F424683

General Info

Members Datasets Scaffolds Average Seq Length
368 208 736 218

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10929480|Ga0114129_109294802
Length 244
Sequence MRGSVPLGRLAAALLLAGSLALVLSTGASAGRECDGLDVCVSVPGPWVVVPAGPAGKREPTYYQLTCPRRYVVAGLDAVVSNRGIHVEFLGSLGSPVNPGITTSTSVVFAATPTSAGPASFQPLIGCIPTSGGGRGTTSVGSRLPQAVPVGRPAIRRVRTVRLRPGTSRVLRQGCRRGEHLVSSSSAVAFGSRSEPSAALITAVSATTRVKGGEVVVRVKVPATVPRSSRPEVQIHALCARGRA

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
108 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
111 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
123 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
124 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
125 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
138 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
150 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
204 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 1.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 8.97
Rhizosphere 90.76
Stem 0
Stem Tuber 0
Unclassified 9.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10929480 3300009147 Unclassified 1100
2 Ga0070658_10007377 3300005327 Bacteria 8885
3 Ga0070658_10013970 3300005327 Bacteria 6446
4 Ga0070658_10031258 3300005327 Bacteria 4275
5 Ga0070683_100008669 3300005329 Bacteria 8643
6 Ga0070683_100110005 3300005329 Bacteria 2599
7 Ga0070670_100019798 3300005331 Bacteria 5777
8 Ga0070670_100151822 3300005331 Bacteria 2005
9 Ga0070680_100199244 3300005336 Bacteria 1688
10 Ga0070680_100663941 3300005336 Unclassified 896
11 Ga0068868_100350005 3300005338 Bacteria 1265
12 Ga0070660_100004331 3300005339 Bacteria 9801
13 Ga0070660_100230942 3300005339 Bacteria 1505
14 Ga0070691_10066352 3300005341 Bacteria 1744
15 Ga0070661_100016922 3300005344 Bacteria 5163
16 Ga0070675_100004854 3300005354 Bacteria 10259
17 Ga0070674_100004012 3300005356 Bacteria 8342
18 Ga0070688_100035102 3300005365 Bacteria 3044
19 Ga0070659_100499809 3300005366 Bacteria 1036
20 Ga0070667_100477135 3300005367 Bacteria 1141
21 Ga0070709_10064644 3300005434 Unclassified 2340
22 Ga0070714_100013442 3300005435 Bacteria 6560
23 Ga0070714_100020705 3300005435 Bacteria 5376
24 Ga0070714_100048399 3300005435 Bacteria 3616
25 Ga0070714_100576617 3300005435 Bacteria 1079
26 Ga0070714_101024674 3300005435 Unclassified 803
27 Ga0070701_10004570 3300005438 Bacteria 5628
28 Ga0070711_100574981 3300005439 Bacteria 937
29 Ga0070700_100046751 3300005441 Bacteria 2675
30 Ga0070700_100426843 3300005441 Unclassified 1003
31 Ga0070678_100008698 3300005456 Bacteria 6094
32 Ga0070678_100486284 3300005456 Bacteria 1087
33 Ga0070681_10025617 3300005458 Bacteria 5933
34 Ga0070685_10015295 3300005466 Bacteria 4074
35 Ga0070706_100422491 3300005467 Bacteria 1241
36 Ga0070707_100044769 3300005468 Bacteria 4237
37 Ga0070698_100079944 3300005471 Bacteria 3265
38 Ga0070699_100093940 3300005518 Bacteria 2625
39 Ga0070699_100182666 3300005518 Bacteria 1862
40 Ga0070699_100410538 3300005518 Bacteria 1225
41 Ga0070679_100036424 3300005530 Bacteria 4882
42 Ga0070679_100048026 3300005530 Bacteria 4254
43 Ga0070679_100080790 3300005530 Bacteria 3241
44 Ga0070684_100097619 3300005535 Bacteria 2620
45 Ga0070684_100497290 3300005535 Unclassified 1129
46 Ga0070684_100734349 3300005535 Bacteria 921
47 Ga0070684_100742861 3300005535 Unclassified 916
48 Ga0070672_100016132 3300005543 Bacteria 5344
49 Ga0070686_100078148 3300005544 Bacteria 2184
50 Ga0070665_100052257 3300005548 Bacteria 4099
51 Ga0070704_100425366 3300005549 Bacteria 1138
52 Ga0070704_100986775 3300005549 Bacteria 761
