ga0466958_0698587 3300045836 Bacteria 661
281 Ga0466967_0099434 3300045976 Bacteria 2657
282 Ga0466967_0356376 3300045976 Unclassified 1417
283 Ga0466967_0436610 3300045976 Bacteria 1278
284 Ga0466967_0657240 3300045976 Unclassified 1037
285 Ga0466967_1027489 3300045976 Bacteria 821
286 Ga0495603_0012598 3300046455 Bacteria 5117
287 Ga0495629_0008031 3300046459 Bacteria 7767
288 Ga0495629_0117579 3300046459 Unclassified 1852
289 Ga0495651_0009002 3300046462 Bacteria 7665
290 Ga0495651_0530012 3300046462 Unclassified 751
291 Ga0495653_0083402 3300046463 Unclassified 2357
292 Ga0495580_0205162 3300046472 Unclassified 1357
293 Ga0495582_0112096 3300046473 Bacteria 1532
294 Ga0495582_0168443 3300046473 Unclassified 1247
295 Ga0495639_0192900 3300046475 Bacteria 995
296 Ga0495662_0015820 3300046476 Bacteria 3662
297 Ga0495664_0688927 3300046477 Bacteria 604
298 Ga0495585_0302198 3300046492 Bacteria 786
299 Ga0495594_0225125 3300046499 Bacteria 1069
300 Ga0495608_0725701 3300046511 Bacteria 590
301 Ga0495628_0066380 3300046516 Bacteria 2821
302 Ga0495630_0207017 3300046517 Bacteria 1497
303 Ga0495630_0610917 3300046517 Bacteria 836
304 Ga0495666_0058581 3300046526 Bacteria 1842
305 Ga0495652_0114605 3300046529 Unclassified 2162
306 Ga0495652_0613050 3300046529 Unclassified 741
307 Ga0495665_0033111 3300046531 Bacteria 2765
308 Ga0495665_0111213 3300046531 Bacteria 1437
309 Ga0495665_0135969 3300046531 Bacteria 1286
310 Ga0495640_0025423 3300046533 Bacteria 4296
311 Ga0495586_0030614 3300046535 Bacteria 2880
312 Ga0495586_0327190 3300046535 Bacteria 879
313 Ga0495587_0010729 3300046536 Bacteria 5816
314 Ga0495587_0036873 3300046536 Unclassified 2939
315 Ga0495645_0101575 3300046543 Unclassified 2044
316 Ga0495645_0144839 3300046543 Bacteria 1655
317 Ga0495622_0135250 3300046557 Bacteria 1121
318 Ga0495667_0069463 3300046559 Bacteria 2299
319 Ga0495634_0046487 3300046642 Bacteria 2929
320 Ga0495625_0041436 3300046660 Bacteria 3352
321 Ga0495625_0382418 3300046660 Bacteria 883
322 Ga0495635_0851761 3300046663 Unclassified 585
323 Ga0495599_0288467 3300046678 Bacteria 993
324 Ga0495623_0023729 3300046679 Bacteria 3957
325 Ga0495646_0091968 3300046680 Bacteria 1750
326 Ga0495647_0002656 3300046681 Bacteria 5675
327 Ga0495658_0022319 3300046683 Bacteria 3345
328 Ga0495613_0101211 3300046689 Unclassified 2081
329 Ga0495613_0325798 3300046689 Bacteria 1059
330 Ga0495600_0036628 3300046809 Bacteria 3189
331 Ga0495581_0012434 3300047315 Bacteria 4930
332 Ga0495581_0496901 3300047315 Bacteria 709
333 Ga0495604_0000424 3300047317 Bacteria 38047
334 Ga0495604_0435195 3300047317 Bacteria 859
335 Ga0495674_0284404 3300047319 Bacteria 1354
336 Ga0495674_0545496 3300047319 Bacteria 923
337 Ga0495680_0022642 3300047322 Bacteria 5234
338 Ga0495680_0302306 3300047322 Bacteria 1123
339 Ga0495684_0005435 3300047471 Bacteria 9914
340 Ga0495684_0096036 3300047471 Unclassified 2243
341 Ga0495684_0229759 3300047471 Bacteria 1357
342 Ga0495602_0005733 3300048088 Bacteria 13027
343 Ga0495602_0452166 3300048088 Bacteria 906
344 Ga0495614_0070394 3300048089 Bacteria 1507
345 Ga0496100_0262684 3300048903 Bacteria 1281
346 Ga0496100_0372413 3300048903 Bacteria 1083
347 Ga0496100_0959531 3300048903 Unclassified 672
348 Ga0496102_0209469 3300048905 Bacteria 1838
349 Ga0496102_1250236 3300048905 Unclassified 662
350 Ga0496106_0390295 3300048909 Bacteria 1119
351 Ga0496107_0350299 3300048910 Bacteria 1099
352 Ga0496109_0248301 3300048912 Bacteria 1676
353 Ga0496112_0037608 3300048915 Unclassified 4724
