F424667

General Info

Members Datasets Scaffolds Average Seq Length
368 193 736 380

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100164746|Ga0075435_1001647462
Length 413
Sequence MRSRRSAARSGSSARPTSEPTKPVRAESGGGAASPAASVAIQRIGRSKAELARFFDVADRIYAGDPNWVAPLRADLAKVFQDENPFFRHGEMQLFVAQRDGEDVGRIAAILDKNHNSFHGEKAAFFGFFESVDDPAVAGKLLDAAALWGRERKMTVLRGPVNPTLNDEVGLLVDGYDSPAVLMMTYNPPSYARLIEGQGFRKAKDLLAFWFPLEEKPLERLSRVADRFRKRESQVVVRNVSKGGLTRDLPKIREVYNEAWEKNWGFVPMTPEEMDFMAKRLKPLLQEKLVWLAEAPRPDGTLEPIAFMLMLPDYNVAIAPTKGRLLPFGWLKFLLAQRRIKTVRVLALGIKRTHRMSGVQSIMMADSLRFLLKLGYTGAEVSWLLEDNELVIGAVRLWGGKLYKTYRIYEKPL

Samples

Sample ID Description Type Environment
1 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
135 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
145 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
163 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
164 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.43
Rhizosphere 94.02
Stem 0
Stem Tuber 0
Unclassified 16.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075435_100164746 3300007076 Bacteria 1869
2 Ga0065704_10150479 3300005289 Unclassified 1433
3 Ga0065704_10174164 3300005289 Unclassified 1270
4 Ga0065712_10002385 3300005290 Bacteria 8033
5 Ga0065712_10076366 3300005290 Bacteria 3675
6 Ga0065712_10104759 3300005290 Bacteria 1954
7 Ga0065715_10001015 3300005293 Bacteria 8230
8 Ga0065715_10016128 3300005293 Unclassified 2048
9 Ga0065715_10117943 3300005293 Bacteria 2331
10 Ga0070676_10000548 3300005328 Bacteria 18206
11 Ga0070676_10045603 3300005328 Bacteria 2553
12 Ga0070683_100045784 3300005329 Viruses 4038
13 Ga0070683_100052562 3300005329 Bacteria 3775
14 Ga0070690_100000276 3300005330 Bacteria 26326
15 Ga0070690_100007127 3300005330 Bacteria 6389
16 Ga0070670_100016779 3300005331 Bacteria 6284
17 Ga0070670_100017052 3300005331 Bacteria 6233
18 Ga0070670_100176755 3300005331 Unclassified 1853
19 Ga0068869_100025613 3300005334 Bacteria 4097
20 Ga0070666_10000426 3300005335 Bacteria 26024
21 Ga0070666_10001425 3300005335 Bacteria 14493
22 Ga0070666_10008344 3300005335 Bacteria 6426
23 Ga0070666_10008432 3300005335 Bacteria 6400
24 Ga0070680_100031723 3300005336 Unclassified 4248
25 Ga0068868_100005908 3300005338 Bacteria 8635
26 Ga0068868_100015433 3300005338 Bacteria 5649
27 Ga0068868_100070570 3300005338 Bacteria 2785
28 Ga0070660_100072059 3300005339 Bacteria 2699
29 Ga0070689_100006248 3300005340 Bacteria 8224
30 Ga0070689_100016483 3300005340 Bacteria 5408
31 Ga0070689_100028361 3300005340 Unclassified 4231
32 Ga0070687_100006656 3300005343 Bacteria 4752
33 Ga0070661_100063353 3300005344 Bacteria 2715
34 Ga0070661_100121861 3300005344 Bacteria 1954
35 Ga0070668_100006355 3300005347 Bacteria 8751
36 Ga0070668_100094760 3300005347 Bacteria 2357
