F424696

General Info

Members Datasets Scaffolds Average Seq Length
368 250 362 138

Family's Representative Sequence

Representative Sequence 3300012497|Ga0157319_1011275|Ga0157319_10112751
Length 149
Sequence MPVLLAPGASTGMSETWTGGCACGAIRYAIAGEPMLMNDCQCRDCQRKSGTGHGSYLSFSRAGVQLEGDASRWDIVADSGNVKTRAFCPTCGSPVYMTFAAMPEMFTVHAASLDDPARYAPQAVMYGVRGHAWDRVDPALPKFDTMPPR

Samples

Sample ID Description Type Environment
1 2738541277 Variovorax sp. GV051 Isolate Unclassified
2 2738543019 Variovorax sp. GV040 Isolate Unclassified
3 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
4 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
5 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
6 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
81 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
82 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
118 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
119 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
127 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
139 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
140 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
141 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
142 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
143 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
145 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
158 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
159 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
160 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
161 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
162 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
163 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
164 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
165 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
166 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
167 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
168 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
169 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
170 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
171 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
172 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
173 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
174 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
175 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
176 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
187 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
188 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
191 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
192 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
193 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
200 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
201 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
220 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
223 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
229 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
230 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
231 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
232 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
233 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
238 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
239 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
240 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
241 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
242 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
243 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
244 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
245 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
246 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
247 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
248 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
249 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.37
Metatranscriptomes 0
Isolates 1.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.65
Nodule 2.17
Rhizoplane 4.62
Rhizosphere 65.76
Stem 0
Stem Tuber 0
Unclassified 6.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10046268 3300003659 Bacteria 917
2 Ga0055536_1017435 3300003781 Bacteria 2351
3 Ga0055540_1018506 3300003792 Bacteria 1907
4 Ga0055531_10044826 3300003794 Bacteria 1234
5 Ga0055531_10119482 3300003794 Bacteria 516
6 Ga0065712_10454857 3300005290 Bacteria 683
7 Ga0065715_10924347 3300005293 Bacteria 567
8 Ga0070670_100392571 3300005331 Bacteria 1224
9 Ga0070668_100039039 3300005347 Bacteria 3632
10 Ga0070671_102014399 3300005355 Bacteria 514
11 Ga0070674_100008250 3300005356 Bacteria 6191
12 Ga0070673_100261773 3300005364 Bacteria 1511
13 Ga0070673_100542047 3300005364 Bacteria 1056
14 Ga0070667_100008542 3300005367 Bacteria 8489
15 Ga0070667_100127990 3300005367 Bacteria 2215
16 Ga0070667_100221442 3300005367 Bacteria 1684
17 Ga0070667_100391605 3300005367 Bacteria 1263
18 Ga0070667_101246835 3300005367 Bacteria 696
19 Ga0070713_100169687 3300005436 Bacteria 1954
20 Ga0070710_11197349 3300005437 Bacteria 561
21 Ga0070708_100092346 3300005445 Bacteria 2757
22 Ga0070708_100162634 3300005445 Bacteria 2081
23 Ga0070662_100039111 3300005457 Bacteria 3373
24 Ga0070706_100519649 3300005467 Bacteria 1107
25 Ga0070707_100314217 3300005468 Bacteria 1523
26 Ga0070698_100002268 3300005471 Bacteria 21281
27 Ga0070698_100435800 3300005471 Bacteria 1246
28 Ga0070699_100194080 3300005518 Bacteria 1804
29 Ga0070699_100297145 3300005518 Bacteria 1449
30 Ga0070665_100000057 3300005548 Bacteria 237271
31 Ga0070665_100016026 3300005548 Bacteria 7523