354 Ga0496112_0070092 3300048915 Bacteria 3464
355 Ga0496115_0070778 3300048918 Bacteria 2828
356 Ga0496115_0123116 3300048918 Bacteria 2135
357 Ga0496115_0133497 3300048918 Bacteria 2046
358 Ga0496126_0000560 3300048929 Bacteria 71370
359 nmdc:mga09592_562130_c1 3300050508 Bacteria 979
360 nmdc:mga06r32_515747_c1 3300050510 Unclassified 1171
361 nmdc:mga08y16_326029_c1 3300050511 Bacteria 1580
362 nmdc:mga08x19_896562_c1 3300050514 Unclassified 630
363 Ga0495601_0062233 3300053077 Bacteria 2370
364 Ga0495612_0214131 3300053078 Bacteria 852
365 Ga0495619_0081614 3300053085 Unclassified 2178
366 Ga0495619_0712899 3300053085 Bacteria 682
367 Ga0500641_0176556 3300053096 Unclassified 918
368 Ga0500555_057970 3300053103 Unclassified 1047
369 Ga0436362_0744665
370 Ga0070683_100089904
371 Ga0070670_100052000
372 Ga0068869_100017807
373 Ga0070666_10015688
374 Ga0070680_100098918
375 Ga0068868_100039514
376 Ga0068868_100188344
377 Ga0070668_100053166
378 Ga0070675_100108607
379 Ga0070671_100227547
380 Ga0070667_100035450
381 Ga0070709_10411937
382 Ga0070714_101275030
383 Ga0070713_100191150
384 Ga0070713_100570227
385 Ga0070713_101256927
386 Ga0070710_10126374
387 Ga0070710_10652730
388 Ga0070711_100179748
389 Ga0070711_100182204
390 Ga0070708_100049089
391 Ga0070663_100028438
392 Ga0070678_100005029
393 Ga0070662_100036228
394 Ga0070681_10001183
395 Ga0070681_10050475
396 Ga0070681_10174333
397 Ga0070681_11917158
398 Ga0070706_100092235
399 Ga0070707_100170731
400 Ga0070707_100578794
401 Ga0070698_100080726
402 Ga0070699_100045226
403 Ga0070679_100001523
404 Ga0070679_100005254
405 Ga0070679_100059090
406 Ga0070679_100192652
407 Ga0070684_100076948
408 Ga0070684_100083906
409 Ga0070684_101373247
410 Ga0068853_100134418
411 Ga0068853_100421804
412 Ga0068853_100626925
413 Ga0070672_100216230
414 Ga0070665_100003678
415 Ga0070665_100216639
416 Ga0070665_101804641
417 Ga0068855_100000518
418 Ga0068855_100002017
419 Ga0068855_100048501
420 Ga0068855_100553199
421 Ga0068855_101773832
422 Ga0070664_100271808
423 Ga0070664_101259495
424 Ga0068857_100006486
425 Ga0068854_100263758
426 Ga0068856_100005181
427 Ga0068856_100166343
428 Ga0068856_100167044
429 Ga0068856_101590058
430 Ga0068852_100050619
431 Ga0068852_100060185
432 Ga0068852_100404575
433 Ga0068859_100067527
434 Ga0068859_101759972
435 Ga0068864_100190753
436 Ga0068864_102064141
437 Ga0068858_100102311
438 Ga0081455_10050532
439 Ga0081455_10126528
440 Ga0070717_10115664
441 Ga0070717_10139796
442 Ga0070717_10966992
443 Ga0070717_11910153
444 Ga0070715_10038264
445 Ga0070716_100434344
446 Ga0070716_100817071
447 Ga0070712_100170852
448 Ga0070712_100292332
449 Ga0070712_100311863
450 Ga0097621_100000893
451 Ga0097621_100003634
452 Ga0097621_101335786
453 Ga0068871_100000140
454 Ga0068871_100053796
455 Ga0068871_100120801
456 Ga0068871_100143294
457 Ga0075428_100672894
458 Ga0075428_101151456
459 Ga0075428_101481768
460 Ga0068865_100381654
461 Ga0075436_100329833
462 Ga0097620_100067526
463 Ga0097620_101760504
464 Ga0105240_10015029
465 Ga0105240_10029102
466 Ga0105240_10082392
467 Ga0105240_10819783
468 Ga0111539_10289091
469 Ga0105245_10014683
470 Ga0105245_10801736
471 Ga0105245_11306611
472 Ga0105247_10119451
473 Ga0105247_10131731
474 Ga0105241_10030918
475 Ga0105241_10032669
476 Ga0105241_10121995
477 Ga0105242_10095212
478 Ga0105248_10030884
479 Ga0105248_10082754
480 Ga0105237_10034476
481 Ga0105237_10196996
482 Ga0105237_10697279
483 Ga0105237_10910726
484 Ga0105238_10021453
485 Ga0105238_10574425