37 Ga0070669_100002334 3300005353 Bacteria 13715
38 Ga0070669_100138587 3300005353 Bacteria 1873
39 Ga0070675_100008883 3300005354 Bacteria 7811
40 Ga0070675_100014772 3300005354 Bacteria 6162
41 Ga0070675_100020815 3300005354 Bacteria 5235
42 Ga0070675_100093822 3300005354 Unclassified 2517
43 Ga0070671_100021697 3300005355 Bacteria 5245
44 Ga0070674_100053224 3300005356 Bacteria 2794
45 Ga0070673_100016350 3300005364 Bacteria 5244
46 Ga0070673_100020667 3300005364 Unclassified 4752
47 Ga0070673_100026285 3300005364 Bacteria 4298
48 Ga0070673_100077900 3300005364 Bacteria 2680
49 Ga0070688_100006713 3300005365 Bacteria 6166
50 Ga0070688_100020245 3300005365 Bacteria 3866
51 Ga0070688_100161163 3300005365 Unclassified 1541
52 Ga0070659_100043994 3300005366 Bacteria 3494
53 Ga0070659_100053927 3300005366 Bacteria 3166
54 Ga0070667_100000353 3300005367 Bacteria 50941
55 Ga0070667_100010694 3300005367 Bacteria 7583
56 Ga0070709_10147470 3300005434 Unclassified 1623
57 Ga0070708_100004218 3300005445 Bacteria 11294
58 Ga0070708_100006989 3300005445 Bacteria 9006
59 Ga0070708_100035065 3300005445 Unclassified 4369
60 Ga0070708_100058794 3300005445 Unclassified 3426
61 Ga0070708_100181188 3300005445 Bacteria 1969
62 Ga0070708_100306698 3300005445 Bacteria 1495
63 Ga0070663_100025545 3300005455 Bacteria 3989
64 Ga0070663_100198682 3300005455 Bacteria 1564
65 Ga0070678_100005309 3300005456 Bacteria 7430
66 Ga0070678_100044440 3300005456 Bacteria 3172
67 Ga0070662_100000885 3300005457 Bacteria 18309
68 Ga0070662_100089761 3300005457 Bacteria 2306
69 Ga0070681_10009528 3300005458 Bacteria 9555
70 Ga0068867_100019032 3300005459 Bacteria 4889
71 Ga0068867_100042203 3300005459 Bacteria 3336
72 Ga0070685_10004773 3300005466 Bacteria 6863
73 Ga0070706_100012944 3300005467 Bacteria 7722
74 Ga0070706_100021163 3300005467 Bacteria 5989
75 Ga0070706_100023817 3300005467 Bacteria 5637
76 Ga0070706_100110565 3300005467 Bacteria 2557
77 Ga0070707_100003505 3300005468 Bacteria 14806
78 Ga0070707_100020984 3300005468 Bacteria 6168
79 Ga0070707_100071698 3300005468 Bacteria 3337
80 Ga0070707_100080337 3300005468 Bacteria 3147
81 Ga0070707_100090449 3300005468 Bacteria 2962
82 Ga0070707_100156402 3300005468 Bacteria 2221
83 Ga0070707_100283803 3300005468 Unclassified 1609
84 Ga0070698_100040343 3300005471 Bacteria 4798
85 Ga0070699_100030184 3300005518 Unclassified 4679
86 Ga0070699_100078491 3300005518 Bacteria 2876
87 Ga0070679_100006792 3300005530 Bacteria 10667
88 Ga0070684_100117139 3300005535 Bacteria 2393
89 Ga0070697_100002929 3300005536 Bacteria 13131
90 Ga0070697_100009301 3300005536 Bacteria 7681
91 Ga0070697_100009443 3300005536 Bacteria 7620
92 Ga0070697_100053395 3300005536 Bacteria 3285
93 Ga0070697_100174016 3300005536 Bacteria 1823