32 Ga0070665_100152114 3300005548 Bacteria 2316
33 Ga0070665_100163682 3300005548 Bacteria 2227
34 Ga0070665_100186929 3300005548 Bacteria 2072
35 Ga0070665_100262962 3300005548 Bacteria 1726
36 Ga0070665_100830680 3300005548 Bacteria 937
37 Ga0068857_100937922 3300005577 Bacteria 831
38 Ga0068852_101263133 3300005616 Bacteria 760
39 Ga0068859_100000726 3300005617 Bacteria 33124
40 Ga0068864_100804996 3300005618 Bacteria 924
41 Ga0068864_101352519 3300005618 Bacteria 713
42 Ga0068861_100881359 3300005719 Bacteria 846
43 Ga0068861_101265160 3300005719 Bacteria 716
44 Ga0068861_101652836 3300005719 Bacteria 632
45 Ga0068851_10156452 3300005834 Bacteria 1249
46 Ga0068870_10716012 3300005840 Bacteria 692
47 Ga0068863_100077720 3300005841 Bacteria 3141
48 Ga0068863_101023828 3300005841 Bacteria 829
49 Ga0068858_100455488 3300005842 Bacteria 1233
50 Ga0068860_100180592 3300005843 Bacteria 2039
51 Ga0068860_100748120 3300005843 Bacteria 989
52 Ga0068862_100000379 3300005844 Bacteria 48327
53 Ga0081538_10010032 3300005981 Bacteria 7811
54 Ga0081540_1000213 3300005983 Bacteria 61164
55 Ga0075365_10134410 3300006038 Bacteria 1713
56 Ga0075365_10315561 3300006038 Bacteria 1101
57 Ga0075365_10697019 3300006038 Bacteria 717
58 Ga0075368_10011450 3300006042 Bacteria 3227
59 Ga0075368_10062374 3300006042 Bacteria 1494
60 Ga0075368_10175551 3300006042 Bacteria 902
61 Ga0075363_100277443 3300006048 Bacteria 969
62 Ga0075363_100469880 3300006048 Bacteria 745
63 Ga0075363_100502839 3300006048 Bacteria 720
64 Ga0075363_100549314 3300006048 Unclassified 689
65 Ga0075364_10049449 3300006051 Bacteria 2742
66 Ga0075364_10855289 3300006051 Bacteria 619
67 Ga0070712_100183270 3300006175 Bacteria 1633
68 Ga0075362_10000919 3300006177 Bacteria 8945
69 Ga0075362_10055477 3300006177 Bacteria 1782
70 Ga0075362_10118368 3300006177 Bacteria 1252
71 Ga0075362_10216278 3300006177 Unclassified 936
72 Ga0075362_10502348 3300006177 Bacteria 620
73 Ga0075367_10059587 3300006178 Bacteria 2273
74 Ga0075367_10187406 3300006178 Bacteria 1290
75 Ga0075367_10251566 3300006178 Bacteria 1108
76 Ga0075367_10590660 3300006178 Bacteria 705
77 Ga0075369_10038153 3300006186 Bacteria 2049
78 Ga0075369_10063192 3300006186 Bacteria 1619
79 Ga0075369_10116046 3300006186 Bacteria 1209
80 Ga0075366_10004359 3300006195 Bacteria 7589
81 Ga0075366_10101868 3300006195 Bacteria 1723
82 Ga0075366_10472025 3300006195 Bacteria 775
83 Ga0075366_10494900 3300006195 Bacteria 756
84 Ga0075370_10000904 3300006353 Bacteria 12168
85 Ga0075370_10080316 3300006353 Bacteria 1874
86 Ga0075370_10582503 3300006353 Bacteria 677
87 Ga0075428_101349183 3300006844 Bacteria 749
88 Ga0075431_100968089 3300006847 Bacteria 819
89 Ga0075434_101968579 3300006871 Bacteria 590
90 Ga0097620_100000726 3300006931 Bacteria 33124
91 Ga0099794_10010520 3300007265 Bacteria 3931
92 Ga0099794_10153234 3300007265 Bacteria 1170
93 Ga0099795_10018768 3300007788 Bacteria 2228
94 Ga0099795_10258061 3300007788 Bacteria 754
95 Ga0105250_10255787 3300009092 Bacteria 749
96 Ga0105240_10370176 3300009093 Bacteria 1620
97 Ga0105240_11673909 3300009093 Bacteria 665
98 Ga0111539_10000100 3300009094 Bacteria 91427
99 Ga0105245_11991901 3300009098 Bacteria 634
100 Ga0105247_10121454 3300009101 Bacteria 1693
101 Ga0105247_10800978 3300009101 Bacteria 719
102 Ga0114129_10857623 3300009147 Bacteria 1154
103 Ga0114129_11283384 3300009147 Bacteria 908
104 Ga0105243_12609305 3300009148 Bacteria 545
105 Ga0105243_12733424 3300009148 Bacteria 534
106 Ga0105242_10442854 3300009176 Bacteria 1223
107 Ga0105248_10040535 3300009177 Bacteria 5221
108 Ga0105248_11091996 3300009177 Bacteria 902
109 Ga0105237_10036635 3300009545 Bacteria 4964
110 Ga0105237_10090217 3300009545 Bacteria 3055
111 Ga0105237_10137548 3300009545 Bacteria 2437
112 Ga0105238_10365479 3300009551 Bacteria 1433
113 Ga0105238_10489630 3300009551 Bacteria 1230
114 Ga0105249_10498500 3300009553 Bacteria 1263
115 Ga0099796_10207712 3300010159 Bacteria 797
116 Ga0105239_10076658 3300010375 Bacteria 3677
117 Ga0105246_10486919 3300011119 Bacteria 1045
118 Ga0157319_1011275 3300012497 Bacteria 735
119 Ga0163162_10193308 3300013306 Bacteria 2163
120 Ga0163162_12152000 3300013306 Bacteria 640
121 Ga0157375_10333851 3300013308 Bacteria 1681
122 Ga0163163_10665198 3300014325 Bacteria 1105
123 Ga0157380_10001496 3300014326 Bacteria 15310
124 Ga0157380_10124700 3300014326 Bacteria 2187
125 Ga0157380_10369524 3300014326 Bacteria 1349
126 Ga0157380_10595296 3300014326 Bacteria 1093
127 Ga0157377_10514511 3300014745 Bacteria 839
128 Ga0157379_10175540 3300014968 Bacteria 1935
129 Ga0157379_10460151 3300014968 Bacteria 1176
130 Ga0157379_10526503 3300014968 Bacteria 1098
131 Ga0182007_10294771 3300015262 Bacteria 594
132 Ga0183368_1004 3300015687 Bacteria 1211761
133 Ga0228711_1003229 3300022739 Bacteria 25290
134 Ga0228710_1000004 3300022740 Bacteria 250560
135 Ga0209148_1000574 3300025254 Bacteria 34124
136 Ga0209233_1004212 3300025261 Bacteria 4931
137 Ga0209455_1000834 3300025272 Bacteria 16636
138 Ga0209676_1020565 3300025292 Bacteria 2238
139 Ga0209025_1041326 3300025294 Bacteria 1977
140 Ga0209051_1031223 3300025303 Bacteria 2054
141 Ga0209257_1003061 3300025304 Bacteria 15077
142 Ga0207656_10101115 3300025321 Bacteria 1322
143 Ga0207710_10275283 3300025900 Bacteria 846
144 Ga0207688_10064510 3300025901 Bacteria 2068
145 Ga0207647_10106861 3300025904 Bacteria 1657
146 Ga0207684_10091817 3300025910 Bacteria 2588
147 Ga0207693_10271500 3300025915 Bacteria 1329
148 Ga0207646_10151450 3300025922 Bacteria 2092
149 Ga0207646_10307836 3300025922 Bacteria 1431
150 Ga0207681_10055475 3300025923 Bacteria 2699
