F424749

General Info

Members Datasets Scaffolds Average Seq Length
368 258 307 404

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10022011|Ga0307513_100220115
Length 463
Sequence MVVLMVAKPPDSSESGGFFIGDRPAGLQDLAQCDKVKPRVNTRFFHLSLGRAGRLAWQRLHPDDHMTNPISVDQQSRVLLRAVLALGVGGFAIGTGEFVIMGLLPEVARDIDVSIPQAGHVISAYALGVVIGAPLLAVLAAGWRRRTLLIALMAVFSLGNFASALAPGYLALNLLRFATGLPHGTYFGVAALVAAALAPPGRRARAVGMVMLGLTGATLVGVPIAAWLGQLFGWRAAFVFVGLIGLLAIEMIRREVPDLAAPQGASPWRELGALKRKQVWFTLGIAAIGFGGMFSVFSYIKPTLTEVTGLSVGGVPVVLALFGLGMVCGNLVGSRLADKSLMRTIGGVLVWAMLMLTTFTFAAHYLAAAALTVFLIGTTVAIGPALQIRLMDVAGDAQTLAAALNHSAFNMANALGAWLGGVAISAGLGWTSTGIFAWALSSERKDLRGAGPSAAGAVPSRQG

Samples

Sample ID Description Type Environment
1 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221596 Acidovorax sp. Root70 Isolate Unclassified
8 2643221609 Acidovorax sp. Root217 Isolate Unclassified
9 2643221611 Acidovorax sp. Root219 Isolate Unclassified
10 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
11 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
12 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
13 2643221658 Variovorax sp. Root411 Isolate Unclassified
14 2643221683 Variovorax sp. Root473 Isolate Unclassified
15 2643221717 Acidovorax sp. Root267 Isolate Unclassified
16 2643221719 Rhizobium sp. Root274 Isolate Unclassified
17 2738541277 Variovorax sp. GV051 Isolate Unclassified
18 2738541307 Variovorax sp. GV008 Isolate Unclassified
19 2738543012 Acidovorax sp. CF301 Isolate Unclassified
20 2738543013 Variovorax sp. BT01 Isolate Unclassified
21 2738543019 Variovorax sp. GV040 Isolate Unclassified
22 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
23 2816332133 Acidovorax radicis 2721A Isolate Unclassified
24 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
25 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
26 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
27 2842677519 Variovorax sp. R-72495 Isolate Unclassified
28 2842733646 Variovorax sp. R-72446 Isolate Unclassified
29 2842747753 Variovorax sp. R-72060 Isolate Unclassified
30 2862574272 Streptomyces sp. AcE210 Isolate Nodule
31 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
32 2885198086 Variovorax sp. 679 Isolate Unclassified
33 2885211737 Variovorax sp. 553 Isolate Unclassified
34 2899924645 Variovorax sp. 369 Isolate Unclassified
35 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
36 2904456579 Variovorax sp. 2002 Isolate Unclassified
37 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
38 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
39 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
40 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
41 2928037797 Variovorax sp. 1126 Isolate Unclassified
42 2928044640 Variovorax sp. 1128 Isolate Unclassified
43 2928051484 Variovorax sp. 1133 Isolate Unclassified
44 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
45 2928070936 Variovorax gossypii 1167 Isolate Unclassified
46 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
47 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
48 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
49 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
50 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
51 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
52 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
53 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
54 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
55 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
56 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
57 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
58 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
59 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
60 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
61 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
62 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
63 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
64 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
65 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
66 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
67 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
68 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
69 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
70 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
71 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
72 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
73 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
74 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
75 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
76 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
77 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
78 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
79 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
80 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
81 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
82 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
83 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
84 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
85 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
86 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
110 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
118 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
119 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
155 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
156 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
157 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
158 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
159 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
160 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
161 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
166 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
167 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
173 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
174 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
175 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
176 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
177 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
178 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
179 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
180 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
181 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
182 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
183 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
184 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
185 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
186 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
187 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
188 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
189 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
190 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
191 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
192 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
193 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
194 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
195 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
196 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
197 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
198 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
199 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
200 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
201 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
202 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
205 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
206 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
207 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
208 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
211 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
212 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
218 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
219 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
220 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
221 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