94 Ga0070672_100079499 3300005543 Bacteria 2625
95 Ga0070686_100007125 3300005544 Bacteria 6233
96 Ga0070696_100068400 3300005546 Bacteria 2494
97 Ga0070665_100005244 3300005548 Bacteria 13405
98 Ga0070665_100009057 3300005548 Bacteria 10084
99 Ga0070665_100089687 3300005548 Bacteria 3080
100 Ga0070704_100049680 3300005549 Bacteria 2944
101 Ga0070664_100002262 3300005564 Bacteria 15481
102 Ga0070664_100008113 3300005564 Bacteria 8490
103 Ga0070664_100086993 3300005564 Unclassified 2701
104 Ga0070664_100147774 3300005564 Bacteria 2074
105 Ga0068856_100012851 3300005614 Bacteria 8102
106 Ga0068856_100061876 3300005614 Bacteria 3698
107 Ga0068856_100112309 3300005614 Unclassified 2722
108 Ga0070702_100004936 3300005615 Bacteria 6148
109 Ga0068859_100010544 3300005617 Bacteria 9302
110 Ga0068859_100100573 3300005617 Bacteria 2947
111 Ga0068859_100130741 3300005617 Bacteria 2582
112 Ga0068864_100008622 3300005618 Bacteria 8412
113 Ga0068864_100032969 3300005618 Bacteria 4401
114 Ga0068864_100221709 3300005618 Bacteria 1745
115 Ga0068866_10097244 3300005718 Bacteria 1617
116 Ga0068870_10012899 3300005840 Bacteria 3914
117 Ga0068863_100008265 3300005841 Bacteria 10166
118 Ga0068863_100009546 3300005841 Bacteria 9459
119 Ga0068863_100021877 3300005841 Bacteria 6101
120 Ga0068863_100099606 3300005841 Bacteria 2761
121 Ga0068858_100004067 3300005842 Bacteria 14407
122 Ga0068858_100143563 3300005842 Bacteria 2242
123 Ga0068860_100000950 3300005843 Bacteria 32061
124 Ga0068860_100019715 3300005843 Bacteria 6538
125 Ga0068860_100071046 3300005843 Bacteria 3309
126 Ga0068860_100155610 3300005843 Unclassified 2203
127 Ga0068860_100279204 3300005843 Bacteria 1632
128 Ga0068860_100290487 3300005843 Unclassified 1600
129 Ga0068862_100009449 3300005844 Bacteria 8067
130 Ga0068862_100059412 3300005844 Bacteria 3283
131 Ga0081455_10006566 3300005937 Bacteria 12445
132 Ga0081455_10015115 3300005937 Bacteria 7512
133 Ga0081455_10030005 3300005937 Unclassified 4948
134 Ga0081540_1020427 3300005983 Bacteria 3983
135 Ga0081539_10019219 3300005985 Bacteria 4687
136 Ga0081539_10024948 3300005985 Bacteria 3864
137 Ga0081539_10051049 3300005985 Bacteria 2334
138 Ga0081539_10090853 3300005985 Unclassified 1578
139 Ga0070716_100034432 3300006173 Unclassified 2777
140 Ga0097621_100097438 3300006237 Bacteria 2469
141 Ga0097621_100154244 3300006237 Unclassified 1971
142 Ga0068871_100017890 3300006358 Bacteria 5373
143 Ga0068871_100026651 3300006358 Viruses 4513
144 Ga0075433_10035406 3300006852 Bacteria 4293
145 Ga0075434_100002252 3300006871 Bacteria 16864
146 Ga0068865_100088536 3300006881 Bacteria 2240
147 Ga0097620_100010545 3300006931 Bacteria 9302
148 Ga0097620_100100573 3300006931 Bacteria 2947
149 Ga0097620_100130746 3300006931 Bacteria 2582
150 Ga0111539_10229780 3300009094 Bacteria 2160