151 Ga0207694_10410139 3300025924 Bacteria 1127
152 Ga0207650_11087784 3300025925 Bacteria 680
153 Ga0207700_10178499 3300025928 Bacteria 1776
154 Ga0207644_10858843 3300025931 Bacteria 760
155 Ga0207690_10038025 3300025932 Bacteria 3129
156 Ga0207706_10169131 3300025933 Bacteria 1921
157 Ga0207686_10434366 3300025934 Bacteria 1007
158 Ga0207704_10249054 3300025938 Bacteria 1332
159 Ga0207691_10044865 3300025940 Bacteria 4067
160 Ga0207691_10071337 3300025940 Bacteria 3135
161 Ga0207712_10139215 3300025961 Bacteria 1860
162 Ga0207712_11097042 3300025961 Bacteria 708
163 Ga0207668_10010894 3300025972 Bacteria 5511
164 Ga0207668_10559326 3300025972 Bacteria 992
165 Ga0207668_10620735 3300025972 Bacteria 943
166 Ga0207658_10004940 3300025986 Bacteria 9198
167 Ga0207658_10079062 3300025986 Bacteria 2515
168 Ga0207658_10256748 3300025986 Bacteria 1488
169 Ga0207677_10123443 3300026023 Bacteria 1953
170 Ga0207677_11382449 3300026023 Bacteria 648
171 Ga0207703_10915482 3300026035 Bacteria 840
172 Ga0207708_10333244 3300026075 Bacteria 1241
173 Ga0207641_10013070 3300026088 Bacteria 6809
174 Ga0207648_10128565 3300026089 Bacteria 2229
175 Ga0207676_10063439 3300026095 Bacteria 2935
176 Ga0207676_11377874 3300026095 Bacteria 701
177 Ga0207675_100014309 3300026118 Bacteria 7396
178 Ga0207675_101024153 3300026118 Bacteria 844
179 Ga0207675_101163301 3300026118 Bacteria 791
180 Ga0209281_1000134 3300027111 Bacteria 185406
181 Ga0209282_1000013 3300027666 Bacteria 215053
182 Ga0209588_1012506 3300027671 Bacteria 2578
183 Ga0207428_10000096 3300027907 Bacteria 123081
184 Ga0268266_10000001 3300028379 Bacteria 4040580
185 Ga0268266_10114605 3300028379 Bacteria 2392
186 Ga0268266_10123191 3300028379 Bacteria 2309
187 Ga0268266_10334753 3300028379 Bacteria 1420
188 Ga0268266_10361006 3300028379 Bacteria 1367
189 Ga0268266_10383625 3300028379 Bacteria 1326
190 Ga0268266_10647992 3300028379 Bacteria 1016
191 Ga0268265_10000163 3300028380 Bacteria 81425
192 Ga0268264_11481868 3300028381 Bacteria 689
193 Ga0268264_12369220 3300028381 Bacteria 537
194 Ga0307517_10162277 3300028786 Bacteria 1496
195 Ga0307517_10311016 3300028786 Bacteria 878
196 Ga0307515_10005291 3300028794 Bacteria 26238
197 Ga0307515_10475302 3300028794 Bacteria 863
198 Ga0307511_10002194 3300030521 Bacteria 20480
199 Ga0316181_1275178 3300030744 Bacteria 2011
200 Ga0307513_10004959 3300031456 Bacteria 17650
201 Ga0307513_10067762 3300031456 Bacteria 3742
202 Ga0307513_10081539 3300031456 Bacteria 3333
203 Ga0307513_10189132 3300031456 Bacteria 1912
204 Ga0307408_100534248 3300031548 Bacteria 1032
205 Ga0307508_10059483 3300031616 Bacteria 3380
206 Ga0307516_10284914 3300031730 Bacteria 1333
207 Ga0307516_10490831 3300031730 Bacteria 883
208 Ga0307413_11146175 3300031824 Bacteria 674
209 Ga0307412_10236546 3300031911 Bacteria 1410
210 Ga0315914_1000004 3300031967 Bacteria 288534
211 Ga0307409_101148190 3300031995 Bacteria 799
212 Ga0307416_100483612 3300032002 Bacteria 1299
213 Ga0307411_10681021 3300032005 Bacteria 894
214 Ga0307411_11244157 3300032005 Bacteria 676
215 Ga0307510_10004361 3300033180 Bacteria 16655
216 Ga0315913_1008800 3300033430 Bacteria 11917
217 Ga0315915_1000003 3300033464 Bacteria 407996
218 Ga0373934_0000138 3300035086 Bacteria 26971
219 Ga0373944_0315828 3300035089 Bacteria 589
220 Ga0373923_0133686 3300035111 Bacteria 1117
221 Ga0373956_0029718 3300035119 Bacteria 2384
222 Ga0373957_0082389 3300035120 Bacteria 1272
223 Ga0373955_0014511 3300035172 Bacteria 3834
224 Ga0373931_0096856 3300035691 Bacteria 1653
225 Ga0373931_0200372 3300035691 Bacteria 1192
226 Ga0373927_0209677 3300035695 Bacteria 1280
227 Ga0373927_0594849 3300035695 Bacteria 731
228 Ga0373933_0001893 3300035724 Bacteria 12068
229 Ga0373947_0875116 3300035725 Bacteria 613
230 Ga0373937_0005884 3300036401 Bacteria 10549
231 Ga0373925_0207262 3300037068 Bacteria 1561
232 Ga0373925_0757915 3300037068 Bacteria 800
233 Ga0395900_0765712 3300037418 Bacteria 895
234 Ga0395898_1469489 3300037466 Bacteria 608
235 Ga0436364_0942254 3300037853 Bacteria 614
236 Ga0436363_1325084 3300039450 Bacteria 655
237 Ga0439436_0000605 3300041404 Bacteria 9500
238 Ga0439438_019703 3300041405 Bacteria 1904
239 Ga0439439_0006362 3300041406 Bacteria 2730
240 Ga0439453_0000692 3300041408 Bacteria 3872
241 Ga0439465_0016954 3300041413 Bacteria 2273
242 Ga0451797_0788926 3300041453 Bacteria 594
243 Ga0451798_1111559 3300041458 Bacteria 661
244 Ga0451851_0405651 3300041507 Bacteria 1402
245 Ga0439433_0219759 3300041999 Bacteria 506
246 Ga0439443_008323 3300042003 Bacteria 1461
247 Ga0439448_0004615 3300042005 Bacteria 3896
248 Ga0439449_0196722 3300042007 Bacteria 754
249 Ga0439455_0001267 3300042012 Bacteria 4144
250 Ga0439457_009322 3300042014 Bacteria 2289
251 Ga0439462_0065382 3300042015 Bacteria 985
252 Ga0450906_000256 3300042145 Bacteria 10256
253 Ga0439458_0000599 3300042157 Bacteria 9281
254 Ga0439434_0002807 3300042435 Bacteria 5084
255 Ga0439435_0003198 3300042436 Bacteria 3374
256 Ga0439460_0029444 3300042461 Bacteria 1554
257 Ga0466963_0011705 3300044694 Bacteria 5348
258 Ga0466970_0153728 3300044765 Bacteria 1271
259 Ga0466957_1016824 3300044842 Bacteria 596
260 Ga0466959_0728333 3300045049 Bacteria 664
261 Ga0466967_0041384 3300045976 Bacteria 3972
262 Ga0495603_0029791 3300046455 Bacteria 3290
263 Ga0495638_0003450 3300046460 Bacteria 12448
264 Ga0495638_0041243 3300046460 Bacteria 2921
265 Ga0495638_0437703 3300046460 Bacteria 670
266 Ga0495641_0377731 3300046461 Bacteria 642
267 Ga0495639_0028878 3300046475 Bacteria 2459
268 Ga0495664_0161082 3300046477 Bacteria 1361
269 Ga0495584_0081661 3300046491 Bacteria 1627
270 Ga0495606_0014314 3300046507 Bacteria 6204