226 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
227 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
228 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
229 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
230 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
231 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
232 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
236 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
237 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
238 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
239 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
240 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
241 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
242 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
243 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
244 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
245 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
246 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
247 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
248 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
249 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
250 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
251 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
252 639633007 Azoarcus olearius BH72 Isolate Unclassified
253 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
254 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
255 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
256 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
257 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
258 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.88
Metatranscriptomes 0.54
Isolates 16.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 36.14
Nodule 1.09
Rhizoplane 1.36
Rhizosphere 40.22
Stem 0
Stem Tuber 0
Unclassified 21.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1008042 3300002774 Bacteria 2087
2 JGI25159J45721_1008558 3300002987 Bacteria 2798
3 JGI25159J45721_1008678 3300002987 Bacteria 2768
4 JGI25151J46595_10001423 3300003187 Bacteria 16347
5 JGI25151J46595_10005604 3300003187 Bacteria 6461
6 rootH1_10010022 3300003316 Bacteria 6261
7 Ga0006562J51391_1118015 3300003578 Bacteria 5312
8 Ga0006562J51391_1118017 3300003578 Bacteria 3200
9 Ga0055539_1000174 3300003752 Bacteria 54849
10 Ga0055533_1000011 3300003756 Bacteria 467893
11 Ga0055535_1000302 3300003761 Bacteria 50219
12 Ga0055535_1000760 3300003761 Bacteria 23926
13 Ga0055542_1000127 3300003762 Bacteria 100078
14 Ga0055529_1000306 3300003763 Bacteria 56382
15 Ga0055526_1002580 3300003771 Bacteria 12108
16 Ga0055537_1000209 3300003773 Bacteria 43625
17 Ga0055524_1011676 3300003775 Bacteria 3419
18 Ga0055536_1001474 3300003781 Bacteria 14143
19 Ga0055536_1005808 3300003781 Bacteria 5937
20 Ga0055534_1000204 3300003784 Bacteria 43602
21 Ga0055534_1001025 3300003784 Bacteria 12223
22 Ga0055534_1001621 3300003784 Bacteria 8717
23 Ga0055528_1000531 3300003790 Bacteria 29380
24 Ga0055530_10003395 3300003791 Bacteria 9087
25 Ga0055530_10005355 3300003791 Bacteria 6135
26 Ga0055540_1001184 3300003792 Bacteria 16088
27 Ga0055540_1001797 3300003792 Bacteria 12200
28 Ga0055540_1002027 3300003792 Bacteria 11225
29 Ga0055531_10000578 3300003794 Bacteria 31923
30 Ga0055531_10001763 3300003794 Bacteria 15421
31 Ga0055531_10006619 3300003794 Bacteria 6530
32 Ga0058692_1013800 3300003856 Bacteria 1869
33 Ga0055543_1001214 3300004625 Bacteria 10824
34 Ga0065165_1004677 3300005262 Bacteria 8264
35 Ga0070658_10061359 3300005327 Bacteria 3063
36 Ga0068869_100008855 3300005334 Bacteria 6512
37 Ga0070669_100101515 3300005353 Bacteria 2171
38 Ga0070673_100063733 3300005364 Bacteria 2934
39 Ga0070678_100158561 3300005456 Bacteria 1831
40 Ga0068867_100000385 3300005459 Bacteria 29434
41 Ga0070706_100073842 3300005467 Bacteria 3157
42 Ga0070707_100180356 3300005468 Bacteria 2058
43 Ga0070698_100040147 3300005471 Bacteria 4813
44 Ga0068853_100094249 3300005539 Bacteria 2637
45 Ga0068855_100001326 3300005563 Bacteria 30623
46 Ga0068855_100057428 3300005563 Bacteria 4562
47 Ga0068852_100005511 3300005616 Bacteria 9070
48 Ga0068852_100057039 3300005616 Bacteria 3378
49 Ga0068862_100017882 3300005844 Bacteria 5902
50 Ga0075363_100119741 3300006048 Bacteria 1469
51 Ga0075364_10000177 3300006051 Bacteria 28741
52 Ga0075369_10004942 3300006186 Bacteria 4958
53 Ga0075366_10067254 3300006195 Bacteria 2132
54 Ga0075370_10019555 3300006353 Bacteria 3690
55 Ga0075370_10029870 3300006353 Bacteria 3038
56 Ga0075370_10034348 3300006353 Bacteria 2843
57 Ga0075370_10064352 3300006353 Bacteria 2091
58 Ga0068871_100197706 3300006358 Bacteria 1735
59 Ga0099826_10000909 3300006948 Bacteria 16262
60 Ga0099826_10094188 3300006948 Bacteria 1824
61 Ga0105240_10153943 3300009093 Bacteria 2736
62 Ga0105243_10002463 3300009148 Bacteria 15464
63 Ga0105243_10062269 3300009148 Bacteria 2987
64 Ga0105243_10199096 3300009148 Bacteria 1755
65 Ga0105242_10006283 3300009176 Bacteria 9155
66 Ga0105242_10254457 3300009176 Bacteria 1584
67 Ga0105239_10073311 3300010375 Bacteria 3764
68 Ga0157373_10131422 3300013100 Bacteria 1760
69 Ga0157370_10001210 3300013104 Bacteria 32282
70 Ga0157369_10197925 3300013105 Bacteria 2109
71 Ga0157372_10053992 3300013307 Bacteria 4480
72 Ga0182008_10000692 3300014497 Bacteria 24293
73 Ga0157377_10000223 3300014745 Bacteria 29679
74 Ga0182007_10016155 3300015262 Bacteria 2762
75 Ga0163161_10077400 3300017792 Bacteria 2443
76 Ga0209436_104671 3300025208 Bacteria 3332
77 Ga0209674_100003 3300025226 Bacteria 2196646
78 Ga0209672_102400 3300025228 Bacteria 4643
79 Ga0209147_101037 3300025229 Bacteria 11826
80 Ga0209563_100010 3300025230 Bacteria 1337457
81 Ga0209258_100078 3300025242 Bacteria 263996
82 Ga0209258_100162 3300025242 Bacteria 151725
83 Ga0209677_100083 3300025253 Bacteria 117063
84 Ga0209677_100924 3300025253 Bacteria 14367
85 Ga0209148_1000086 3300025254 Bacteria 263996
86 Ga0209759_1001447 3300025256 Bacteria 13370
87 Ga0209759_1003597 3300025256 Bacteria 6114
88 Ga0209759_1007391 3300025256 Bacteria 3535
89 Ga0209129_1000116 3300025258 Bacteria 140716
90 Ga0209129_1000830 3300025258 Bacteria 19469
91 Ga0209565_1000067 3300025263 Bacteria 171247
92 Ga0209565_1000133 3300025263 Bacteria 104054
93 Ga0209565_1000156 3300025263 Bacteria 91427
94 Ga0209455_1000128 3300025272 Bacteria 162413
95 Ga0209673_1000190 3300025273 Bacteria 123411
96 Ga0209673_1000813 3300025273 Bacteria 41247
97 Ga0209673_1002954 3300025273 Bacteria 10655
98 Ga0209673_1005012 3300025273 Bacteria 6843
99 Ga0209130_1001910 3300025284 Bacteria 11746
100 Ga0209675_1000038 3300025291 Bacteria 250481
101 Ga0209675_1001111 3300025291 Bacteria 16375
102 Ga0209675_1002406 3300025291 Bacteria 9651
103 Ga0209675_1004428 3300025291 Bacteria 6245
104 Ga0209675_1009569 3300025291 Bacteria 3408
105 Ga0209676_1000125 3300025292 Bacteria 191565
106 Ga0209676_1001016 3300025292 Bacteria 32817
107 Ga0209676_1001114 3300025292 Bacteria 29761
108 Ga0209676_1006428 3300025292 Bacteria 5806
109 Ga0209025_1001608 3300025294 Bacteria 28307
110 Ga0209025_1002825 3300025294 Bacteria 17474
111 Ga0209025_1002969 3300025294 Bacteria 16837
112 Ga0209025_1005949 3300025294 Bacteria 9709
113 Ga0209564_1000340 3300025295 Bacteria 89579
114 Ga0209564_1001113 3300025295 Bacteria 31670
115 Ga0209564_1002219 3300025295 Bacteria 16157
116 Ga0209564_1002684 3300025295 Bacteria 13489
117 Ga0209758_1000034 3300025297 Bacteria 467637
118 Ga0209050_1000012 3300025298 Bacteria 813717
119 Ga0209050_1001325 3300025298 Bacteria 27578
120 Ga0209050_1022637 3300025298 Bacteria 2245
121 Ga0209256_1000066 3300025299 Bacteria 247534
122 Ga0209256_1000270 3300025299 Bacteria 90996
123 Ga0209256_1000486 3300025299 Bacteria 58822
124 Ga0207426_1000067 3300025302 Bacteria 342108
125 Ga0207426_1002489 3300025302 Bacteria 11681
126 Ga0209051_1000025 3300025303 Bacteria 415397
127 Ga0209051_1000134 3300025303 Bacteria 138380
128 Ga0209051_1000141 3300025303 Bacteria 135837
129 Ga0209051_1000991 3300025303 Bacteria 27413
130 Ga0209051_1001829 3300025303 Bacteria 16828
131 Ga0209051_1006486 3300025303 Bacteria 6582
132 Ga0209051_1015481 3300025303 Bacteria 3505
133 Ga0209257_1000024 3300025304 Bacteria 726068