53 Ga0068855_100156176 3300005563 Bacteria 2592
54 Ga0068855_100803563 3300005563 Bacteria 999
55 Ga0068857_100318018 3300005577 Bacteria 1437
56 Ga0070702_100067086 3300005615 Bacteria 2106
57 Ga0068852_100159215 3300005616 Unclassified 2106
58 Ga0068864_100024541 3300005618 Bacteria 5073
59 Ga0068870_10001467 3300005840 Bacteria 9550
60 Ga0068862_100390414 3300005844 Bacteria 1300
61 Ga0081455_10001448 3300005937 Bacteria 29359
62 Ga0081455_10001979 3300005937 Bacteria 24466
63 Ga0081455_10073916 3300005937 Bacteria 2817
64 Ga0081538_10017785 3300005981 Bacteria 5374
65 Ga0081538_10028156 3300005981 Bacteria 3873
66 Ga0075365_10062877 3300006038 Bacteria 2484
67 Ga0070712_100007907 3300006175 Bacteria 6667
68 Ga0070712_100057491 3300006175 Unclassified 2733
69 Ga0097621_100493489 3300006237 Bacteria 1108
70 Ga0075428_100008822 3300006844 Bacteria 11189
71 Ga0075428_100106865 3300006844 Bacteria 3051
72 Ga0075430_100002824 3300006846 Bacteria 14529
73 Ga0075431_100005512 3300006847 Bacteria 12499
74 Ga0075431_100156935 3300006847 Bacteria 2341
75 Ga0075433_10126805 3300006852 Bacteria 2267
76 Ga0075434_100008363 3300006871 Bacteria 9618
77 Ga0075434_100329991 3300006871 Bacteria 1546
78 Ga0075429_100072767 3300006880 Bacteria 2993
79 Ga0068865_100011322 3300006881 Bacteria 5578
80 Ga0068865_100018967 3300006881 Bacteria 4447
81 Ga0075436_100236131 3300006914 Bacteria 1299
82 Ga0075435_100020070 3300007076 Bacteria 5111
83 Ga0105240_10264182 3300009093 Bacteria 1984
84 Ga0105240_10345613 3300009093 Bacteria 1689
85 Ga0111539_10009759 3300009094 Bacteria 12114
86 Ga0111539_10130891 3300009094 Unclassified 2938
87 Ga0111539_10238375 3300009094 Bacteria 2117
88 Ga0111539_10318589 3300009094 Unclassified 1810
89 Ga0105245_10053467 3300009098 Bacteria 3625
90 Ga0114129_10051597 3300009147 Bacteria 5774
91 Ga0114129_10119666 3300009147 Bacteria 3627
92 Ga0114129_10231021 3300009147 Bacteria 2491
93 Ga0114129_10352379 3300009147 Bacteria 1949
94 Ga0114129_10488377 3300009147 Bacteria 1610
95 Ga0114129_11348192 3300009147 Bacteria 882
96 Ga0105243_10021088 3300009148 Bacteria 4945
97 Ga0105242_10045335 3300009176 Bacteria 3563
98 Ga0105242_10308959 3300009176 Bacteria 1446
99 Ga0105242_10358550 3300009176 Bacteria 1349
100 Ga0105248_10215904 3300009177 Bacteria 2160
101 Ga0105249_11045987 3300009553 Bacteria 886
102 Ga0105246_10038110 3300011119 Bacteria 3230
103 Ga0105246_10049541 3300011119 Bacteria 2877
104 Ga0157370_10158726 3300013104 Bacteria 2105
105 Ga0157370_10166755 3300013104 Bacteria 2048
106 Ga0157369_10033755 3300013105 Bacteria 5620
107 Ga0157372_10316843 3300013307 Bacteria 1816
108 Ga0157375_10019170 3300013308 Bacteria 6215
109 Ga0182008_10001963 3300014497 Bacteria 13209
110 Ga0157377_10000567 3300014745 Bacteria 15510
111 Ga0157376_10040105 3300014969 Bacteria 3825
112 Ga0182007_10052265 3300015262 Unclassified 1347
113 Ga0197907_10802273 3300020069 Bacteria 1770
114 Ga0206356_11022326 3300020070 Bacteria 2285
115 Ga0206354_11567907 3300020081 Bacteria 2714
116 Ga0206353_11365756 3300020082 Bacteria 3720
117 Ga0207688_10024121 3300025901 Bacteria 3335
118 Ga0207645_10088672 3300025907 Bacteria 1989
119 Ga0207643_10004402 3300025908 Bacteria 7577
120 Ga0207705_10031100 3300025909 Bacteria 3809
121 Ga0207705_10036381 3300025909 Bacteria 3524
122 Ga0207707_10056231 3300025912 Bacteria 3423
123 Ga0207693_10025962 3300025915 Bacteria 4640
124 Ga0207693_10052748 3300025915 Unclassified 3190
125 Ga0207660_10478639 3300025917 Bacteria 1009
126 Ga0207657_10015104 3300025919 Bacteria 7499