486 Ga0105239_10005929
487 Ga0105239_10088807
488 Ga0105239_10233144
489 Ga0105239_10854181
490 Ga0105246_10037789
491 Ga0157373_10035845
492 Ga0157373_10085914
493 Ga0157370_10035474
494 Ga0157370_11513753
495 Ga0157369_10000569
496 Ga0157369_10200480
497 Ga0157369_10335226
498 Ga0157369_10456389
499 Ga0157369_10576082
500 Ga0157369_10674641
501 Ga0157374_10000284
502 Ga0157374_10089675
503 Ga0157378_10012485
504 Ga0157378_10049364
505 Ga0157378_10306501
506 Ga0157378_10333668
507 Ga0157372_10000265
508 Ga0157372_10013619
509 Ga0157372_10123147
510 Ga0157372_10486108
511 Ga0157372_10520929
512 Ga0157375_10448704
513 Ga0157380_10431473
514 Ga0157380_12196737
515 Ga0157380_13320779
516 Ga0157379_10117500
517 Ga0157376_10032578
518 Ga0157376_10048480
519 Ga0163161_10039714
520 Ga0213872_10327934
521 Ga0213874_10442476
522 Ga0213876_10097548
523 Ga0213875_10050665
524 Ga0213875_10428475
525 Ga0213875_10449778
526 Ga0207685_10065730
527 Ga0207699_10353951
528 Ga0207699_11036926
529 Ga0207705_10760821
530 Ga0207684_10769153
531 Ga0207654_10017605
532 Ga0207654_10105482
533 Ga0207654_10270558
534 Ga0207707_10006372
535 Ga0207707_10418843
536 Ga0207707_10478537
537 Ga0207707_11541534
538 Ga0207695_10028307
539 Ga0207695_10076012
540 Ga0207695_10260622
541 Ga0207671_10150956
542 Ga0207693_10042301
543 Ga0207693_10235902
544 Ga0207663_10141215
545 Ga0207663_10169963
546 Ga0207660_10006320
547 Ga0207660_10077850
548 Ga0207657_10262437
549 Ga0207652_10000522
550 Ga0207652_10000995
551 Ga0207652_10165676
552 Ga0207646_10046043
553 Ga0207646_10253673
554 Ga0207646_10310561
555 Ga0207694_10011705
556 Ga0207694_10290122
557 Ga0207694_10927959
558 Ga0207687_10033604
559 Ga0207700_10044618
560 Ga0207700_10238727
561 Ga0207700_11546805
562 Ga0207664_11132658
563 Ga0207706_10002468
564 Ga0207665_10142339
565 Ga0207665_10146433
566 Ga0207665_10487377
567 Ga0207691_10030797
568 Ga0207711_10042125
569 Ga0207711_10157539
570 Ga0207689_10315735
571 Ga0207667_10001624
572 Ga0207667_10515285
573 Ga0207667_11016450
574 Ga0207668_10378856
575 Ga0207640_10250756
576 Ga0207640_10914376
577 Ga0207658_10108074
578 Ga0207677_10482138
579 Ga0207703_11195082
580 Ga0207639_10113096
581 Ga0207639_11497612
582 Ga0207678_10268442
583 Ga0207678_10370714
584 Ga0207702_10000354
585 Ga0207702_10211746
586 Ga0207702_11387115
587 Ga0207648_11963159
588 Ga0207676_10242410
589 Ga0207674_10003732
590 Ga0207683_10002472
591 Ga0207698_10151655
592 Ga0268266_10000267
593 Ga0268266_10695932
594 Ga0265338_10652362
595 Ga0265760_10017252
596 Ga0265325_10028795
597 Ga0265331_10028324
598 Ga0307510_10184065
599 Ga0307510_10281579
600 Ga0373934_0004046
601 Ga0373923_0104038
602 Ga0373954_0002912
603 Ga0373956_0002158
604 Ga0373957_0257943
605 Ga0373955_0000159
606 Ga0373924_0258405
607 Ga0373931_0136719
608 Ga0373935_0507241
609 Ga0373935_1195420
610 Ga0373933_0015068
611 Ga0373947_0528838
612 Ga0373947_0830496
613 Ga0373937_0002331
614 Ga0373937_0087363
615 Ga0373937_1212060
616 Ga0373925_0189658
617 Ga0373925_0266968
618 Ga0373925_0467588
619 Ga0395900_0486849
620 Ga0395900_1583625
621 Ga0395898_0460821
622 Ga0436364_0056456
623 Ga0436364_0403566
624 Ga0436364_0671096
625 Ga0436364_1025202
626 Ga0436364_1301999
627 Ga0395901_1084088
628 Ga0436365_1136890
629 Ga0436365_1551220
630 Ga0436365_1866606
631 Ga0436365_1871597
632 Ga0436360_0341971
633 Ga0436361_0212413
634 Ga0436363_0125554
635 Ga0436363_1030659
636 Ga0436363_1628206
637 Ga0436362_0963920
638 Ga0466965_0923733
639 Ga0466966_0304458