134 Ga0209257_1000039 3300025304 Bacteria 591694
135 Ga0209257_1001367 3300025304 Bacteria 29437
136 Ga0209257_1007756 3300025304 Bacteria 6384
137 Ga0207705_10041800 3300025909 Bacteria 3289
138 Ga0207695_10029054 3300025913 Bacteria 6119
139 Ga0207657_10033697 3300025919 Bacteria 4614
140 Ga0207646_10050095 3300025922 Bacteria 3738
141 Ga0207681_10053334 3300025923 Bacteria 2745
142 Ga0207706_10022628 3300025933 Bacteria 5641
143 Ga0207686_10002760 3300025934 Bacteria 9514
144 Ga0207709_10001889 3300025935 Bacteria 13830
145 Ga0207709_10002492 3300025935 Bacteria 11541
146 Ga0207709_10034507 3300025935 Bacteria 2982
147 Ga0207709_10085959 3300025935 Bacteria 2041
148 Ga0207669_10033855 3300025937 Bacteria 2889
149 Ga0207689_10226397 3300025942 Bacteria 1545
150 Ga0207667_10001863 3300025949 Bacteria 26504
151 Ga0207667_10042592 3300025949 Bacteria 4825
152 Ga0207667_10090671 3300025949 Bacteria 3159
153 Ga0207651_10014118 3300025960 Bacteria 4600
154 Ga0207640_10042318 3300025981 Bacteria 2904
155 Ga0207639_10251249 3300026041 Bacteria 1542
156 Ga0207648_10001151 3300026089 Bacteria 29631
157 Ga0207675_100116325 3300026118 Bacteria 2527
158 Ga0207683_10200275 3300026121 Bacteria 1815
159 Ga0207698_10048499 3300026142 Bacteria 3225
160 Ga0209371_1008118 3300027312 Bacteria 3538
161 Ga0268266_10005293 3300028379 Bacteria 12110
162 Ga0268265_10037294 3300028380 Bacteria 3567
163 Ga0307517_10001421 3300028786 Bacteria 40285
164 Ga0307517_10109023 3300028786 Bacteria 2121
165 Ga0307515_10000109 3300028794 Bacteria 195895
166 Ga0307515_10000577 3300028794 Bacteria 86068
167 Ga0307515_10010767 3300028794 Bacteria 17455
168 Ga0307515_10062490 3300028794 Bacteria 5256
169 Ga0268256_1008407 3300030500 Bacteria 3538
170 Ga0307512_10091701 3300030522 Bacteria 2112
171 Ga0316180_1087136 3300030736 Bacteria 1653
172 Ga0316183_1152930 3300030742 Bacteria 2498
173 Ga0316182_1256750 3300030745 Bacteria 4712
174 Ga0316182_1373415 3300030745 Bacteria 2278
175 Ga0265327_10000183 3300031251 Bacteria 133191
176 Ga0307513_10000990 3300031456 Bacteria 41065
177 Ga0307513_10022011 3300031456 Bacteria 7508
178 Ga0307513_10046943 3300031456 Bacteria 4703
179 Ga0307509_10043209 3300031507 Bacteria 4878
180 Ga0307408_100000112 3300031548 Bacteria 89783
181 Ga0307508_10000101 3300031616 Bacteria 100858
182 Ga0307508_10004079 3300031616 Bacteria 14428
183 Ga0307508_10024713 3300031616 Bacteria 5452
184 Ga0307508_10103016 3300031616 Bacteria 2450
185 Ga0307514_10002080 3300031649 Bacteria 21613
186 Ga0307514_10004622 3300031649 Bacteria 12619
187 Ga0307514_10008985 3300031649 Bacteria 8442
188 Ga0307514_10020302 3300031649 Bacteria 5423
189 Ga0307516_10004060 3300031730 Bacteria 18325
190 Ga0307516_10011646 3300031730 Bacteria 9543
191 Ga0307406_10009690 3300031901 Bacteria 5416
192 Ga0307412_10040694 3300031911 Bacteria 3008
193 Ga0307416_100104827 3300032002 Bacteria 2473
194 Ga0307414_10155313 3300032004 Bacteria 1810
195 Ga0307507_10063204 3300033179 Bacteria 3430
196 Ga0439447_000251 3300041407 Bacteria 18824
197 Ga0439466_0011031 3300041411 Bacteria 3350
198 Ga0439449_0001857 3300042007 Bacteria 8312
199 Ga0439462_0001180 3300042015 Bacteria 5707
200 Ga0439462_0003004 3300042015 Bacteria 4004
201 Ga0450920_005731 3300042122 Bacteria 2216
202 Ga0450923_003272 3300042125 Bacteria 2426
203 Ga0450906_009526 3300042145 Bacteria 1850
204 Ga0450910_004609 3300042147 Bacteria 1864
205 Ga0439446_0005091 3300042156 Bacteria 3366
206 Ga0450908_006398 3300042184 Bacteria 2239
207 Ga0439434_0012909 3300042435 Bacteria 2476
208 Ga0439434_0020075 3300042435 Bacteria 2005
209 Ga0450918_000008 3300042531 Bacteria 41788
210 Ga0495627_027315 3300046453 Bacteria 1832
211 Ga0495590_0055301 3300046457 Bacteria 1387
212 Ga0495650_0000008 3300046471 Bacteria 688246
213 Ga0495584_0012519 3300046491 Bacteria 4330
214 Ga0495607_0004297 3300046501 Bacteria 10517
215 Ga0495606_0000289 3300046507 Bacteria 87270
216 Ga0495606_0010682 3300046507 Bacteria 7584
217 Ga0495610_0025116 3300046512 Bacteria 3205
218 Ga0495610_0047192 3300046512 Bacteria 2120
219 Ga0495610_0062998 3300046512 Bacteria 1757
220 Ga0495616_0002971 3300046513 Bacteria 11009
221 Ga0495620_0043552 3300046515 Bacteria 1955
222 Ga0495620_0054822 3300046515 Bacteria 1682
223 Ga0495631_0002617 3300046518 Bacteria 10048
224 Ga0495631_0032460 3300046518 Bacteria 2355
225 Ga0495632_0010999 3300046519 Bacteria 5307
226 Ga0495637_0012794 3300046520 Bacteria 4004
227 Ga0495643_0027471 3300046522 Bacteria 3197
228 Ga0495648_0021195 3300046524 Bacteria 4508
229 Ga0495642_0023790 3300046528 Bacteria 2420
230 Ga0495654_0000091 3300046530 Bacteria 101543
231 Ga0495611_0046344 3300046648 Bacteria 1949
232 Ga0495625_0000317 3300046660 Bacteria 73568
233 Ga0495625_0002069 3300046660 Bacteria 22491
234 Ga0495625_0009203 3300046660 Bacteria 8297
235 Ga0495625_0012039 3300046660 Bacteria 7020
236 Ga0495625_0084820 3300046660 Bacteria 2200
237 Ga0495669_0012275 3300046684 Bacteria 3644
238 Ga0495671_0010310 3300046692 Bacteria 5187
239 Ga0495649_0001316 3300046694 Bacteria 18941
240 Ga0495649_0002777 3300046694 Bacteria 12183
241 Ga0495589_0010069 3300046794 Bacteria 4911
242 Ga0495589_0027193 3300046794 Bacteria 2893
243 Ga0495660_0000247 3300046810 Bacteria 52182
244 Ga0495660_0005155 3300046810 Bacteria 7852
245 Ga0495672_0000003 3300047320 Bacteria 728845
246 Ga0495676_0102751 3300047321 Bacteria 2111
247 Ga0495683_0033243 3300047323 Bacteria 2625
248 Ga0495687_014104 3300047443 Bacteria 4131
249 Ga0495673_0000011 3300047469 Bacteria 674140
250 Ga0495593_0037869 3300047673 Bacteria 2606
251 Ga0495614_0032213 3300048089 Bacteria 2256
252 Ga0496101_0214119 3300048904 Bacteria 1493
253 Ga0496102_0008802 3300048905 Bacteria 8659
254 Ga0496116_0016934 3300048919 Bacteria 5682
255 Ga0496117_0074558 3300048920 Bacteria 2258
256 Ga0496121_0036362 3300048924 Bacteria 4389
257 Ga0496122_0001678 3300048925 Bacteria 34323
258 Ga0496122_0105386 3300048925 Bacteria 1870
259 Ga0496123_0000102 3300048926 Bacteria 169327
260 Ga0496123_0036487 3300048926 Bacteria 3486
261 Ga0496123_0112988 3300048926 Bacteria 1547
262 Ga0496124_0192980 3300048927 Bacteria 1556
263 Ga0496125_0008364 3300048928 Bacteria 10849
264 Ga0496125_0022586 3300048928 Bacteria 5836
265 Ga0496125_0049552 3300048928 Bacteria 3489
266 Ga0496126_0152306 3300048929 Bacteria 1981
267 Ga0495678_000198 3300049459 Bacteria 70659
268 Ga0495682_0000006 3300049460 Bacteria 316373
269 Ga0495682_0034544 3300049460 Bacteria 1864
270 Ga0501262_000211 3300049759 Bacteria 7263
271 Ga0501266_000615 3300049763 Bacteria 4620
272 nmdc:mga03683_40546_c1 3300050489 Bacteria 1910
273 nmdc:mga00v17_201_c1 3300050491 Bacteria 36027
274 nmdc:mga00v17_23749_c1 3300050491 Bacteria 3550
275 nmdc:mga0yw44_23453_c1 3300050492 Bacteria 3477
276 nmdc:mga0k408_70433_c1 3300050493 Bacteria 2040
277 nmdc:mga0k408_92588_c1 3300050493 Bacteria 1777
278 nmdc:mga06z11_15875_c1 3300050494 Bacteria 3374
279 nmdc:mga07m45_14102_c1 3300050496 Bacteria 4252
280 nmdc:mga07m45_29568_c1 3300050496 Bacteria 3031
281 nmdc:mga07m45_40281_c1 3300050496 Bacteria 2614
282 nmdc:mga07m45_7282_c1 3300050496 Bacteria 5645
283 Ga0500610_0001020 3300053079 Bacteria 9139
284 Ga0500610_0001866 3300053079 Bacteria 7465
285 Ga0500610_0073633 3300053079 Bacteria 1781
286 Ga0500635_0000003 3300053080 Bacteria 216927
287 Ga0500643_007111 3300053087 Bacteria 4578
288 Ga0500651_0000931 3300053093 Bacteria 14354
289 Ga0500651_0001691 3300053093 Bacteria 11269
290 Ga0500651_0054502 3300053093 Bacteria 2506
291 Ga0500571_003382 3300053110 Bacteria 8175
292 Ga0500593_005895 3300053117 Bacteria 4867
293 Ga0500607_003289 3300053121 Bacteria 11897
294 Ga0500608_000850 3300053122 Bacteria 11059
295 Ga0500608_065144 3300053122 Bacteria 1738
296 Ga0500621_000004 3300053126 Bacteria 485792
297 Ga0500655_008669 3300053133 Bacteria 1830
298 Ga0500658_0000878 3300053134 Bacteria 12336
299 Ga0500658_0000902 3300053134 Bacteria 12176
300 Ga0500658_0007490 3300053134 Bacteria 4035
301 Ga0500559_0003185 3300053136 Bacteria 8156
302 Ga0500559_0003951 3300053136 Bacteria 7148
303 Ga0500568_0000710 3300053139 Bacteria 23894
304 Ga0500616_0013583 3300053153 Bacteria 4720
305 Ga0500619_000246 3300053154 Bacteria 11678
306 Ga0500627_0002811 3300053158 Bacteria 5244
307 Ga0500638_065699 3300053162 Bacteria 1739