271 Ga0495606_0209513 3300046507 Bacteria 1105
272 Ga0495630_0310096 3300046517 Bacteria 1206
273 Ga0495643_0167672 3300046522 Bacteria 1076
274 Ga0495663_0052338 3300046525 Bacteria 1267
275 Ga0495663_0300720 3300046525 Bacteria 578
276 Ga0495597_0014188 3300046542 Bacteria 3798
277 Ga0495656_0013520 3300046615 Bacteria 3039
278 Ga0495656_0596554 3300046615 Bacteria 591
279 Ga0495668_0250513 3300046616 Bacteria 970
280 Ga0495611_0087929 3300046648 Bacteria 1434
281 Ga0495625_0081945 3300046660 Bacteria 2245
282 Ga0495625_0256130 3300046660 Bacteria 1134
283 Ga0495625_0698300 3300046660 Bacteria 599
284 Ga0495625_0812390 3300046660 Bacteria 543
285 Ga0495588_0008879 3300046674 Bacteria 4625
286 Ga0495657_0282099 3300046675 Bacteria 994
287 Ga0495649_0059540 3300046694 Bacteria 2056
288 Ga0495660_0081191 3300046810 Bacteria 1700
289 Ga0495636_0011051 3300047318 Bacteria 3573
290 Ga0495636_0280103 3300047318 Bacteria 776
291 Ga0495674_0234910 3300047319 Bacteria 1512
292 Ga0495672_0397966 3300047320 Bacteria 630
293 Ga0495676_0060197 3300047321 Bacteria 2978
294 Ga0495680_0439433 3300047322 Bacteria 895
295 Ga0495687_000585 3300047443 Bacteria 42774
296 Ga0495675_0116825 3300047444 Bacteria 1663
297 Ga0495686_0402067 3300047472 Unclassified 735
298 Ga0495626_0404436 3300048091 Bacteria 528
299 Ga0496100_0413791 3300048903 Bacteria 1029
300 Ga0496104_0399624 3300048907 Bacteria 1286
301 Ga0496106_0053866 3300048909 Bacteria 3039
302 Ga0496106_0506212 3300048909 Bacteria 970
303 Ga0496106_0764497 3300048909 Bacteria 768
304 Ga0496106_0870874 3300048909 Bacteria 712
305 Ga0496107_0009774 3300048910 Bacteria 6653
306 Ga0496108_0051741 3300048911 Bacteria 3441
307 Ga0496108_0611214 3300048911 Bacteria 949
308 Ga0496109_0122570 3300048912 Bacteria 2422
309 Ga0496109_1433743 3300048912 Bacteria 626
310 Ga0496110_0099862 3300048913 Bacteria 2601
311 Ga0496111_0105513 3300048914 Bacteria 2073
312 Ga0496111_0669876 3300048914 Bacteria 756
313 Ga0496114_0102995 3300048917 Bacteria 2439
314 Ga0496117_0118213 3300048920 Bacteria 1635
315 Ga0496118_0123164 3300048921 Bacteria 1685
316 Ga0496121_0721253 3300048924 Bacteria 597
317 Ga0496125_0085952 3300048928 Bacteria 2381
318 Ga0495682_0070715 3300049460 Bacteria 1256
319 Ga0495682_0155908 3300049460 Bacteria 814
320 Ga0501072_0494957 3300049588 Bacteria 967
321 Ga0501073_0094061 3300049589 Bacteria 2082
322 Ga0501075_1040312 3300049591 Bacteria 622
323 Ga0501045_0455308 3300049824 Bacteria 951
324 nmdc:mga03683_120013_c1 3300050489 Bacteria 1168
325 nmdc:mga03683_648_c1 3300050489 Bacteria 5541
326 nmdc:mga03n38_195728_c1 3300050490 Bacteria 1044
327 nmdc:mga03n38_31148_c1 3300050490 Bacteria 2248
328 nmdc:mga03n38_891762_c1 3300050490 Bacteria 522
329 nmdc:mga00v17_1021739_c1 3300050491 Bacteria 520
330 nmdc:mga0yw44_106066_c1 3300050492 Bacteria 1795
331 nmdc:mga0yw44_143915_c1 3300050492 Bacteria 1551
332 nmdc:mga0yw44_712641_c1 3300050492 Bacteria 682
333 nmdc:mga06z11_116945_c1 3300050494 Bacteria 1483
334 nmdc:mga06z11_202779_c1 3300050494 Bacteria 1153
335 nmdc:mga06z11_61062_c1 3300050494 Bacteria 1965
336 nmdc:mga06z11_618422_c1 3300050494 Bacteria 659
337 nmdc:mga04h51_196692_c1 3300050495 Bacteria 791
338 nmdc:mga07m45_13689_c2 3300050496 Bacteria 3613
339 nmdc:mga07m45_202614_c1 3300050496 Bacteria 1154
340 nmdc:mga08y16_62_c1 3300050511 Bacteria 89583
341 nmdc:mga0a205_1098247_c1 3300050515 Bacteria 643
342 nmdc:mga0sz30_111724_c1 3300050516 Bacteria 1198
343 nmdc:mga0sz30_251196_c1 3300050516 Bacteria 787
344 Ga0500583_0239191 3300053092 Bacteria 898
345 Ga0500583_0323074 3300053092 Bacteria 752
346 Ga0500651_0057530 3300053093 Bacteria 2433
347 Ga0500651_0425681 3300053093 Bacteria 742
348 Ga0500651_0769759 3300053093 Bacteria 510
349 Ga0500641_0040790 3300053096 Bacteria 1876
350 Ga0500641_0054387 3300053096 Bacteria 1655
351 Ga0500641_0312785 3300053096 Bacteria 641
352 Ga0500652_012873 3300053131 Bacteria 2949
353 Ga0500658_0035889 3300053134 Bacteria 1965
354 Ga0500577_0018249 3300053142 Bacteria 2252
355 Ga0500604_0036680 3300053151 Bacteria 1463
356 Ga0500616_0000501 3300053153 Bacteria 50041
357 Ga0500622_0001755 3300053156 Bacteria 16695
358 Ga0500611_023543 3300053727 Bacteria 1200
359 Ga0500645_000385 3300053730 Bacteria 30984
360 Ga0590074_096549 3300059423 Bacteria 574
361 Ga0530510_0545817 3300061734 Bacteria 880
362 Ga0530510_0553198 3300061734 Bacteria 874

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0765712 Ga0395900_0765712_15_365 116
2 3300037466 Ga0395898_1469489 Ga0395898_1469489_29_379 116
3 3300046507 Ga0495606_0209513 Ga0495606_0209513_126_509 127
4 iso_pu_bacteria 2738541277 2738722885 133
5 iso_pu_bacteria 2738543019 2739283456 133
6 iso_pu_bacteria 3005718088 3005720910 133
7 iso_pu_bacteria 2775506902 2776272389 134
8 iso_pu_bacteria 2775506904 2776284329 134
9 iso_pu_bacteria 3002141150 3002142862 134
10 3300028786 Ga0307517_10162277 Ga0307517_101622772 136
11 3300041458 Ga0451798_1111559 Ga0451798_1111559_158_568 136
12 3300003781 Ga0055536_1017435 Ga0055536_10174353 137
13 3300003792 Ga0055540_1018506 Ga0055540_10185061 137
14 3300005347 Ga0070668_100039039 Ga0070668_1000390393 137
15 3300005618 Ga0068864_100804996 Ga0068864_1008049962 137
16 3300005618 Ga0068864_101352519 Ga0068864_1013525191 137
17 3300005841 Ga0068863_101023828 Ga0068863_1010238282 137
18 3300006042 Ga0075368_10062374 Ga0075368_100623743 137
19 3300006048 Ga0075363_100277443 Ga0075363_1002774432 137
20 3300006048 Ga0075363_100469880 Ga0075363_1004698801 137
21 3300006178 Ga0075367_10059587 Ga0075367_100595873 137
22 3300006195 Ga0075366_10004359 Ga0075366_100043596 137