151 Ga0105245_10029378 3300009098 Bacteria 4855
152 Ga0114129_10002576 3300009147 Bacteria 25194
153 Ga0114129_10003755 3300009147 Bacteria 21404
154 Ga0114129_10100384 3300009147 Bacteria 4005
155 Ga0114129_10141437 3300009147 Bacteria 3298
156 Ga0114129_10309782 3300009147 Bacteria 2102
157 Ga0105241_10059047 3300009174 Unclassified 2948
158 Ga0105241_10126945 3300009174 Bacteria 2061
159 Ga0105242_10311705 3300009176 Unclassified 1440
160 Ga0105249_10358653 3300009553 Bacteria 1479
161 Ga0105239_10084401 3300010375 Unclassified 3498
162 Ga0105239_10122773 3300010375 Bacteria 2886
163 Ga0157371_10116182 3300013102 Unclassified 1901
164 Ga0157371_10146173 3300013102 Bacteria 1685
165 Ga0157370_10053940 3300013104 Unclassified 3833
166 Ga0157369_10015389 3300013105 Bacteria 8624
167 Ga0157374_10031769 3300013296 Unclassified 4802
168 Ga0157374_10052219 3300013296 Bacteria 3806
169 Ga0157374_10092387 3300013296 Bacteria 2887
170 Ga0157378_10015302 3300013297 Bacteria 6720
171 Ga0157378_10026842 3300013297 Bacteria 5079
172 Ga0157378_10050380 3300013297 Bacteria 3706
173 Ga0157378_10137757 3300013297 Unclassified 2264
174 Ga0157378_10174104 3300013297 Bacteria 2021
175 Ga0163162_10004119 3300013306 Bacteria 13952
176 Ga0163162_10127525 3300013306 Bacteria 2652
177 Ga0157372_10031351 3300013307 Bacteria 5822
178 Ga0157372_10066773 3300013307 Bacteria 4041
179 Ga0157375_10000609 3300013308 Bacteria 31758
180 Ga0157375_10001657 3300013308 Bacteria 19152
181 Ga0157375_10017285 3300013308 Bacteria 6506
182 Ga0157375_10078272 3300013308 Bacteria 3339
183 Ga0157375_10089172 3300013308 Bacteria 3140
184 Ga0163163_10009449 3300014325 Bacteria 8706
185 Ga0163163_10047707 3300014325 Bacteria 4211
186 Ga0163163_10075289 3300014325 Bacteria 3369
187 Ga0157380_10099603 3300014326 Bacteria 2417
188 Ga0157377_10136079 3300014745 Bacteria 1505
189 Ga0157379_10007634 3300014968 Bacteria 9360
190 Ga0157379_10099033 3300014968 Bacteria 2617
191 Ga0157376_10002219 3300014969 Bacteria 13096
192 Ga0157376_10012412 3300014969 Bacteria 6324
193 Ga0157376_10013043 3300014969 Bacteria 6191
194 Ga0157376_10071566 3300014969 Bacteria 2947
195 Ga0157376_10227390 3300014969 Bacteria 1731
196 Ga0207673_1000583 3300025290 Unclassified 3879
197 Ga0207697_10000012 3300025315 Bacteria 62443
198 Ga0207697_10004095 3300025315 Bacteria 7048
199 Ga0207697_10004912 3300025315 Bacteria 6302
200 Ga0207697_10052679 3300025315 Unclassified 1684
201 Ga0207682_10024761 3300025893 Bacteria 2378
202 Ga0207688_10010873 3300025901 Bacteria 4953
203 Ga0207680_10002771 3300025903 Bacteria 8196
204 Ga0207680_10014783 3300025903 Unclassified 4053
205 Ga0207647_10055403 3300025904 Unclassified 2437
206 Ga0207645_10000363 3300025907 Bacteria 37541
207 Ga0207645_10025268 3300025907 Bacteria 3843