127 Ga0207657_10018326 3300025919 Bacteria 6688
128 Ga0207652_10036310 3300025921 Bacteria 4166
129 Ga0207646_10067139 3300025922 Bacteria 3202
130 Ga0207681_10140324 3300025923 Bacteria 1799
131 Ga0207650_10073453 3300025925 Unclassified 2576
132 Ga0207650_10101969 3300025925 Bacteria 2210
133 Ga0207659_10544505 3300025926 Bacteria 986
134 Ga0207664_10197820 3300025929 Bacteria 1733
135 Ga0207664_10274828 3300025929 Bacteria 1477
136 Ga0207664_10673545 3300025929 Bacteria 930
137 Ga0207644_10089590 3300025931 Bacteria 2290
138 Ga0207644_10604620 3300025931 Archaea 911
139 Ga0207706_10348852 3300025933 Bacteria 1287
140 Ga0207686_10067917 3300025934 Unclassified 2282
141 Ga0207686_10211615 3300025934 Bacteria 1394
142 Ga0207709_10511501 3300025935 Bacteria 939
143 Ga0207670_10104199 3300025936 Bacteria 2031
144 Ga0207669_10024439 3300025937 Bacteria 3247
145 Ga0207669_10233958 3300025937 Bacteria 1357
146 Ga0207711_10520571 3300025941 Bacteria 1109
147 Ga0207689_10262713 3300025942 Bacteria 1428
148 Ga0207661_10037531 3300025944 Bacteria 3790
149 Ga0207661_10082099 3300025944 Bacteria 2664
150 Ga0207661_10095128 3300025944 Bacteria 2490
151 Ga0207661_10195013 3300025944 Bacteria 1778
152 Ga0207667_10314638 3300025949 Bacteria 1599
153 Ga0207667_10705406 3300025949 Bacteria 1011
154 Ga0207651_10088477 3300025960 Bacteria 2258
155 Ga0207668_10348179 3300025972 Bacteria 1238
156 Ga0207678_10069769 3300026067 Unclassified 3013
157 Ga0207708_10003190 3300026075 Bacteria 12081
158 Ga0207708_10258827 3300026075 Bacteria 1404
159 Ga0207702_10184408 3300026078 Bacteria 1924
160 Ga0207676_10092076 3300026095 Bacteria 2492
161 Ga0207674_10212437 3300026116 Bacteria 1884
162 Ga0207683_10024005 3300026121 Bacteria 5247
163 Ga0207683_10039444 3300026121 Bacteria 4120
164 Ga0207428_10420029 3300027907 Bacteria 978
165 Ga0265319_1050008 3300028563 Unclassified 1382
166 Ga0265318_10027726 3300028577 Bacteria 2223
167 Ga0265338_10089747 3300028800 Bacteria 2546
168 Ga0265338_10472162 3300028800 Bacteria 886
169 Ga0265320_10115429 3300031240 Bacteria 1228
170 Ga0265342_10023180 3300031712 Bacteria 3934
171 Ga0307416_100183872 3300032002 Bacteria 1962
172 Ga0373933_0152346 3300035724 Bacteria 1465
173 Ga0373937_0306649 3300036401 Bacteria 1501
174 Ga0373937_0675558 3300036401 Bacteria 979
175 Ga0395899_0003808 3300037312 Bacteria 11913
176 Ga0395899_0245063 3300037312 Bacteria 1232
177 Ga0395899_0455351 3300037312 Unclassified 837
178 Ga0395900_0015254 3300037418 Bacteria 7835
179 Ga0395900_0218786 3300037418 Bacteria 1921
180 Ga0395900_0301664 3300037418 Bacteria 1588
181 Ga0395900_0585657 3300037418 Unclassified 1057
182 Ga0395898_0010653 3300037466 Bacteria 9604
183 Ga0395898_0223043 3300037466 Bacteria 1798
184 Ga0395898_0235149 3300037466 Bacteria 1747
185 Ga0395905_0004780 3300037471 Bacteria 13992
186 Ga0395905_0118468 3300037471 Bacteria 2489
187 Ga0395901_0020132 3300038443 Bacteria 6827
188 Ga0395901_0022311 3300038443 Bacteria 6488
189 Ga0395901_0231237 3300038443 Bacteria 1930
190 Ga0395901_0582836 3300038443 Bacteria 1130
191 Ga0436360_0912514 3300039438 Bacteria 5967
192 Ga0436362_0030657 3300039453 Bacteria 1747
193 Ga0439453_0003011 3300041408 Bacteria 2382
194 Ga0439450_019098 3300042008 Unclassified 1448
195 Ga0439454_043031 3300042011 Unclassified 744
196 Ga0439460_0089402 3300042461 Bacteria 977
197 Ga0466961_0390246 3300044693 Bacteria 845
198 Ga0466963_0009964 3300044694 Bacteria 5742
199 Ga0466963_0013538 3300044694 Bacteria 5010
200 Ga0466963_0059878 3300044694 Unclassified 2542
201 Ga0466963_0069095 3300044694 Unclassified 2373