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046471 Ga0495650_0000008 Ga0495650_0000008_358479_359693 350
2 3300046491 Ga0495584_0012519 Ga0495584_0012519_2679_3893 350
3 3300046501 Ga0495607_0004297 Ga0495607_0004297_7358_8572 350
4 3300046507 Ga0495606_0000289 Ga0495606_0000289_69865_71079 350
5 3300046518 Ga0495631_0032460 Ga0495631_0032460_637_1851 350
6 3300046524 Ga0495648_0021195 Ga0495648_0021195_78_1292 350
7 3300046530 Ga0495654_0000091 Ga0495654_0000091_42283_43497 350
8 3300046648 Ga0495611_0046344 Ga0495611_0046344_613_1827 350
9 3300046794 Ga0495589_0010069 Ga0495589_0010069_3563_4777 350
10 3300046810 Ga0495660_0000247 Ga0495660_0000247_15314_16528 350
11 3300047320 Ga0495672_0000003 Ga0495672_0000003_381853_383067 350
12 3300047323 Ga0495683_0033243 Ga0495683_0033243_45_1259 350
13 3300047469 Ga0495673_0000011 Ga0495673_0000011_337554_338768 350
14 3300049459 Ga0495678_000198 Ga0495678_000198_4681_5895 350
15 3300049460 Ga0495682_0000006 Ga0495682_0000006_103985_105199 350
16 3300053126 Ga0500621_000004 Ga0500621_000004_318309_319523 350
17 3300048924 Ga0496121_0036362 Ga0496121_0036362_2738_3988 357
18 3300048928 Ga0496125_0008364 Ga0496125_0008364_6521_7771 357
19 3300005467 Ga0070706_100073842 Ga0070706_1000738422 362
20 3300025922 Ga0207646_10050095 Ga0207646_100500952 362
21 3300042015 Ga0439462_0001180 Ga0439462_0001180_3760_4968 362
22 3300047443 Ga0495687_014104 Ga0495687_014104_2538_3725 362
23 3300053134 Ga0500658_0007490 Ga0500658_0007490_715_1902 362
24 3300046457 Ga0495590_0055301 Ga0495590_0055301_129_1316 364
25 3300046512 Ga0495610_0047192 Ga0495610_0047192_115_1302 364
26 3300046519 Ga0495632_0010999 Ga0495632_0010999_927_2114 364
27 3300046694 Ga0495649_0001316 Ga0495649_0001316_4563_5750 364
28 3300046810 Ga0495660_0005155 Ga0495660_0005155_3716_4903 364
29 3300049460 Ga0495682_0034544 Ga0495682_0034544_378_1565 364
30 3300031548 Ga0307408_100000112 Ga0307408_1000001125 365
31 3300031901 Ga0307406_10009690 Ga0307406_100096906 365
32 3300028379 Ga0268266_10005293 Ga0268266_100052932 371
33 iso_pu_bacteria 2791355406 2793985137 371
34 iso_pu_bacteria 2997600082 2997607359 371
35 iso_pu_bacteria 8047893842 8047900919 371
36 iso_pu_bacteria 8048356638 8048357982 371
37 iso_pu_bacteria 8048369669 8048377861 371
38 iso_pu_bacteria 8048379754 8048386959 371
39 3300048928 Ga0496125_0022586 Ga0496125_0022586_3128_4336 372
40 3300048929 Ga0496126_0152306 Ga0496126_0152306_40_1248 372
41 iso_pu_bacteria 2862574272 2862578840 372
42 iso_pu_bacteria 639633007 639785693 372
43 3300053134 Ga0500658_0000878 Ga0500658_0000878_9826_10983 373
44 3300053134 Ga0500658_0000902 Ga0500658_0000902_8119_9276 373
45 iso_pu_bacteria 2818991463 2819697301 373
46 3300031616 Ga0307508_10004079 Ga0307508_100040795 374
47 3300005459 Ga0068867_100000385 Ga0068867_10000038522 376
48 3300009148 Ga0105243_10002463 Ga0105243_100024639 376
49 3300014745 Ga0157377_10000223 Ga0157377_1000022311 376
50 3300025935 Ga0207709_10002492 Ga0207709_100024929 376
51 3300026089 Ga0207648_10001151 Ga0207648_1000115122 376
52 3300026121 Ga0207683_10200275 Ga0207683_102002752 376
53 3300005468 Ga0070707_100180356 Ga0070707_1001803562 379
54 3300005471 Ga0070698_100040147 Ga0070698_1000401472 379
55 3300046660 Ga0495625_0009203 Ga0495625_0009203_4938_6182 379
56 3300050496 nmdc:mga07m45_29568_c1 nmdc:mga07m45_29568_c1_1075_2319 379
57 3300028786 Ga0307517_10001421 Ga0307517_1000142121 380
58 3300003784 Ga0055534_1001025 Ga0055534_10010254 381
59 3300003856 Ga0058692_1013800 Ga0058692_10138002 381
60 3300013307 Ga0157372_10053992 Ga0157372_100539921 381
61 3300025291 Ga0209675_1001111 Ga0209675_10011115 381
62 3300025292 Ga0209676_1006428 Ga0209676_10064283 381
63 3300025298 Ga0209050_1022637 Ga0209050_10226372 381
64 3300025303 Ga0209051_1006486 Ga0209051_10064862 381
65 3300027312 Ga0209371_1008118 Ga0209371_10081182 381
66 3300030500 Ga0268256_1008407 Ga0268256_10084073 381
67 3300031616 Ga0307508_10103016 Ga0307508_101030162 381
68 3300041407 Ga0439447_000251 Ga0439447_000251_16869_18086 381
69 3300048904 Ga0496101_0214119 Ga0496101_0214119_140_1471 381
70 3300005616 Ga0068852_100005511 Ga0068852_1000055116 382
71 3300031616 Ga0307508_10024713 Ga0307508_100247136 382
72 iso_pu_bacteria 2885192300 2885193410 382
73 3300048905 Ga0496102_0008802 Ga0496102_0008802_3768_4988 383
74 3300050493 nmdc:mga0k408_70433_c1 nmdc:mga0k408_70433_c1_365_1573 383
75 iso_pu_bacteria 2928115317 2928115712 383
76 3300042531 Ga0450918_000008 Ga0450918_000008_37427_38662 384
77 3300006186 Ga0075369_10004942 Ga0075369_100049423 385
78 3300006353 Ga0075370_10029870 Ga0075370_100298702 385
79 3300050489 nmdc:mga03683_40546_c1 nmdc:mga03683_40546_c1_595_1839 385
80 3300050496 nmdc:mga07m45_7282_c1 nmdc:mga07m45_7282_c1_4242_5486 385
81 iso_pu_bacteria 2510461069 2510840993 386
82 iso_pu_bacteria 2643221653 2644296937 386
83 iso_pu_bacteria 2643221719 2644655191 386
84 iso_pu_bacteria 8005246636 8005246672 386
85 iso_pu_bacteria 8046767195 8046767576 386
86 3300006051 Ga0075364_10000177 Ga0075364_1000017726 387
87 3300042007 Ga0439449_0001857 Ga0439449_0001857_989_2203 387
88 3300042015 Ga0439462_0003004 Ga0439462_0003004_2211_3425 387
89 3300042125 Ga0450923_003272 Ga0450923_003272_883_2097 387
90 3300042156 Ga0439446_0005091 Ga0439446_0005091_1240_2454 387