23 3300006195 Ga0075366_10101868 Ga0075366_101018682 137
24 3300006353 Ga0075370_10000904 Ga0075370_100009049 137
25 3300007788 Ga0099795_10018768 Ga0099795_100187682 137
26 3300009092 Ga0105250_10255787 Ga0105250_102557872 137
27 3300009093 Ga0105240_10370176 Ga0105240_103701762 137
28 3300009177 Ga0105248_11091996 Ga0105248_110919962 137
29 3300009545 Ga0105237_10090217 Ga0105237_100902172 137
30 3300010375 Ga0105239_10076658 Ga0105239_100766583 137
31 3300012497 Ga0157319_1011275 Ga0157319_10112751 137
32 3300025254 Ga0209148_1000574 Ga0209148_100057420 137
33 3300025261 Ga0209233_1004212 Ga0209233_10042122 137
34 3300025272 Ga0209455_1000834 Ga0209455_100083417 137
35 3300025292 Ga0209676_1020565 Ga0209676_10205652 137
36 3300025303 Ga0209051_1031223 Ga0209051_10312231 137
37 3300025931 Ga0207644_10858843 Ga0207644_108588432 137
38 3300026095 Ga0207676_11377874 Ga0207676_113778742 137
39 3300026118 Ga0207675_101163301 Ga0207675_1011633012 137
40 3300030744 Ga0316181_1275178 Ga0316181_12751782 137
41 3300031730 Ga0307516_10284914 Ga0307516_102849143 137
42 3300033180 Ga0307510_10004361 Ga0307510_100043614 137
43 3300037853 Ga0436364_0942254 Ga0436364_0942254_152_565 137
44 3300044694 Ga0466963_0011705 Ga0466963_0011705_2527_2940 137
45 3300044765 Ga0466970_0153728 Ga0466970_0153728_729_1142 137
46 3300044842 Ga0466957_1016824 Ga0466957_1016824_92_505 137
47 3300045049 Ga0466959_0728333 Ga0466959_0728333_184_597 137
48 3300045976 Ga0466967_0041384 Ga0466967_0041384_2665_3078 137
49 3300046477 Ga0495664_0161082 Ga0495664_0161082_515_928 137
50 3300046507 Ga0495606_0014314 Ga0495606_0014314_4546_4959 137
51 3300046517 Ga0495630_0310096 Ga0495630_0310096_335_748 137
52 3300046522 Ga0495643_0167672 Ga0495643_0167672_292_705 137
53 3300046542 Ga0495597_0014188 Ga0495597_0014188_1660_2073 137
54 3300046615 Ga0495656_0013520 Ga0495656_0013520_1506_1919 137
55 3300046660 Ga0495625_0256130 Ga0495625_0256130_392_805 137
56 3300047318 Ga0495636_0011051 Ga0495636_0011051_2320_2733 137
57 3300047319 Ga0495674_0234910 Ga0495674_0234910_14_427 137
58 3300047443 Ga0495687_000585 Ga0495687_000585_30695_31108 137
59 3300047472 Ga0495686_0402067 Ga0495686_0402067_176_592 137
60 3300048909 Ga0496106_0764497 Ga0496106_0764497_215_628 137
61 3300048911 Ga0496108_0611214 Ga0496108_0611214_450_863 137
62 3300048913 Ga0496110_0099862 Ga0496110_0099862_1855_2268 137
63 3300048914 Ga0496111_0105513 Ga0496111_0105513_128_541 137
64 3300048920 Ga0496117_0118213 Ga0496117_0118213_1024_1437 137
65 3300048928 Ga0496125_0085952 Ga0496125_0085952_1265_1678 137
66 3300049460 Ga0495682_0070715 Ga0495682_0070715_273_686 137
67 3300049460 Ga0495682_0155908 Ga0495682_0155908_302_715 137
68 3300049588 Ga0501072_0494957 Ga0501072_0494957_161_574 137
69 3300049824 Ga0501045_0455308 Ga0501045_0455308_475_900 137
70 3300050490 nmdc:mga03n38_31148_c1 nmdc:mga03n38_31148_c1_1412_1828 137
71 3300053096 Ga0500641_0054387 Ga0500641_0054387_722_1138 137
72 3300061734 Ga0530510_0553198 Ga0530510_0553198_63_476 137
73 3300003659 JGI25404J52841_10046268 JGI25404J52841_100462681 138
74 3300003794 Ga0055531_10044826 Ga0055531_100448262 138
75 3300003794 Ga0055531_10119482 Ga0055531_101194821 138
76 3300005290 Ga0065712_10454857 Ga0065712_104548571 138
77 3300005293 Ga0065715_10924347 Ga0065715_109243471 138
78 3300005331 Ga0070670_100392571 Ga0070670_1003925712 138
79 3300005355 Ga0070671_102014399 Ga0070671_1020143991 138
80 3300005356 Ga0070674_100008250 Ga0070674_1000082503 138
81 3300005364 Ga0070673_100261773 Ga0070673_1002617732 138
82 3300005364 Ga0070673_100542047 Ga0070673_1005420472 138
83 3300005367 Ga0070667_100008542 Ga0070667_1000085423 138
84 3300005367 Ga0070667_100127990 Ga0070667_1001279903 138
85 3300005367 Ga0070667_100221442 Ga0070667_1002214423 138
86 3300005367 Ga0070667_100391605 Ga0070667_1003916051 138
87 3300005367 Ga0070667_101246835 Ga0070667_1012468351 138
88 3300005436 Ga0070713_100169687 Ga0070713_1001696873 138
89 3300005437 Ga0070710_11197349 Ga0070710_111973491 138
90 3300005445 Ga0070708_100092346 Ga0070708_1000923462 138
91 3300005445 Ga0070708_100162634 Ga0070708_1001626342 138
92 3300005457 Ga0070662_100039111 Ga0070662_1000391113 138
93 3300005467 Ga0070706_100519649 Ga0070706_1005196492 138
94 3300005468 Ga0070707_100314217 Ga0070707_1003142171 138
95 3300005471 Ga0070698_100002268 Ga0070698_10000226824 138
96 3300005471 Ga0070698_100435800 Ga0070698_1004358002 138
97 3300005518 Ga0070699_100194080 Ga0070699_1001940803 138
98 3300005518 Ga0070699_100297145 Ga0070699_1002971452 138
99 3300005548 Ga0070665_100000057 Ga0070665_10000005750 138
100 3300005548 Ga0070665_100016026 Ga0070665_1000160265 138
101 3300005548 Ga0070665_100152114 Ga0070665_1001521144 138
102 3300005548 Ga0070665_100163682 Ga0070665_1001636823 138
103 3300005548 Ga0070665_100186929 Ga0070665_1001869292 138
104 3300005548 Ga0070665_100262962 Ga0070665_1002629622 138
105 3300005548 Ga0070665_100830680 Ga0070665_1008306802 138
106 3300005577 Ga0068857_100937922 Ga0068857_1009379222 138
107 3300005616 Ga0068852_101263133 Ga0068852_1012631332 138
108 3300005617 Ga0068859_100000726 Ga0068859_10000072627 138
109 3300005719 Ga0068861_100881359 Ga0068861_1008813592 138
110 3300005719 Ga0068861_101265160 Ga0068861_1012651602 138
111 3300005719 Ga0068861_101652836 Ga0068861_1016528361 138
112 3300005834 Ga0068851_10156452 Ga0068851_101564522 138
113 3300005840 Ga0068870_10716012 Ga0068870_107160121 138
114 3300005841 Ga0068863_100077720 Ga0068863_1000777203 138
115 3300005842 Ga0068858_100455488 Ga0068858_1004554882 138
116 3300005843 Ga0068860_100180592 Ga0068860_1001805922 138
117 3300005843 Ga0068860_100748120 Ga0068860_1007481202 138