202 Ga0466963_0080045 3300044694 Bacteria 2211
203 Ga0466963_0087273 3300044694 Bacteria 2121
204 Ga0466964_0004784 3300044706 Bacteria 5007
205 Ga0466964_0007097 3300044706 Bacteria 4190
206 Ga0466964_0016287 3300044706 Bacteria 2837
207 Ga0466968_0187246 3300044735 Bacteria 965
208 Ga0466957_0094701 3300044842 Unclassified 1875
209 Ga0466959_0069718 3300045049 Bacteria 2547
210 Ga0466958_0010600 3300045836 Bacteria 5166
211 Ga0466958_0092401 3300045836 Unclassified 1873
212 Ga0466967_0005827 3300045976 Bacteria 8621
213 Ga0466967_0010587 3300045976 Bacteria 6929
214 Ga0466967_0032293 3300045976 Bacteria 4418
215 Ga0466967_0036631 3300045976 Bacteria 4190
216 Ga0466967_0106582 3300045976 Bacteria 2569
217 Ga0466967_0216231 3300045976 Unclassified 1819
218 Ga0466967_0217141 3300045976 Bacteria 1815
219 Ga0466967_0277168 3300045976 Bacteria 1608
220 Ga0495592_0168535 3300046454 Bacteria 1501
221 Ga0495592_0192928 3300046454 Bacteria 1379
222 Ga0495651_0105357 3300046462 Bacteria 2092
223 Ga0495651_0140559 3300046462 Bacteria 1751
224 Ga0495651_0198324 3300046462 Bacteria 1407
225 Ga0495651_0244106 3300046462 Bacteria 1230
226 Ga0495653_0083006 3300046463 Bacteria 2364
227 Ga0495653_0113329 3300046463 Bacteria 1945
228 Ga0495664_0018130 3300046477 Bacteria 4027
229 Ga0495608_0120494 3300046511 Bacteria 1683
230 Ga0495618_0122167 3300046514 Bacteria 1668
231 Ga0495630_0415483 3300046517 Bacteria 1031
232 Ga0495652_0374468 3300046529 Bacteria 1014
233 Ga0495586_0331434 3300046535 Bacteria 873
234 Ga0495587_0082392 3300046536 Bacteria 1864
235 Ga0495667_0094273 3300046559 Bacteria 1938
236 Ga0495667_0267745 3300046559 Bacteria 1086
237 Ga0495656_0142209 3300046615 Bacteria 1152
238 Ga0495634_0150136 3300046642 Bacteria 1474
239 Ga0495635_0016427 3300046663 Bacteria 5170
240 Ga0495657_0095794 3300046675 Bacteria 1897
241 Ga0495657_0173109 3300046675 Bacteria 1328
242 Ga0495623_0048639 3300046679 Bacteria 2689
243 Ga0495649_0066086 3300046694 Bacteria 1941
244 Ga0495600_0155916 3300046809 Bacteria 1477
245 Ga0495600_0406688 3300046809 Unclassified 846
246 Ga0495680_0040636 3300047322 Bacteria 3704
247 Ga0495684_0058212 3300047471 Bacteria 2944
248 Ga0495602_0203762 3300048088 Bacteria 1507
249 Ga0495602_0368231 3300048088 Bacteria 1033
250 Ga0496101_0306907 3300048904 Bacteria 1244
251 Ga0496102_0086996 3300048905 Bacteria 2887
252 Ga0496104_0000966 3300048907 Bacteria 24722
253 Ga0496104_0037536 3300048907 Bacteria 4531
254 Ga0496104_0087425 3300048907 Bacteria 2977
255 Ga0496105_0001396 3300048908 Bacteria 16959
256 Ga0496105_0077600 3300048908 Bacteria 2743
257 Ga0496105_0110335 3300048908 Bacteria 2271
258 Ga0496106_0040965 3300048909 Bacteria 3470
259 Ga0496106_0239172 3300048909 Bacteria 1451
260 Ga0496107_0087047 3300048910 Bacteria 2281
261 Ga0496108_0017327 3300048911 Bacteria 5892
262 Ga0496108_0036976 3300048911 Bacteria 4065
263 Ga0496108_0356729 3300048911 Bacteria 1276
264 Ga0496109_0047837 3300048912 Bacteria 3890
265 Ga0496109_0072898 3300048912 Bacteria 3155
266 Ga0496109_0152835 3300048912 Bacteria 2161
267 Ga0496110_0045857 3300048913 Bacteria 3822
268 Ga0496110_0110123 3300048913 Bacteria 2474
269 Ga0496110_0294796 3300048913 Bacteria 1477
270 Ga0496110_0448175 3300048913 Bacteria 1176
271 Ga0496111_0002472 3300048914 Bacteria 11152
272 Ga0496111_0024017 3300048914 Bacteria 4287
273 Ga0496112_0034341 3300048915 Bacteria 4936
274 Ga0496112_0086495 3300048915 Bacteria 3101
275 Ga0496112_0128746 3300048915 Bacteria 2502
276 Ga0496112_0237503 3300048915 Bacteria 1776
277 Ga0496113_0026818 3300048916 Bacteria 4124