91 3300042435 Ga0439434_0012909 Ga0439434_0012909_544_1758 387
92 3300050491 nmdc:mga00v17_201_c1 nmdc:mga00v17_201_c1_10533_11756 387
93 iso_pu_bacteria 2547132374 2548498896 387
94 iso_pu_bacteria 2643221717 2644648356 387
95 3300003794 Ga0055531_10000578 Ga0055531_1000057827 388
96 3300005563 Ga0068855_100057428 Ga0068855_1000574283 388
97 3300009176 Ga0105242_10254457 Ga0105242_102544572 388
98 3300025303 Ga0209051_1000025 Ga0209051_1000025385 388
99 3300025304 Ga0209257_1000039 Ga0209257_1000039223 388
100 3300025942 Ga0207689_10226397 Ga0207689_102263972 388
101 3300025949 Ga0207667_10042592 Ga0207667_100425923 388
102 3300026142 Ga0207698_10048499 Ga0207698_100484993 388
103 3300053093 Ga0500651_0000931 Ga0500651_0000931_7407_8618 388
104 iso_pu_bacteria 2643221596 2643991757 388
105 iso_pu_bacteria 2974320154 2974320195 388
106 3300003771 Ga0055526_1002580 Ga0055526_10025804 389
107 3300003775 Ga0055524_1011676 Ga0055524_10116763 389
108 3300003784 Ga0055534_1001621 Ga0055534_10016218 389
109 3300005563 Ga0068855_100001326 Ga0068855_10000132623 389
110 3300009176 Ga0105242_10006283 Ga0105242_100062834 389
111 3300025263 Ga0209565_1000156 Ga0209565_100015674 389
112 3300025294 Ga0209025_1005949 Ga0209025_10059496 389
113 3300025295 Ga0209564_1000340 Ga0209564_100034070 389
114 3300025295 Ga0209564_1001113 Ga0209564_100111313 389
115 3300025299 Ga0209256_1000486 Ga0209256_10004869 389
116 3300025934 Ga0207686_10002760 Ga0207686_100027603 389
117 3300025949 Ga0207667_10001863 Ga0207667_1000186322 389
118 3300031456 Ga0307513_10000990 Ga0307513_1000099022 389
119 3300031649 Ga0307514_10004622 Ga0307514_100046226 389
120 iso_pu_bacteria 2643221609 2644059014 389
121 iso_pu_bacteria 2643221611 2644071237 389
122 iso_pu_bacteria 2738543012 2739246263 389
123 iso_pu_bacteria 2816332133 2816471354 389
124 iso_pu_bacteria 2989776772 2989778083 389
125 3300025937 Ga0207669_10033855 Ga0207669_100338551 390
126 3300028794 Ga0307515_10000577 Ga0307515_1000057727 390
127 iso_pu_bacteria 2643221644 2644246315 390
128 iso_pu_bacteria 2904479285 2904480521 390
129 iso_pu_bacteria 2919704043 2919707012 390
130 iso_pu_bacteria 2842747753 2842748763 391
131 3300028794 Ga0307515_10010767 Ga0307515_1001076710 392
132 3300031251 Ga0265327_10000183 Ga0265327_10000183109 392
133 3300031507 Ga0307509_10043209 Ga0307509_100432094 392
134 3300031616 Ga0307508_10000101 Ga0307508_1000010191 392
135 3300031649 Ga0307514_10008985 Ga0307514_100089853 392
136 3300033179 Ga0307507_10063204 Ga0307507_100632042 392
137 iso_pu_bacteria 2585428062 2587759886 392
138 3300028794 Ga0307515_10000109 Ga0307515_1000010921 393
139 3300053154 Ga0500619_000246 Ga0500619_000246_3077_4300 393
140 iso_pu_bacteria 2842733646 2842736266 393
141 3300003316 rootH1_10010022 rootH1_100100225 395
142 3300003752 Ga0055539_1000174 Ga0055539_100017443 395
143 3300003756 Ga0055533_1000011 Ga0055533_1000011190 395
144 3300003761 Ga0055535_1000302 Ga0055535_100030235 395
145 3300003763 Ga0055529_1000306 Ga0055529_100030631 395
146 3300005327 Ga0070658_10061359 Ga0070658_100613592 395
147 3300005334 Ga0068869_100008855 Ga0068869_1000088552 395
148 3300005353 Ga0070669_100101515 Ga0070669_1001015152 395
149 3300005364 Ga0070673_100063733 Ga0070673_1000637332 395
150 3300006353 Ga0075370_10064352 Ga0075370_100643522 395
151 3300025226 Ga0209674_100003 Ga0209674_100003489 395
152 3300025230 Ga0209563_100010 Ga0209563_100010219 395
153 3300025242 Ga0209258_100162 Ga0209258_10016219 395
154 3300025253 Ga0209677_100083 Ga0209677_10008316 395
155 3300025256 Ga0209759_1001447 Ga0209759_10014477 395
156 3300025256 Ga0209759_1007391 Ga0209759_10073912 395
157 3300025272 Ga0209455_1000128 Ga0209455_1000128129 395
158 3300025909 Ga0207705_10041800 Ga0207705_100418002 395
159 3300025913 Ga0207695_10029054 Ga0207695_100290542 395
160 3300025919 Ga0207657_10033697 Ga0207657_100336972 395
161 3300025923 Ga0207681_10053334 Ga0207681_100533343 395
162 3300025949 Ga0207667_10090671 Ga0207667_100906713 395
163 3300025960 Ga0207651_10014118 Ga0207651_100141183 395
164 3300026118 Ga0207675_100116325 Ga0207675_1001163251 395
165 3300028794 Ga0307515_10062490 Ga0307515_100624902 395
166 3300031456 Ga0307513_10046943 Ga0307513_100469432 395
167 3300031730 Ga0307516_10004060 Ga0307516_100040605 395
168 3300031730 Ga0307516_10011646 Ga0307516_100116462 395
169 3300046507 Ga0495606_0010682 Ga0495606_0010682_274_1626 395
170 3300046512 Ga0495610_0025116 Ga0495610_0025116_925_2160 395
171 3300046522 Ga0495643_0027471 Ga0495643_0027471_186_1421 395
172 3300046660 Ga0495625_0002069 Ga0495625_0002069_16582_17934 395
173 3300046660 Ga0495625_0012039 Ga0495625_0012039_4912_6147 395
174 3300046684 Ga0495669_0012275 Ga0495669_0012275_2254_3606 395
175 3300046694 Ga0495649_0002777 Ga0495649_0002777_8751_10103 395
176 3300046794 Ga0495589_0027193 Ga0495589_0027193_1387_2739 395
177 3300048925 Ga0496122_0001678 Ga0496122_0001678_1037_2266 395
178 3300048926 Ga0496123_0000102 Ga0496123_0000102_1037_2266 395
179 3300048927 Ga0496124_0192980 Ga0496124_0192980_261_1490 395
180 3300050493 nmdc:mga0k408_92588_c1 nmdc:mga0k408_92588_c1_324_1559 395
181 3300053093 Ga0500651_0054502 Ga0500651_0054502_152_1504 395
182 iso_pu_bacteria 2738543013 2739248906 395
183 3300009148 Ga0105243_10062269 Ga0105243_100622693 396
184 3300025253 Ga0209677_100924 Ga0209677_1009245 396