118 3300005844 Ga0068862_100000379 Ga0068862_1000003794 138
119 3300005981 Ga0081538_10010032 Ga0081538_100100326 138
120 3300005983 Ga0081540_1000213 Ga0081540_100021366 138
121 3300006038 Ga0075365_10134410 Ga0075365_101344102 138
122 3300006038 Ga0075365_10315561 Ga0075365_103155611 138
123 3300006038 Ga0075365_10697019 Ga0075365_106970191 138
124 3300006042 Ga0075368_10011450 Ga0075368_100114502 138
125 3300006042 Ga0075368_10175551 Ga0075368_101755512 138
126 3300006048 Ga0075363_100502839 Ga0075363_1005028392 138
127 3300006048 Ga0075363_100549314 Ga0075363_1005493141 138
128 3300006051 Ga0075364_10049449 Ga0075364_100494492 138
129 3300006051 Ga0075364_10855289 Ga0075364_108552892 138
130 3300006175 Ga0070712_100183270 Ga0070712_1001832702 138
131 3300006177 Ga0075362_10000919 Ga0075362_1000091915 138
132 3300006177 Ga0075362_10055477 Ga0075362_100554774 138
133 3300006177 Ga0075362_10118368 Ga0075362_101183681 138
134 3300006177 Ga0075362_10216278 Ga0075362_102162782 138
135 3300006177 Ga0075362_10502348 Ga0075362_105023482 138
136 3300006178 Ga0075367_10187406 Ga0075367_101874062 138
137 3300006178 Ga0075367_10251566 Ga0075367_102515662 138
138 3300006178 Ga0075367_10590660 Ga0075367_105906601 138
139 3300006186 Ga0075369_10038153 Ga0075369_100381533 138
140 3300006186 Ga0075369_10063192 Ga0075369_100631922 138
141 3300006186 Ga0075369_10116046 Ga0075369_101160462 138
142 3300006195 Ga0075366_10472025 Ga0075366_104720252 138
143 3300006195 Ga0075366_10494900 Ga0075366_104949001 138
144 3300006353 Ga0075370_10080316 Ga0075370_100803162 138
145 3300006353 Ga0075370_10582503 Ga0075370_105825032 138
146 3300006844 Ga0075428_101349183 Ga0075428_1013491832 138
147 3300006847 Ga0075431_100968089 Ga0075431_1009680892 138
148 3300006871 Ga0075434_101968579 Ga0075434_1019685792 138
149 3300006931 Ga0097620_100000726 Ga0097620_10000072627 138
150 3300007265 Ga0099794_10010520 Ga0099794_100105204 138
151 3300007265 Ga0099794_10153234 Ga0099794_101532341 138
152 3300007788 Ga0099795_10258061 Ga0099795_102580611 138
153 3300009093 Ga0105240_11673909 Ga0105240_116739091 138
154 3300009094 Ga0111539_10000100 Ga0111539_1000010054 138
155 3300009098 Ga0105245_11991901 Ga0105245_119919011 138
156 3300009101 Ga0105247_10121454 Ga0105247_101214542 138
157 3300009101 Ga0105247_10800978 Ga0105247_108009782 138
158 3300009147 Ga0114129_10857623 Ga0114129_108576231 138
159 3300009147 Ga0114129_11283384 Ga0114129_112833842 138
160 3300009148 Ga0105243_12609305 Ga0105243_126093051 138
161 3300009148 Ga0105243_12733424 Ga0105243_127334242 138
162 3300009176 Ga0105242_10442854 Ga0105242_104428542 138
163 3300009177 Ga0105248_10040535 Ga0105248_100405356 138
164 3300009545 Ga0105237_10036635 Ga0105237_100366353 138
165 3300009545 Ga0105237_10137548 Ga0105237_101375481 138
166 3300009551 Ga0105238_10365479 Ga0105238_103654792 138
167 3300009551 Ga0105238_10489630 Ga0105238_104896303 138
168 3300009553 Ga0105249_10498500 Ga0105249_104985002 138
169 3300010159 Ga0099796_10207712 Ga0099796_102077122 138
170 3300011119 Ga0105246_10486919 Ga0105246_104869192 138
171 3300013306 Ga0163162_10193308 Ga0163162_101933083 138
172 3300013306 Ga0163162_12152000 Ga0163162_121520001 138
173 3300013308 Ga0157375_10333851 Ga0157375_103338512 138
174 3300014325 Ga0163163_10665198 Ga0163163_106651982 138
175 3300014326 Ga0157380_10001496 Ga0157380_100014964 138
176 3300014326 Ga0157380_10124700 Ga0157380_101247003 138
177 3300014326 Ga0157380_10369524 Ga0157380_103695242 138
178 3300014326 Ga0157380_10595296 Ga0157380_105952963 138
179 3300014745 Ga0157377_10514511 Ga0157377_105145112 138
180 3300014968 Ga0157379_10175540 Ga0157379_101755402 138
181 3300014968 Ga0157379_10460151 Ga0157379_104601513 138
182 3300014968 Ga0157379_10526503 Ga0157379_105265031 138
183 3300015262 Ga0182007_10294771 Ga0182007_102947711 138
184 3300015687 Ga0183368_1004 Ga0183368_1004754 138
185 3300022739 Ga0228711_1003229 Ga0228711_100322914 138
186 3300022740 Ga0228710_1000004 Ga0228710_100000436 138
187 3300025294 Ga0209025_1041326 Ga0209025_10413262 138
188 3300025304 Ga0209257_1003061 Ga0209257_100306110 138
189 3300025321 Ga0207656_10101115 Ga0207656_101011152 138
190 3300025900 Ga0207710_10275283 Ga0207710_102752832 138
191 3300025901 Ga0207688_10064510 Ga0207688_100645102 138
192 3300025904 Ga0207647_10106861 Ga0207647_101068612 138
193 3300025910 Ga0207684_10091817 Ga0207684_100918174 138
194 3300025915 Ga0207693_10271500 Ga0207693_102715002 138
195 3300025922 Ga0207646_10151450 Ga0207646_101514503 138
196 3300025922 Ga0207646_10307836 Ga0207646_103078361 138
197 3300025923 Ga0207681_10055475 Ga0207681_100554752 138
198 3300025924 Ga0207694_10410139 Ga0207694_104101393 138
199 3300025925 Ga0207650_11087784 Ga0207650_110877841 138
200 3300025928 Ga0207700_10178499 Ga0207700_101784992 138
201 3300025932 Ga0207690_10038025 Ga0207690_100380255 138
202 3300025933 Ga0207706_10169131 Ga0207706_101691312 138
203 3300025934 Ga0207686_10434366 Ga0207686_104343662 138
204 3300025938 Ga0207704_10249054 Ga0207704_102490542 138
205 3300025940 Ga0207691_10044865 Ga0207691_100448652 138
206 3300025940 Ga0207691_10071337 Ga0207691_100713373 138
207 3300025961 Ga0207712_10139215 Ga0207712_101392152 138
208 3300025961 Ga0207712_11097042 Ga0207712_110970422 138
209 3300025972 Ga0207668_10010894 Ga0207668_100108943 138
210 3300025972 Ga0207668_10559326 Ga0207668_105593261 138
211 3300025972 Ga0207668_10620735 Ga0207668_106207352 138
212 3300025986 Ga0207658_10004940 Ga0207658_100049405 138
213 3300025986 Ga0207658_10079062 Ga0207658_100790624 138
214 3300025986 Ga0207658_10256748 Ga0207658_102567482 138