278 Ga0496113_0081654 3300048916 Bacteria 2478
279 Ga0496113_0299392 3300048916 Bacteria 1288
280 Ga0496113_0433370 3300048916 Bacteria 1056
281 Ga0496114_0073844 3300048917 Bacteria 2871
282 Ga0496114_0077515 3300048917 Bacteria 2802
283 Ga0501031_0010305 3300049568 Bacteria 6088
284 Ga0501033_0005477 3300049570 Bacteria 10051
285 Ga0501034_0002607 3300049571 Bacteria 21420
286 Ga0501036_0061810 3300049572 Bacteria 3172
287 Ga0501037_0013440 3300049573 Bacteria 6030
288 Ga0501037_0423732 3300049573 Unclassified 911
289 Ga0501038_0006312 3300049574 Bacteria 10965
290 Ga0501039_0013757 3300049575 Bacteria 6190
291 Ga0501040_0001485 3300049576 Bacteria 14887
292 Ga0501040_0085375 3300049576 Bacteria 2191
293 Ga0501041_0000603 3300049577 Bacteria 18831
294 Ga0501041_0401164 3300049577 Bacteria 869
295 Ga0501042_0004647 3300049578 Bacteria 8764
296 Ga0501042_0122609 3300049578 Bacteria 1872
297 Ga0501046_0014089 3300049580 Bacteria 6752
298 Ga0501047_0137895 3300049581 Bacteria 2319
299 Ga0501048_0005916 3300049582 Bacteria 9313
300 Ga0501067_0054267 3300049583 Bacteria 2220
301 Ga0501067_0064635 3300049583 Unclassified 2025
302 Ga0501067_0075093 3300049583 Bacteria 1873
303 Ga0501067_0083860 3300049583 Bacteria 1768
304 Ga0501067_0204333 3300049583 Unclassified 1100
305 Ga0501067_0242501 3300049583 Bacteria 1003
306 Ga0501068_0001721 3300049584 Bacteria 11645
307 Ga0501069_0027163 3300049585 Bacteria 3136
308 Ga0501069_0037291 3300049585 Bacteria 2682
309 Ga0501069_0086263 3300049585 Bacteria 1772
310 Ga0501070_0004230 3300049586 Bacteria 12345
311 Ga0501070_0009939 3300049586 Bacteria 8045
312 Ga0501070_0050242 3300049586 Bacteria 3462
313 Ga0501071_0023381 3300049587 Bacteria 4315
314 Ga0501071_0419334 3300049587 Bacteria 1023
315 Ga0501072_0003754 3300049588 Bacteria 11461
316 Ga0501072_0019869 3300049588 Bacteria 5198
317 Ga0501074_0115652 3300049590 Unclassified 1919
318 Ga0501074_0162804 3300049590 Bacteria 1593
319 Ga0501074_0228798 3300049590 Bacteria 1324
320 Ga0501075_0048707 3300049591 Bacteria 3184
321 Ga0501076_0005174 3300049592 Bacteria 9337
322 Ga0501076_0050141 3300049592 Bacteria 3302
323 Ga0501076_0118788 3300049592 Bacteria 2141
324 Ga0501076_0358616 3300049592 Bacteria 1198
325 Ga0501077_0002710 3300049593 Bacteria 10617
326 Ga0501077_0004980 3300049593 Bacteria 8053
327 Ga0501077_0124261 3300049593 Unclassified 1636
328 Ga0501077_0172712 3300049593 Bacteria 1373
329 Ga0501079_0012390 3300049741 Bacteria 6506
330 Ga0501079_0067087 3300049741 Bacteria 2769
331 Ga0501079_0150564 3300049741 Bacteria 1814
332 Ga0501080_0003342 3300049742 Bacteria 14169
333 Ga0501080_0003767 3300049742 Bacteria 13392
334 Ga0501080_0364419 3300049742 Unclassified 1304
335 Ga0501081_0000959 3300049743 Bacteria 17151
336 Ga0501081_0143564 3300049743 Bacteria 1712
337 Ga0501081_0520441 3300049743 Bacteria 887
338 Ga0501083_0000852 3300049744 Bacteria 20067
339 Ga0501083_0006198 3300049744 Bacteria 8484
340 Ga0501035_0033379 3300049822 Bacteria 4681
341 Ga0501045_0001335 3300049824 Bacteria 16354
342 nmdc:mga05p37_1104034_c1 3300050507 Bacteria 830
343 nmdc:mga05p37_120373_c1 3300050507 Bacteria 3225
344 nmdc:mga05p37_281445_c1 3300050507 Unclassified 1983
345 nmdc:mga05p37_30409_c1 3300050507 Bacteria 6590
346 nmdc:mga05p37_65543_c1 3300050507 Bacteria 4468
347 nmdc:mga05p37_90018_c1 3300050507 Bacteria 3782
348 nmdc:mga09592_115057_c1 3300050508 Bacteria 2309
349 nmdc:mga06r32_119155_c1 3300050510 Bacteria 2602
350 nmdc:mga06r32_12732_c1 3300050510 Bacteria 7604
351 nmdc:mga08y16_48689_c1 3300050511 Bacteria 4435
352 nmdc:mga0rr50_26727_c1 3300050513 Bacteria 4032