208 Ga0207643_10002286 3300025908 Bacteria 10429
209 Ga0207684_10008700 3300025910 Bacteria 9011
210 Ga0207684_10012387 3300025910 Bacteria 7421
211 Ga0207684_10017018 3300025910 Bacteria 6244
212 Ga0207684_10029451 3300025910 Bacteria 4675
213 Ga0207684_10127266 3300025910 Bacteria 2186
214 Ga0207707_10008525 3300025912 Bacteria 8887
215 Ga0207660_10067284 3300025917 Unclassified 2594
216 Ga0207662_10000175 3300025918 Bacteria 30539
217 Ga0207657_10326215 3300025919 Bacteria 1213
218 Ga0207649_10082983 3300025920 Bacteria 2079
219 Ga0207652_10027672 3300025921 Unclassified 4726
220 Ga0207646_10041092 3300025922 Bacteria 4158
221 Ga0207646_10052447 3300025922 Bacteria 3650
222 Ga0207646_10052979 3300025922 Bacteria 3630
223 Ga0207646_10058664 3300025922 Bacteria 3438
224 Ga0207646_10104045 3300025922 Bacteria 2546
225 Ga0207646_10271546 3300025922 Unclassified 1533
226 Ga0207681_10001796 3300025923 Bacteria 13773
227 Ga0207650_10172107 3300025925 Bacteria 1722
228 Ga0207659_10003392 3300025926 Bacteria 9551
229 Ga0207659_10003844 3300025926 Bacteria 9053
230 Ga0207659_10013319 3300025926 Bacteria 5262
231 Ga0207659_10114282 3300025926 Bacteria 2057
232 Ga0207700_10118911 3300025928 Unclassified 2139
233 Ga0207664_10171509 3300025929 Bacteria 1857
234 Ga0207644_10064461 3300025931 Bacteria 2662
235 Ga0207690_10040616 3300025932 Bacteria 3043
236 Ga0207690_10062422 3300025932 Bacteria 2536
237 Ga0207706_10000319 3300025933 Bacteria 52048
238 Ga0207706_10023146 3300025933 Bacteria 5580
239 Ga0207706_10081972 3300025933 Bacteria 2835
240 Ga0207670_10010047 3300025936 Bacteria 5431
241 Ga0207670_10014061 3300025936 Bacteria 4738
242 Ga0207670_10017202 3300025936 Unclassified 4366
243 Ga0207670_10018557 3300025936 Unclassified 4232
244 Ga0207670_10069030 3300025936 Bacteria 2437
245 Ga0207669_10030594 3300025937 Bacteria 2993
246 Ga0207704_10009366 3300025938 Bacteria 4723
247 Ga0207665_10010858 3300025939 Bacteria 5979
248 Ga0207665_10043949 3300025939 Unclassified 2988
249 Ga0207691_10003216 3300025940 Bacteria 15937
250 Ga0207691_10034667 3300025940 Bacteria 4692
251 Ga0207691_10043921 3300025940 Bacteria 4116
252 Ga0207691_10075194 3300025940 Bacteria 3046
253 Ga0207711_10000394 3300025941 Bacteria 46442
254 Ga0207689_10006020 3300025942 Bacteria 10726
255 Ga0207689_10173194 3300025942 Unclassified 1779
256 Ga0207679_10007498 3300025945 Bacteria 6924
257 Ga0207651_10084651 3300025960 Bacteria 2298
258 Ga0207651_10249875 3300025960 Bacteria 1450
259 Ga0207651_10292103 3300025960 Bacteria 1352
260 Ga0207712_10062772 3300025961 Bacteria 2642
261 Ga0207712_10072762 3300025961 Bacteria 2476
262 Ga0207668_10001263 3300025972 Bacteria 15082
263 Ga0207668_10019131 3300025972 Bacteria 4323
264 Ga0207658_10002706 3300025986 Bacteria 12791