215 3300026023 Ga0207677_10123443 Ga0207677_101234432 138
216 3300026023 Ga0207677_11382449 Ga0207677_113824492 138
217 3300026035 Ga0207703_10915482 Ga0207703_109154822 138
218 3300026075 Ga0207708_10333244 Ga0207708_103332442 138
219 3300026088 Ga0207641_10013070 Ga0207641_100130703 138
220 3300026089 Ga0207648_10128565 Ga0207648_101285654 138
221 3300026095 Ga0207676_10063439 Ga0207676_100634391 138
222 3300026118 Ga0207675_100014309 Ga0207675_1000143091 138
223 3300026118 Ga0207675_101024153 Ga0207675_1010241532 138
224 3300027111 Ga0209281_1000134 Ga0209281_100013428 138
225 3300027666 Ga0209282_1000013 Ga0209282_10000136 138
226 3300027671 Ga0209588_1012506 Ga0209588_10125064 138
227 3300027907 Ga0207428_10000096 Ga0207428_1000009619 138
228 3300028379 Ga0268266_10000001 Ga0268266_100000012979 138
229 3300028379 Ga0268266_10114605 Ga0268266_101146053 138
230 3300028379 Ga0268266_10123191 Ga0268266_101231914 138
231 3300028379 Ga0268266_10334753 Ga0268266_103347533 138
232 3300028379 Ga0268266_10361006 Ga0268266_103610062 138
233 3300028379 Ga0268266_10383625 Ga0268266_103836252 138
234 3300028379 Ga0268266_10647992 Ga0268266_106479922 138
235 3300028380 Ga0268265_10000163 Ga0268265_1000016344 138
236 3300028381 Ga0268264_11481868 Ga0268264_114818681 138
237 3300028381 Ga0268264_12369220 Ga0268264_123692201 138
238 3300028786 Ga0307517_10311016 Ga0307517_103110162 138
239 3300028794 Ga0307515_10005291 Ga0307515_1000529115 138
240 3300028794 Ga0307515_10475302 Ga0307515_104753021 138
241 3300030521 Ga0307511_10002194 Ga0307511_1000219421 138
242 3300031456 Ga0307513_10004959 Ga0307513_100049598 138
243 3300031456 Ga0307513_10067762 Ga0307513_100677626 138
244 3300031456 Ga0307513_10081539 Ga0307513_100815392 138
245 3300031456 Ga0307513_10189132 Ga0307513_101891323 138
246 3300031548 Ga0307408_100534248 Ga0307408_1005342482 138
247 3300031616 Ga0307508_10059483 Ga0307508_100594836 138
248 3300031730 Ga0307516_10490831 Ga0307516_104908312 138
249 3300031824 Ga0307413_11146175 Ga0307413_111461751 138
250 3300031911 Ga0307412_10236546 Ga0307412_102365462 138
251 3300031967 Ga0315914_1000004 Ga0315914_100000441 138
252 3300031995 Ga0307409_101148190 Ga0307409_1011481902 138
253 3300032002 Ga0307416_100483612 Ga0307416_1004836122 138
254 3300032005 Ga0307411_10681021 Ga0307411_106810211 138
255 3300032005 Ga0307411_11244157 Ga0307411_112441572 138
256 3300033430 Ga0315913_1008800 Ga0315913_100880012 138
257 3300033464 Ga0315915_1000003 Ga0315915_1000003148 138
258 3300035086 Ga0373934_0000138 Ga0373934_0000138_25528_25944 138
259 3300035089 Ga0373944_0315828 Ga0373944_0315828_75_497 138
260 3300035111 Ga0373923_0133686 Ga0373923_0133686_374_790 138
261 3300035119 Ga0373956_0029718 Ga0373956_0029718_885_1301 138
262 3300035120 Ga0373957_0082389 Ga0373957_0082389_508_924 138
263 3300035172 Ga0373955_0014511 Ga0373955_0014511_1615_2031 138
264 3300035691 Ga0373931_0096856 Ga0373931_0096856_844_1266 138
265 3300035691 Ga0373931_0200372 Ga0373931_0200372_143_559 138
266 3300035695 Ga0373927_0209677 Ga0373927_0209677_265_687 138
267 3300035695 Ga0373927_0594849 Ga0373927_0594849_278_694 138
268 3300035724 Ga0373933_0001893 Ga0373933_0001893_3033_3449 138
269 3300035725 Ga0373947_0875116 Ga0373947_0875116_187_603 138
270 3300036401 Ga0373937_0005884 Ga0373937_0005884_1102_1518 138
271 3300037068 Ga0373925_0207262 Ga0373925_0207262_924_1346 138
272 3300037068 Ga0373925_0757915 Ga0373925_0757915_53_469 138
273 3300039450 Ga0436363_1325084 Ga0436363_1325084_105_521 138
274 3300041404 Ga0439436_0000605 Ga0439436_0000605_6988_7404 138
275 3300041405 Ga0439438_019703 Ga0439438_019703_763_1179 138
276 3300041406 Ga0439439_0006362 Ga0439439_0006362_333_749 138
277 3300041408 Ga0439453_0000692 Ga0439453_0000692_1433_1861 138
278 3300041413 Ga0439465_0016954 Ga0439465_0016954_1248_1664 138
279 3300041453 Ga0451797_0788926 Ga0451797_0788926_160_576 138
280 3300041507 Ga0451851_0405651 Ga0451851_0405651_469_885 138
281 3300041999 Ga0439433_0219759 Ga0439433_0219759_66_482 138
282 3300042003 Ga0439443_008323 Ga0439443_008323_772_1200 138
283 3300042005 Ga0439448_0004615 Ga0439448_0004615_425_841 138
284 3300042007 Ga0439449_0196722 Ga0439449_0196722_191_607 138
285 3300042012 Ga0439455_0001267 Ga0439455_0001267_3614_4030 138
286 3300042014 Ga0439457_009322 Ga0439457_009322_1852_2268 138
287 3300042015 Ga0439462_0065382 Ga0439462_0065382_44_460 138
288 3300042145 Ga0450906_000256 Ga0450906_000256_8375_8791 138
289 3300042157 Ga0439458_0000599 Ga0439458_0000599_4260_4676 138
290 3300042435 Ga0439434_0002807 Ga0439434_0002807_1058_1474 138
291 3300042436 Ga0439435_0003198 Ga0439435_0003198_297_725 138
292 3300042461 Ga0439460_0029444 Ga0439460_0029444_36_464 138
293 3300046455 Ga0495603_0029791 Ga0495603_0029791_2059_2475 138
294 3300046460 Ga0495638_0003450 Ga0495638_0003450_1793_2209 138
295 3300046460 Ga0495638_0041243 Ga0495638_0041243_643_1059 138
296 3300046460 Ga0495638_0437703 Ga0495638_0437703_144_560 138
297 3300046461 Ga0495641_0377731 Ga0495641_0377731_22_438 138
298 3300046475 Ga0495639_0028878 Ga0495639_0028878_1073_1489 138
299 3300046491 Ga0495584_0081661 Ga0495584_0081661_1163_1579 138
300 3300046525 Ga0495663_0052338 Ga0495663_0052338_224_640 138
301 3300046525 Ga0495663_0300720 Ga0495663_0300720_57_473 138
302 3300046615 Ga0495656_0596554 Ga0495656_0596554_136_561 138
303 3300046616 Ga0495668_0250513 Ga0495668_0250513_330_746 138
304 3300046648 Ga0495611_0087929 Ga0495611_0087929_658_1074 138
305 3300046660 Ga0495625_0081945 Ga0495625_0081945_64_480 138
306 3300046660 Ga0495625_0698300 Ga0495625_0698300_112_528 138
307 3300046660 Ga0495625_0812390 Ga0495625_0812390_16_432 138