353 nmdc:mga08x19_179348_c1 3300050514 Bacteria 1445
354 Ga0495601_0092819 3300053077 Bacteria 1944
355 Ga0495595_0001874 3300053084 Bacteria 8160
356 Ga0495595_0065562 3300053084 Bacteria 1708
357 Ga0495619_0058778 3300053085 Bacteria 2553
358 Ga0495619_0097761 3300053085 Bacteria 1995
359 Ga0501084_0007214 3300054114 Bacteria 9159
360 Ga0501084_0126561 3300054114 Unclassified 2150
361 Ga0501082_0003967 3300060353 Bacteria 12921
362 Ga0501082_0489533 3300060353 Bacteria 1075
363 Ga0501082_0664836 3300060353 Bacteria 912
364 Ga0530510_0002750 3300061734 Bacteria 12088
365 Ga0530510_0066783 3300061734 Bacteria 2609
366 Ga0530510_0123203 3300061734 Bacteria 1904
367 Ga0530510_0235349 3300061734 Bacteria 1363
368 Ga0530510_0293977 3300061734 Unclassified 1215
369 Ga0114129_10929480
370 Ga0070658_10007377
371 Ga0070658_10013970
372 Ga0070658_10031258
373 Ga0070683_100008669
374 Ga0070683_100110005
375 Ga0070670_100019798
376 Ga0070670_100151822
377 Ga0070680_100199244
378 Ga0070680_100663941
379 Ga0068868_100350005
380 Ga0070660_100004331
381 Ga0070660_100230942
382 Ga0070691_10066352
383 Ga0070661_100016922
384 Ga0070675_100004854
385 Ga0070674_100004012
386 Ga0070688_100035102
387 Ga0070659_100499809
388 Ga0070667_100477135
389 Ga0070709_10064644
390 Ga0070714_100013442
391 Ga0070714_100020705
392 Ga0070714_100048399
393 Ga0070714_100576617
394 Ga0070714_101024674
395 Ga0070701_10004570
396 Ga0070711_100574981
397 Ga0070700_100046751
398 Ga0070700_100426843
399 Ga0070678_100008698
400 Ga0070678_100486284
401 Ga0070681_10025617
402 Ga0070685_10015295
403 Ga0070706_100422491
404 Ga0070707_100044769
405 Ga0070698_100079944
406 Ga0070699_100093940
407 Ga0070699_100182666
408 Ga0070699_100410538
409 Ga0070679_100036424
410 Ga0070679_100048026
411 Ga0070679_100080790
412 Ga0070684_100097619
413 Ga0070684_100497290
414 Ga0070684_100734349
415 Ga0070684_100742861
416 Ga0070672_100016132
417 Ga0070686_100078148
418 Ga0070665_100052257
419 Ga0070704_100425366
420 Ga0070704_100986775
421 Ga0068855_100156176
422 Ga0068855_100803563
423 Ga0068857_100318018
424 Ga0070702_100067086
425 Ga0068852_100159215
426 Ga0068864_100024541
427 Ga0068870_10001467
428 Ga0068862_100390414
429 Ga0081455_10001448
430 Ga0081455_10001979
431 Ga0081455_10073916
432 Ga0081538_10017785
433 Ga0081538_10028156
434 Ga0075365_10062877
435 Ga0070712_100007907
436 Ga0070712_100057491
437 Ga0097621_100493489
438 Ga0075428_100008822
439 Ga0075428_100106865
440 Ga0075430_100002824
441 Ga0075431_100005512
442 Ga0075431_100156935
443 Ga0075433_10126805
444 Ga0075434_100008363
445 Ga0075434_100329991
446 Ga0075429_100072767
447 Ga0068865_100011322
448 Ga0068865_100018967
449 Ga0075436_100236131
450 Ga0075435_100020070
451 Ga0105240_10264182
452 Ga0105240_10345613
453 Ga0111539_10009759
454 Ga0111539_10130891
455 Ga0111539_10238375
456 Ga0111539_10318589
457 Ga0105245_10053467
458 Ga0114129_10051597
459 Ga0114129_10119666
460 Ga0114129_10231021
461 Ga0114129_10352379
462 Ga0114129_10488377
463 Ga0114129_11348192
464 Ga0105243_10021088
465 Ga0105242_10045335
466 Ga0105242_10308959
467 Ga0105242_10358550
468 Ga0105248_10215904
469 Ga0105249_11045987
470 Ga0105246_10038110
471 Ga0105246_10049541
472 Ga0157370_10158726
473 Ga0157370_10166755
474 Ga0157369_10033755
475 Ga0157372_10316843
476 Ga0157375_10019170
477 Ga0182008_10001963
478 Ga0157377_10000567
479 Ga0157376_10040105
480 Ga0182007_10052265
481 Ga0197907_10802273
482 Ga0206356_11022326
483 Ga0206354_11567907
484 Ga0206353_11365756
485 Ga0207688_10024121
486 Ga0207645_10088672
487 Ga0207643_10004402