185 3300025256 Ga0209759_1003597 Ga0209759_10035974 396
186 3300028786 Ga0307517_10109023 Ga0307517_101090232 396
187 3300050494 nmdc:mga06z11_15875_c1 nmdc:mga06z11_15875_c1_2055_3296 396
188 3300053080 Ga0500635_0000003 Ga0500635_0000003_55197_56435 396
189 3300053136 Ga0500559_0003951 Ga0500559_0003951_5240_6478 396
190 iso_pu_bacteria 2904541872 2904547384 396
191 iso_pu_bacteria 2929160207 2929165115 396
192 3300005456 Ga0070678_100158561 Ga0070678_1001585612 397
193 3300013104 Ga0157370_10001210 Ga0157370_1000121026 397
194 3300032002 Ga0307416_100104827 Ga0307416_1001048273 397
195 3300046528 Ga0495642_0023790 Ga0495642_0023790_1020_2288 397
196 3300049759 Ga0501262_000211 Ga0501262_000211_1375_2616 397
197 iso_pu_bacteria 2643221628 2644161970 397
198 iso_pu_bacteria 2643221683 2644467249 397
199 iso_pu_bacteria 2945984333 2945987688 397
200 3300006353 Ga0075370_10019555 Ga0075370_100195551 398
201 iso_pu_bacteria 2643221658 2644325368 398
202 iso_pu_bacteria 2738541277 2738722020 398
203 iso_pu_bacteria 2738543019 2739282384 398
204 iso_pu_bacteria 2945972063 2945975859 398
205 iso_pu_bacteria 2954767861 2954768704 398
206 3300031911 Ga0307412_10040694 Ga0307412_100406943 399
207 3300053121 Ga0500607_003289 Ga0500607_003289_9230_10495 399
208 iso_pu_bacteria 2842677519 2842677671 399
209 iso_pu_bacteria 2904449895 2904451952 399
210 iso_pu_bacteria 2904456579 2904458902 399
211 iso_pu_bacteria 2919462493 2919467065 399
212 iso_pu_bacteria 2928084124 2928087805 399
213 3300003187 JGI25151J46595_10005604 JGI25151J46595_100056044 400
214 3300003773 Ga0055537_1000209 Ga0055537_10002096 400
215 3300003784 Ga0055534_1000204 Ga0055534_10002046 400
216 3300003790 Ga0055528_1000531 Ga0055528_100053111 400
217 3300006948 Ga0099826_10000909 Ga0099826_100009093 400
218 3300025263 Ga0209565_1000067 Ga0209565_100006743 400
219 3300025273 Ga0209673_1000813 Ga0209673_100081343 400
220 3300025291 Ga0209675_1000038 Ga0209675_1000038201 400
221 3300025294 Ga0209025_1001608 Ga0209025_10016089 400
222 iso_pu_bacteria 2599185226 2599674774 400
223 iso_pu_bacteria 2599185227 2599680731 400
224 iso_pu_bacteria 2599185229 2599692746 400
225 iso_pu_bacteria 2738541307 2738882839 400
226 iso_pu_bacteria 2831265667 2831271948 400
227 iso_pu_bacteria 2838054893 2838059789 400
228 iso_pu_bacteria 2885198086 2885198567 400
229 iso_pu_bacteria 2885211737 2885212053 400
230 iso_pu_bacteria 2899924645 2899928568 400
231 iso_pu_bacteria 2928037797 2928041495 400
232 iso_pu_bacteria 2928044640 2928048337 400
233 iso_pu_bacteria 2928051484 2928056176 400
234 iso_pu_bacteria 2928064002 2928066342 400
235 iso_pu_bacteria 2928070936 2928076000 400
236 3300003781 Ga0055536_1001474 Ga0055536_10014749 401
237 3300003792 Ga0055540_1002027 Ga0055540_10020279 401
238 3300005844 Ga0068862_100017882 Ga0068862_1000178824 401
239 3300006948 Ga0099826_10094188 Ga0099826_100941881 401
240 3300014497 Ga0182008_10000692 Ga0182008_1000069210 401
241 3300025292 Ga0209676_1001016 Ga0209676_100101611 401
242 3300025303 Ga0209051_1000141 Ga0209051_1000141111 401
243 3300025304 Ga0209257_1007756 Ga0209257_10077562 401
244 3300025935 Ga0207709_10001889 Ga0207709_100018895 401
245 3300028380 Ga0268265_10037294 Ga0268265_100372943 401
246 3300030522 Ga0307512_10091701 Ga0307512_100917012 401
247 3300041411 Ga0439466_0011031 Ga0439466_0011031_1813_3069 401
248 3300042122 Ga0450920_005731 Ga0450920_005731_699_1955 401
249 3300042145 Ga0450906_009526 Ga0450906_009526_550_1806 401
250 3300042147 Ga0450910_004609 Ga0450910_004609_382_1638 401
251 3300042184 Ga0450908_006398 Ga0450908_006398_280_1536 401
252 3300042435 Ga0439434_0020075 Ga0439434_0020075_480_1736 401
253 3300046453 Ga0495627_027315 Ga0495627_027315_356_1621 401
254 3300046515 Ga0495620_0054822 Ga0495620_0054822_50_1315 401
255 3300046520 Ga0495637_0012794 Ga0495637_0012794_1370_2635 401
256 3300046660 Ga0495625_0000317 Ga0495625_0000317_5637_6893 401
257 3300046660 Ga0495625_0084820 Ga0495625_0084820_99_1364 401
258 3300046692 Ga0495671_0010310 Ga0495671_0010310_1029_2294 401
259 3300049763 Ga0501266_000615 Ga0501266_000615_439_1803 401
260 3300050491 nmdc:mga00v17_23749_c1 nmdc:mga00v17_23749_c1_167_1423 401
261 3300050492 nmdc:mga0yw44_23453_c1 nmdc:mga0yw44_23453_c1_354_1610 401
262 3300053079 Ga0500610_0001020 Ga0500610_0001020_5311_6576 401
263 3300053079 Ga0500610_0001866 Ga0500610_0001866_2805_4070 401
264 3300053117 Ga0500593_005895 Ga0500593_005895_672_1937 401
265 3300053136 Ga0500559_0003185 Ga0500559_0003185_6631_7884 401
266 3300053158 Ga0500627_0002811 Ga0500627_0002811_1028_2293 401
267 3300003187 JGI25151J46595_10001423 JGI25151J46595_1000142310 402
268 3300003578 Ga0006562J51391_1118015 Ga0006562J51391_11180152 402
269 3300003578 Ga0006562J51391_1118017 Ga0006562J51391_11180174 402
270 3300006048 Ga0075363_100119741 Ga0075363_1001197411 402
271 3300006195 Ga0075366_10067254 Ga0075366_100672541 402
272 3300006353 Ga0075370_10034348 Ga0075370_100343483 402
273 3300013100 Ga0157373_10131422 Ga0157373_101314222 402
274 3300025258 Ga0209129_1000830 Ga0209129_10008306 402
275 3300025273 Ga0209673_1005012 Ga0209673_10050125 402
276 3300025294 Ga0209025_1002969 Ga0209025_10029694 402
277 3300025935 Ga0207709_10034507 Ga0207709_100345073 402
278 3300030745 Ga0316182_1256750 Ga0316182_12567501 402