265 Ga0207658_10019013 3300025986 Bacteria 4752
266 Ga0207677_10013716 3300026023 Bacteria 4705
267 Ga0207677_10052639 3300026023 Unclassified 2767
268 Ga0207677_10053657 3300026023 Bacteria 2745
269 Ga0207702_10005743 3300026078 Bacteria 10806
270 Ga0207702_10012853 3300026078 Bacteria 6965
271 Ga0207702_10176771 3300026078 Unclassified 1962
272 Ga0207641_10155193 3300026088 Bacteria 2076
273 Ga0207648_10007447 3300026089 Bacteria 10762
274 Ga0207648_10040211 3300026089 Bacteria 4109
275 Ga0207674_10085547 3300026116 Bacteria 3148
276 Ga0207675_100009154 3300026118 Bacteria 9288
277 Ga0207683_10001001 3300026121 Bacteria 25848
278 Ga0207683_10037325 3300026121 Bacteria 4230
279 Ga0207683_10050056 3300026121 Unclassified 3659
280 Ga0207683_10050627 3300026121 Unclassified 3639
281 Ga0268266_10020725 3300028379 Bacteria 5604
282 Ga0268266_10022985 3300028379 Bacteria 5306
283 Ga0268266_10043679 3300028379 Bacteria 3831
284 Ga0268266_10067594 3300028379 Bacteria 3093
285 Ga0268264_10001283 3300028381 Bacteria 23718
286 Ga0268264_10015246 3300028381 Bacteria 6305
287 Ga0268264_10153394 3300028381 Bacteria 2068
288 Ga0265316_10010109 3300031344 Bacteria 8620
289 Ga0373936_0026068 3300035113 Bacteria 2289
290 Ga0373954_0048794 3300035118 Bacteria 1984
291 Ga0373956_0107251 3300035119 Unclassified 1299
292 Ga0373935_0006184 3300035692 Bacteria 7124
293 Ga0373935_0259656 3300035692 Unclassified 1218
294 Ga0373933_0007117 3300035724 Bacteria 6091
295 Ga0373937_0007650 3300036401 Bacteria 9362
296 Ga0373937_0094718 3300036401 Bacteria 2769
297 Ga0373925_0192246 3300037068 Unclassified 1620
298 Ga0395900_0046049 3300037418 Unclassified 4492
299 Ga0395900_0055201 3300037418 Bacteria 4090
300 Ga0395898_0010235 3300037466 Bacteria 9820
301 Ga0395905_0000566 3300037471 Bacteria 50211
302 Ga0395905_0001219 3300037471 Bacteria 32045
303 Ga0395905_0002098 3300037471 Bacteria 22663
304 Ga0395905_0005126 3300037471 Bacteria 13458
305 Ga0395901_0092712 3300038443 Bacteria 3162
306 Ga0395901_0195681 3300038443 Bacteria 2120
307 Ga0439455_0011128 3300042012 Unclassified 1992
308 Ga0439458_0003752 3300042157 Bacteria 3520
309 Ga0453684_0017766 3300044712 Bacteria 10982
310 Ga0466971_0058084 3300044719 Bacteria 1746
311 Ga0451576_0152945 3300045051 Bacteria 2406
312 Ga0466967_0214182 3300045976 Bacteria 1828
313 Ga0495592_0069494 3300046454 Bacteria 2567
314 Ga0495629_0084491 3300046459 Bacteria 2215
315 Ga0495629_0102639 3300046459 Bacteria 1995
316 Ga0495641_0022751 3300046461 Bacteria 3130
317 Ga0495582_0093295 3300046473 Bacteria 1680
318 Ga0495628_0043829 3300046516 Bacteria 3562
319 Ga0495666_0113687 3300046526 Unclassified 1271
320 Ga0495652_0039448 3300046529 Bacteria 4083
321 Ga0495586_0082844 3300046535 Bacteria 1764