488 Ga0207705_10031100
489 Ga0207705_10036381
490 Ga0207707_10056231
491 Ga0207693_10025962
492 Ga0207693_10052748
493 Ga0207660_10478639
494 Ga0207657_10015104
495 Ga0207657_10018326
496 Ga0207652_10036310
497 Ga0207646_10067139
498 Ga0207681_10140324
499 Ga0207650_10073453
500 Ga0207650_10101969
501 Ga0207659_10544505
502 Ga0207664_10197820
503 Ga0207664_10274828
504 Ga0207664_10673545
505 Ga0207644_10089590
506 Ga0207644_10604620
507 Ga0207706_10348852
508 Ga0207686_10067917
509 Ga0207686_10211615
510 Ga0207709_10511501
511 Ga0207670_10104199
512 Ga0207669_10024439
513 Ga0207669_10233958
514 Ga0207711_10520571
515 Ga0207689_10262713
516 Ga0207661_10037531
517 Ga0207661_10082099
518 Ga0207661_10095128
519 Ga0207661_10195013
520 Ga0207667_10314638
521 Ga0207667_10705406
522 Ga0207651_10088477
523 Ga0207668_10348179
524 Ga0207678_10069769
525 Ga0207708_10003190
526 Ga0207708_10258827
527 Ga0207702_10184408
528 Ga0207676_10092076
529 Ga0207674_10212437
530 Ga0207683_10024005
531 Ga0207683_10039444
532 Ga0207428_10420029
533 Ga0265319_1050008
534 Ga0265318_10027726
535 Ga0265338_10089747
536 Ga0265338_10472162
537 Ga0265320_10115429
538 Ga0265342_10023180
539 Ga0307416_100183872
540 Ga0373933_0152346
541 Ga0373937_0306649
542 Ga0373937_0675558
543 Ga0395899_0003808
544 Ga0395899_0245063
545 Ga0395899_0455351
546 Ga0395900_0015254
547 Ga0395900_0218786
548 Ga0395900_0301664
549 Ga0395900_0585657
550 Ga0395898_0010653
551 Ga0395898_0223043
552 Ga0395898_0235149
553 Ga0395905_0004780
554 Ga0395905_0118468
555 Ga0395901_0020132
556 Ga0395901_0022311
557 Ga0395901_0231237
558 Ga0395901_0582836
559 Ga0436360_0912514
560 Ga0436362_0030657
561 Ga0439453_0003011
562 Ga0439450_019098
563 Ga0439454_043031
564 Ga0439460_0089402
565 Ga0466961_0390246
566 Ga0466963_0009964
567 Ga0466963_0013538
568 Ga0466963_0059878
569 Ga0466963_0069095
570 Ga0466963_0080045
571 Ga0466963_0087273
572 Ga0466964_0004784
573 Ga0466964_0007097
574 Ga0466964_0016287
575 Ga0466968_0187246
576 Ga0466957_0094701
577 Ga0466959_0069718
578 Ga0466958_0010600
579 Ga0466958_0092401
580 Ga0466967_0005827
581 Ga0466967_0010587
582 Ga0466967_0032293
583 Ga0466967_0036631
584 Ga0466967_0106582
585 Ga0466967_0216231
586 Ga0466967_0217141
587 Ga0466967_0277168
588 Ga0495592_0168535
589 Ga0495592_0192928
590 Ga0495651_0105357
591 Ga0495651_0140559
592 Ga0495651_0198324
593 Ga0495651_0244106
594 Ga0495653_0083006
595 Ga0495653_0113329
596 Ga0495664_0018130
597 Ga0495608_0120494
598 Ga0495618_0122167
599 Ga0495630_0415483
600 Ga0495652_0374468
601 Ga0495586_0331434
602 Ga0495587_0082392
603 Ga0495667_0094273
604 Ga0495667_0267745
605 Ga0495656_0142209
606 Ga0495634_0150136
607 Ga0495635_0016427
608 Ga0495657_0095794
609 Ga0495657_0173109
610 Ga0495623_0048639
611 Ga0495649_0066086
612 Ga0495600_0155916
613 Ga0495600_0406688
614 Ga0495680_0040636
615 Ga0495684_0058212
616 Ga0495602_0203762
617 Ga0495602_0368231
618 Ga0496101_0306907
619 Ga0496102_0086996
620 Ga0496104_0000966
621 Ga0496104_0037536
622 Ga0496104_0087425
623 Ga0496105_0001396
624 Ga0496105_0077600
625 Ga0496105_0110335
626 Ga0496106_0040965
627 Ga0496106_0239172
628 Ga0496107_0087047
629 Ga0496108_0017327
630 Ga0496108_0036976
631 Ga0496108_0356729
632 Ga0496109_0047837
633 Ga0496109_0072898
634 Ga0496109_0152835
635 Ga0496110_0045857
636 Ga0496110_0110123
637 Ga0496110_0294796
638 Ga0496110_0448175
639 Ga0496111_0002472
640 Ga0496111_0024017
641 Ga0496112_0034341
642 Ga0496112_0086495
643 Ga0496112_0128746
644 Ga0496112_0237503
645 Ga0496113_0026818
646 Ga0496113_0081654
647 Ga0496113_0299392
648 Ga0496113_0433370