279 3300031649 Ga0307514_10020302 Ga0307514_100203024 402
280 3300032004 Ga0307414_10155313 Ga0307414_101553132 402
281 3300050496 nmdc:mga07m45_14102_c1 nmdc:mga07m45_14102_c1_1997_3256 402
282 3300053122 Ga0500608_000850 Ga0500608_000850_1587_2846 402
283 3300002987 JGI25159J45721_1008558 JGI25159J45721_10085583 403
284 3300003792 Ga0055540_1001184 Ga0055540_10011845 403
285 3300005616 Ga0068852_100057039 Ga0068852_1000570392 403
286 3300006358 Ga0068871_100197706 Ga0068871_1001977061 403
287 3300009148 Ga0105243_10199096 Ga0105243_101990961 403
288 3300015262 Ga0182007_10016155 Ga0182007_100161553 403
289 3300017792 Ga0163161_10077400 Ga0163161_100774003 403
290 3300025208 Ga0209436_104671 Ga0209436_1046713 403
291 3300025273 Ga0209673_1000190 Ga0209673_1000190114 403
292 3300025291 Ga0209675_1004428 Ga0209675_10044284 403
293 3300025291 Ga0209675_1009569 Ga0209675_10095692 403
294 3300025295 Ga0209564_1002684 Ga0209564_10026846 403
295 3300025299 Ga0209256_1000270 Ga0209256_10002706 403
296 3300025302 Ga0207426_1002489 Ga0207426_10024896 403
297 3300025303 Ga0209051_1000991 Ga0209051_100099124 403
298 3300025933 Ga0207706_10022628 Ga0207706_100226285 403
299 3300025935 Ga0207709_10085959 Ga0207709_100859592 403
300 3300025981 Ga0207640_10042318 Ga0207640_100423182 403
301 3300030736 Ga0316180_1087136 Ga0316180_10871362 403
302 3300030742 Ga0316183_1152930 Ga0316183_11529302 403
303 3300030745 Ga0316182_1373415 Ga0316182_13734152 403
304 3300046512 Ga0495610_0062998 Ga0495610_0062998_32_1279 403
305 3300046513 Ga0495616_0002971 Ga0495616_0002971_446_1693 403
306 3300046515 Ga0495620_0043552 Ga0495620_0043552_398_1645 403
307 3300046518 Ga0495631_0002617 Ga0495631_0002617_905_2152 403
308 3300047321 Ga0495676_0102751 Ga0495676_0102751_710_1957 403
309 3300047673 Ga0495593_0037869 Ga0495593_0037869_462_1709 403
310 3300048089 Ga0495614_0032213 Ga0495614_0032213_856_2103 403
311 3300048919 Ga0496116_0016934 Ga0496116_0016934_3989_5239 403
312 3300048920 Ga0496117_0074558 Ga0496117_0074558_743_1993 403
313 3300048926 Ga0496123_0112988 Ga0496123_0112988_199_1446 403
314 3300048928 Ga0496125_0049552 Ga0496125_0049552_1803_3053 403
315 3300050496 nmdc:mga07m45_40281_c1 nmdc:mga07m45_40281_c1_562_1812 403
316 3300053079 Ga0500610_0073633 Ga0500610_0073633_340_1602 403
317 3300053087 Ga0500643_007111 Ga0500643_007111_3009_4256 403
318 3300053093 Ga0500651_0001691 Ga0500651_0001691_5393_6640 403
319 3300053110 Ga0500571_003382 Ga0500571_003382_1483_2730 403
320 3300053122 Ga0500608_065144 Ga0500608_065144_260_1507 403
321 3300053133 Ga0500655_008669 Ga0500655_008669_211_1458 403
322 3300053139 Ga0500568_0000710 Ga0500568_0000710_21520_22767 403
323 3300053153 Ga0500616_0013583 Ga0500616_0013583_1406_2653 403
324 3300053162 Ga0500638_065699 Ga0500638_065699_335_1582 403
325 3300002774 JGI25150J39212_1008042 JGI25150J39212_10080422 404
326 3300002987 JGI25159J45721_1008678 JGI25159J45721_10086783 404
327 3300003761 Ga0055535_1000760 Ga0055535_10007606 404
328 3300003762 Ga0055542_1000127 Ga0055542_10001276 404
329 3300003781 Ga0055536_1005808 Ga0055536_10058086 404
330 3300003791 Ga0055530_10003395 Ga0055530_100033956 404
331 3300003791 Ga0055530_10005355 Ga0055530_100053552 404
332 3300003792 Ga0055540_1001797 Ga0055540_10017977 404
333 3300003794 Ga0055531_10001763 Ga0055531_100017638 404
334 3300003794 Ga0055531_10006619 Ga0055531_100066192 404
335 3300004625 Ga0055543_1001214 Ga0055543_10012146 404
336 3300005262 Ga0065165_1004677 Ga0065165_10046775 404
337 3300005539 Ga0068853_100094249 Ga0068853_1000942492 404
338 3300009093 Ga0105240_10153943 Ga0105240_101539432 404
339 3300010375 Ga0105239_10073311 Ga0105239_100733112 404
340 3300013105 Ga0157369_10197925 Ga0157369_101979251 404
341 3300025228 Ga0209672_102400 Ga0209672_1024005 404
342 3300025229 Ga0209147_101037 Ga0209147_1010374 404
343 3300025242 Ga0209258_100078 Ga0209258_100078152 404
344 3300025254 Ga0209148_1000086 Ga0209148_1000086152 404
345 3300025258 Ga0209129_1000116 Ga0209129_100011612 404
346 3300025263 Ga0209565_1000133 Ga0209565_10001335 404
347 3300025273 Ga0209673_1002954 Ga0209673_10029547 404
348 3300025284 Ga0209130_1001910 Ga0209130_10019107 404
349 3300025291 Ga0209675_1002406 Ga0209675_10024069 404
350 3300025292 Ga0209676_1000125 Ga0209676_1000125151 404
351 3300025292 Ga0209676_1001114 Ga0209676_10011149 404
352 3300025294 Ga0209025_1002825 Ga0209025_100282510 404
353 3300025295 Ga0209564_1002219 Ga0209564_10022196 404
354 3300025297 Ga0209758_1000034 Ga0209758_1000034128 404
355 3300025298 Ga0209050_1000012 Ga0209050_1000012633 404
356 3300025298 Ga0209050_1001325 Ga0209050_100132522 404
357 3300025299 Ga0209256_1000066 Ga0209256_100006692 404
358 3300025302 Ga0207426_1000067 Ga0207426_100006730 404
359 3300025303 Ga0209051_1000134 Ga0209051_100013489 404
360 3300025303 Ga0209051_1001829 Ga0209051_10018299 404
361 3300025303 Ga0209051_1015481 Ga0209051_10154813 404
362 3300025304 Ga0209257_1000024 Ga0209257_1000024579 404
363 3300025304 Ga0209257_1001367 Ga0209257_10013679 404
364 3300026041 Ga0207639_10251249 Ga0207639_102512492 404
365 3300031456 Ga0307513_10022011 Ga0307513_100220115 404
366 3300031649 Ga0307514_10002080 Ga0307514_1000208017 404
367 3300048925 Ga0496122_0105386 Ga0496122_0105386_236_1486 404
368 3300048926 Ga0496123_0036487 Ga0496123_0036487_1759_3009 404