640 Ga0466961_0305786
641 Ga0466963_0120549
642 Ga0466963_0578665
643 Ga0466968_0255053
644 Ga0466968_0554254
645 Ga0466959_0126355
646 Ga0466959_0464278
647 Ga0451576_0289271
648 Ga0466958_0698587
649 Ga0466967_0099434
650 Ga0466967_0356376
651 Ga0466967_0436610
652 Ga0466967_0657240
653 Ga0466967_1027489
654 Ga0495603_0012598
655 Ga0495629_0008031
656 Ga0495629_0117579
657 Ga0495651_0009002
658 Ga0495651_0530012
659 Ga0495653_0083402
660 Ga0495580_0205162
661 Ga0495582_0112096
662 Ga0495582_0168443
663 Ga0495639_0192900
664 Ga0495662_0015820
665 Ga0495664_0688927
666 Ga0495585_0302198
667 Ga0495594_0225125
668 Ga0495608_0725701
669 Ga0495628_0066380
670 Ga0495630_0207017
671 Ga0495630_0610917
672 Ga0495666_0058581
673 Ga0495652_0114605
674 Ga0495652_0613050
675 Ga0495665_0033111
676 Ga0495665_0111213
677 Ga0495665_0135969
678 Ga0495640_0025423
679 Ga0495586_0030614
680 Ga0495586_0327190
681 Ga0495587_0010729
682 Ga0495587_0036873
683 Ga0495645_0101575
684 Ga0495645_0144839
685 Ga0495622_0135250
686 Ga0495667_0069463
687 Ga0495634_0046487
688 Ga0495625_0041436
689 Ga0495625_0382418
690 Ga0495635_0851761
691 Ga0495599_0288467
692 Ga0495623_0023729
693 Ga0495646_0091968
694 Ga0495647_0002656
695 Ga0495658_0022319
696 Ga0495613_0101211
697 Ga0495613_0325798
698 Ga0495600_0036628
699 Ga0495581_0012434
700 Ga0495581_0496901
701 Ga0495604_0000424
702 Ga0495604_0435195
703 Ga0495674_0284404
704 Ga0495674_0545496
705 Ga0495680_0022642
706 Ga0495680_0302306
707 Ga0495684_0005435
708 Ga0495684_0096036
709 Ga0495684_0229759
710 Ga0495602_0005733
711 Ga0495602_0452166
712 Ga0495614_0070394
713 Ga0496100_0262684
714 Ga0496100_0372413
715 Ga0496100_0959531
716 Ga0496102_0209469
717 Ga0496102_1250236
718 Ga0496106_0390295
719 Ga0496107_0350299
720 Ga0496109_0248301
721 Ga0496112_0037608
722 Ga0496112_0070092
723 Ga0496115_0070778
724 Ga0496115_0123116
725 Ga0496115_0133497
726 Ga0496126_0000560
727 nmdc:mga09592_562130_c1
728 nmdc:mga06r32_515747_c1
729 nmdc:mga08y16_326029_c1
730 nmdc:mga08x19_896562_c1
731 Ga0495601_0062233
732 Ga0495612_0214131
733 Ga0495619_0081614
734 Ga0495619_0712899
735 Ga0500641_0176556
736 Ga0500555_057970

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

26

101

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9141 4 107
5dym-assembly1.cif.gz_A-2 crystal structure of a padr family transcription regulator from hypervirulent clostridium difficile r20291 - cdpadr_0991 to 1.89 angstrom resolution 0.9103 13 108
5zqh-assembly1.cif.gz_A-2 crystal structure of streptococcus transcriptional regulator 0.9084 8 107
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9041 7 106
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9033 4 109
ID Description Score Start End Superfamily
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9403 7 100 1.10.10.10
5dymA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9102 13 108 1.10.10.10
5zqhA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9084 8 107 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9041 7 106 1.10.10.10
af_Q9C106_1_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8981 16 83 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7R8GE46-F1-model_v4 deleted 0.988 11 109
AF-A0A2V9ZD40-F1-model_v4 PadR family transcriptional regulator 0.9829 5 87
AF-A0A2V8CZR8-F1-model_v4 PadR family transcriptional regulator 0.98 17 109
AF-A0A2V9FL99-F1-model_v4 PadR family transcriptional regulator 0.9772 1 97
AF-A0A2V8BEN1-F1-model_v4 PadR family transcriptional regulator 0.9725 14 109

Map