649 Ga0496114_0073844
650 Ga0496114_0077515
651 Ga0501031_0010305
652 Ga0501033_0005477
653 Ga0501034_0002607
654 Ga0501036_0061810
655 Ga0501037_0013440
656 Ga0501037_0423732
657 Ga0501038_0006312
658 Ga0501039_0013757
659 Ga0501040_0001485
660 Ga0501040_0085375
661 Ga0501041_0000603
662 Ga0501041_0401164
663 Ga0501042_0004647
664 Ga0501042_0122609
665 Ga0501046_0014089
666 Ga0501047_0137895
667 Ga0501048_0005916
668 Ga0501067_0054267
669 Ga0501067_0064635
670 Ga0501067_0075093
671 Ga0501067_0083860
672 Ga0501067_0204333
673 Ga0501067_0242501
674 Ga0501068_0001721
675 Ga0501069_0027163
676 Ga0501069_0037291
677 Ga0501069_0086263
678 Ga0501070_0004230
679 Ga0501070_0009939
680 Ga0501070_0050242
681 Ga0501071_0023381
682 Ga0501071_0419334
683 Ga0501072_0003754
684 Ga0501072_0019869
685 Ga0501074_0115652
686 Ga0501074_0162804
687 Ga0501074_0228798
688 Ga0501075_0048707
689 Ga0501076_0005174
690 Ga0501076_0050141
691 Ga0501076_0118788
692 Ga0501076_0358616
693 Ga0501077_0002710
694 Ga0501077_0004980
695 Ga0501077_0124261
696 Ga0501077_0172712
697 Ga0501079_0012390
698 Ga0501079_0067087
699 Ga0501079_0150564
700 Ga0501080_0003342
701 Ga0501080_0003767
702 Ga0501080_0364419
703 Ga0501081_0000959
704 Ga0501081_0143564
705 Ga0501081_0520441
706 Ga0501083_0000852
707 Ga0501083_0006198
708 Ga0501035_0033379
709 Ga0501045_0001335
710 nmdc:mga05p37_1104034_c1
711 nmdc:mga05p37_120373_c1
712 nmdc:mga05p37_281445_c1
713 nmdc:mga05p37_30409_c1
714 nmdc:mga05p37_65543_c1
715 nmdc:mga05p37_90018_c1
716 nmdc:mga09592_115057_c1
717 nmdc:mga06r32_119155_c1
718 nmdc:mga06r32_12732_c1
719 nmdc:mga08y16_48689_c1
720 nmdc:mga0rr50_26727_c1
721 nmdc:mga08x19_179348_c1
722 Ga0495601_0092819
723 Ga0495595_0001874
724 Ga0495595_0065562
725 Ga0495619_0058778
726 Ga0495619_0097761
727 Ga0501084_0007214
728 Ga0501084_0126561
729 Ga0501082_0003967
730 Ga0501082_0489533
731 Ga0501082_0664836
732 Ga0530510_0002750
733 Ga0530510_0066783
734 Ga0530510_0123203
735 Ga0530510_0235349
736 Ga0530510_0293977

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m48-assembly1.cif.gz_A crystal structure of pilus adhesin, spac from lactobacillus rhamnosus gg - p21212 form 0.6377 150 222
5zhv-assembly1.cif.gz_B crystal structure of the padr-family transcriptional regulator rv3488 of mycobacterium tuberculosis h37rv in complex with zinc ion 0.6346 183 206
6cl5-assembly1.cif.gz_B structure of p. aeruginosa r1 pyocin fiber pales_06171 comprising c-terminal residues 323-701 0.6334 138 218
7lgr-assembly1.cif.gz_A streptococcus mutans collagen binding protein cnm - n2 domain 0.6179 137 221
2xdh-assembly1.cif.gz_A non-cellulosomal cohesin from the hyperthermophilic archaeon archaeoglobus fulgidus 0.6152 138 221
ID Description Score Start End Superfamily
3v10B02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6573 137 222 2.60.40.740
af_Q96D70_188_248_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.6535 182 204 3.30.1370.50
3kptB02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6495 138 222 2.60.40.740
af_Q2G1H8_1_214_3.90.470.20 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.6329 188 209 3.90.470.20
af_C6KSX1_25_160_2.60.40.2860 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6295 183 209 2.60.40.2860
ID Description Score Start End GO Terms
AF-A0A7V9CTE4-F1-model_v4 Uncharacterized protein 0.8995 23 222
AF-A0A7W1RWE4-F1-model_v4 Uncharacterized protein 0.8896 22 221
AF-A0A7V9EGS5-F1-model_v4 Uncharacterized protein 0.8867 34 222
AF-A0A7V9JJW8-F1-model_v4 Uncharacterized protein 0.8795 8 222
AF-A0A538DYL8-F1-model_v4 Uncharacterized protein 0.8605 9 221

Map