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

88

258

0.91

PF07690

MFS_1

Major Facilitator Superfamily

86

417

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lo8-assembly1.cif.gz_Z nora in complex with fab36 0.8755 29 375
6zgr-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.8624 31 376
8hpj-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in a ligand-free outward-facing form 0.8607 27 382
6hcl-assembly2.cif.gz_B crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution 0.8584 31 382
6zgu-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 3-(2-methylphenyl)propanoic acid at 2.41 angstroem resolution 0.8565 32 376
ID Description Score Start End Superfamily
af_P9WJX7_21_217_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9704 31 209 1.20.1250.20
af_P77389_5_379_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9469 31 391 1.20.1250.20
af_P0AEJ0_15_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9337 32 201 1.20.1250.20
af_P36554_12_217_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9305 33 211 1.20.1250.20
af_P9WG91_8_214_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9299 32 211 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A329ZP65-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9785 29 373 GO:0005886
GO:0022857
AF-A0A7H4MXV5-F1-model_v4 MFS transporter 0.9743 30 359 GO:0005886
GO:0022857
AF-A0A7Y7H9C2-F1-model_v4 DHA1 family arabinose polymer transporter-like MFS transporter 0.9715 29 374 GO:0005886
GO:0022857
AF-A0A7X8WZ53-F1-model_v4 MFS transporter 0.9711 28 317 GO:0005886
GO:0022857
AF-A0A437KQW2-F1-model_v4 deleted 0.9707 31 384

Feature Viewer

pLDDT pTM Quality
82.84 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map