308 3300046674 Ga0495588_0008879 Ga0495588_0008879_1519_1935 138
309 3300046675 Ga0495657_0282099 Ga0495657_0282099_443_859 138
310 3300046694 Ga0495649_0059540 Ga0495649_0059540_40_456 138
311 3300046810 Ga0495660_0081191 Ga0495660_0081191_452_868 138
312 3300047318 Ga0495636_0280103 Ga0495636_0280103_285_701 138
313 3300047320 Ga0495672_0397966 Ga0495672_0397966_124_540 138
314 3300047321 Ga0495676_0060197 Ga0495676_0060197_2094_2510 138
315 3300047322 Ga0495680_0439433 Ga0495680_0439433_404_820 138
316 3300047444 Ga0495675_0116825 Ga0495675_0116825_337_753 138
317 3300048091 Ga0495626_0404436 Ga0495626_0404436_32_448 138
318 3300048903 Ga0496100_0413791 Ga0496100_0413791_232_648 138
319 3300048907 Ga0496104_0399624 Ga0496104_0399624_265_687 138
320 3300048909 Ga0496106_0053866 Ga0496106_0053866_410_832 138
321 3300048909 Ga0496106_0506212 Ga0496106_0506212_287_703 138
322 3300048909 Ga0496106_0870874 Ga0496106_0870874_50_466 138
323 3300048910 Ga0496107_0009774 Ga0496107_0009774_141_563 138
324 3300048911 Ga0496108_0051741 Ga0496108_0051741_2728_3150 138
325 3300048912 Ga0496109_0122570 Ga0496109_0122570_1648_2070 138
326 3300048912 Ga0496109_1433743 Ga0496109_1433743_190_606 138
327 3300048914 Ga0496111_0669876 Ga0496111_0669876_111_533 138
328 3300048917 Ga0496114_0102995 Ga0496114_0102995_567_989 138
329 3300048921 Ga0496118_0123164 Ga0496118_0123164_490_906 138
330 3300048924 Ga0496121_0721253 Ga0496121_0721253_163_579 138
331 3300049589 Ga0501073_0094061 Ga0501073_0094061_850_1278 138
332 3300049591 Ga0501075_1040312 Ga0501075_1040312_152_568 138
333 3300050489 nmdc:mga03683_120013_c1 nmdc:mga03683_120013_c1_680_1096 138
334 3300050489 nmdc:mga03683_648_c1 nmdc:mga03683_648_c1_4574_4990 138
335 3300050490 nmdc:mga03n38_195728_c1 nmdc:mga03n38_195728_c1_450_866 138
336 3300050490 nmdc:mga03n38_891762_c1 nmdc:mga03n38_891762_c1_85_501 138
337 3300050491 nmdc:mga00v17_1021739_c1 nmdc:mga00v17_1021739_c1_26_442 138
338 3300050492 nmdc:mga0yw44_106066_c1 nmdc:mga0yw44_106066_c1_913_1329 138
339 3300050492 nmdc:mga0yw44_143915_c1 nmdc:mga0yw44_143915_c1_153_569 138
340 3300050492 nmdc:mga0yw44_712641_c1 nmdc:mga0yw44_712641_c1_253_669 138
341 3300050494 nmdc:mga06z11_116945_c1 nmdc:mga06z11_116945_c1_319_735 138
342 3300050494 nmdc:mga06z11_202779_c1 nmdc:mga06z11_202779_c1_498_914 138
343 3300050494 nmdc:mga06z11_61062_c1 nmdc:mga06z11_61062_c1_891_1307 138
344 3300050494 nmdc:mga06z11_618422_c1 nmdc:mga06z11_618422_c1_125_541 138
345 3300050495 nmdc:mga04h51_196692_c1 nmdc:mga04h51_196692_c1_229_645 138
346 3300050496 nmdc:mga07m45_13689_c2 nmdc:mga07m45_13689_c2_2100_2516 138
347 3300050496 nmdc:mga07m45_202614_c1 nmdc:mga07m45_202614_c1_680_1096 138
348 3300050511 nmdc:mga08y16_62_c1 nmdc:mga08y16_62_c1_31946_32362 138
349 3300050515 nmdc:mga0a205_1098247_c1 nmdc:mga0a205_1098247_c1_49_465 138
350 3300050516 nmdc:mga0sz30_111724_c1 nmdc:mga0sz30_111724_c1_385_801 138
351 3300050516 nmdc:mga0sz30_251196_c1 nmdc:mga0sz30_251196_c1_113_529 138
352 3300053092 Ga0500583_0239191 Ga0500583_0239191_343_783 138
353 3300053092 Ga0500583_0323074 Ga0500583_0323074_239_655 138
354 3300053093 Ga0500651_0057530 Ga0500651_0057530_1370_1786 138
355 3300053093 Ga0500651_0425681 Ga0500651_0425681_173_589 138
356 3300053093 Ga0500651_0769759 Ga0500651_0769759_46_462 138
357 3300053096 Ga0500641_0040790 Ga0500641_0040790_250_666 138
358 3300053096 Ga0500641_0312785 Ga0500641_0312785_92_529 138
359 3300053131 Ga0500652_012873 Ga0500652_012873_1030_1446 138
360 3300053134 Ga0500658_0035889 Ga0500658_0035889_672_1088 138
361 3300053142 Ga0500577_0018249 Ga0500577_0018249_1244_1660 138
362 3300053151 Ga0500604_0036680 Ga0500604_0036680_379_816 138
363 3300053153 Ga0500616_0000501 Ga0500616_0000501_2683_3099 138
364 3300053156 Ga0500622_0001755 Ga0500622_0001755_10550_10966 138
365 3300053727 Ga0500611_023543 Ga0500611_023543_626_1042 138
366 3300053730 Ga0500645_000385 Ga0500645_000385_8980_9396 138
367 3300059423 Ga0590074_096549 Ga0590074_096549_87_509 138
368 3300061734 Ga0530510_0545817 Ga0530510_0545817_162_578 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

38

129

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8906 1 138
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8466 1 138
3mry-assembly1.cif.gz_A crystal structure of type i ribosome inactivating protein from momordica balsamina with 6-aminopurine at 2.0a resolution 0.8464 59 87
3ctk-assembly1.cif.gz_A crystal structure of the type 1 rip bouganin 0.8443 59 88
3n1d-assembly1.cif.gz_A crystal structure of the complex of type i ribosome inactivating protein with ribose at 1.7a resolution 0.8398 59 86
ID Description Score Start End Superfamily
3ctkA01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.8443 59 88 3.40.420.10
1ahbA01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.8339 59 86 3.40.420.10
af_A0A1D6EGE5_12_199_3.40.420.10 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.8307 58 87 3.40.420.10
4hr6B01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.83 58 89 3.40.420.10
3ku0B01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.8244 59 88 3.40.420.10
ID Description Score Start End GO Terms
AF-A0A526YI44-F1-model_v4 GFA family protein 0.981 5 93 GO:0016846
GO:0046872
AF-A0A2P2DRP6-F1-model_v4 deleted 0.9805 38 138
AF-A0A3S3RGJ6-F1-model_v4 GFA family protein 0.9802 5 113 GO:0016846
GO:0046872
AF-A0A2A4LHA9-F1-model_v4 Aldehyde-activating protein 0.9791 4 128 GO:0016846
GO:0046872
AF-A0A315EL79-F1-model_v4 Aldehyde-activating protein 0.9784 6 138 GO:0016846
GO:0046872

Feature Viewer

pLDDT pTM Quality
91.67 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map