322 Ga0495587_0061039 3300046536 Bacteria 2209
323 Ga0495645_0020555 3300046543 Bacteria 4766
324 Ga0495634_0070392 3300046642 Unclassified 2306
325 Ga0495635_0021596 3300046663 Unclassified 4487
326 Ga0495659_0017111 3300046664 Unclassified 2399
327 Ga0495657_0096610 3300046675 Unclassified 1888
328 Ga0495646_0032495 3300046680 Bacteria 3248
329 Ga0495581_0074273 3300047315 Unclassified 1967
330 Ga0495684_0021607 3300047471 Bacteria 4955
331 Ga0495684_0053161 3300047471 Bacteria 3090
332 Ga0495602_0071981 3300048088 Bacteria 2950
333 Ga0496102_0030874 3300048905 Bacteria 4799
334 Ga0496102_0176263 3300048905 Bacteria 2013
335 Ga0496102_0364104 3300048905 Bacteria 1361
336 Ga0496104_0042092 3300048907 Unclassified 4285
337 Ga0496105_0211784 3300048908 Unclassified 1580
338 Ga0496106_0010295 3300048909 Bacteria 6914
339 Ga0496107_0001277 3300048910 Bacteria 15402
340 Ga0496108_0000134 3300048911 Bacteria 71998
341 Ga0496109_0378915 3300048912 Unclassified 1336
342 Ga0496110_0055508 3300048913 Bacteria 3486
343 Ga0496110_0163640 3300048913 Bacteria 2017
344 Ga0496110_0208570 3300048913 Unclassified 1776
345 Ga0496111_0003371 3300048914 Bacteria 9878
346 Ga0496112_0028788 3300048915 Bacteria 5366
347 Ga0496112_0158206 3300048915 Bacteria 2232
348 Ga0496113_0272013 3300048916 Unclassified 1354
349 Ga0496114_0043831 3300048917 Bacteria 3710
350 Ga0496115_0002460 3300048918 Bacteria 13306
351 Ga0496115_0017262 3300048918 Bacteria 5512
352 Ga0496115_0043148 3300048918 Bacteria 3596
353 Ga0496116_0005752 3300048919 Bacteria 11404
354 Ga0496126_0129869 3300048929 Bacteria 2178
355 Ga0501076_0160722 3300049592 Bacteria 1830
356 Ga0501079_0069835 3300049741 Bacteria 2712
357 Ga0501081_0156163 3300049743 Bacteria 1642
358 nmdc:mga05p37_11146_c1 3300050507 Bacteria 10682
359 nmdc:mga05p37_11331_c1 3300050507 Bacteria 3471
360 nmdc:mga0n895_664_c1 3300050512 Bacteria 24065
361 nmdc:mga0rr50_102044_c1 3300050513 Bacteria 2256
362 nmdc:mga0rr50_1233_c1 3300050513 Bacteria 13942
363 nmdc:mga0a205_1995_c1 3300050515 Bacteria 17781
364 nmdc:mga0a205_9351_c1 3300050515 Bacteria 8955
365 Ga0495601_0031712 3300053077 Bacteria 3285
366 Ga0495619_0020870 3300053085 Bacteria 4178
367 Ga0501082_0143694 3300060353 Bacteria 2071
368 Ga0466962_0012986 3300061719 Bacteria 4007
369 Ga0075435_100164746
370 Ga0065704_10150479
371 Ga0065704_10174164
372 Ga0065712_10002385
373 Ga0065712_10076366
374 Ga0065712_10104759
375 Ga0065715_10001015
376 Ga0065715_10016128
377 Ga0065715_10117943
378 Ga0070676_10000548
379 Ga0070676_10045603
380 Ga0070683_100045784
381 Ga0070683_100052562
382 Ga0070690_100000276
383 Ga0070690_100007127
384 Ga0070670_100016779
385 Ga0070670_100017052
386 Ga0070670_100176755
387 Ga0068869_100025613
388 Ga0070666_10000426
389 Ga0070666_10001425
390 Ga0070666_10008344
391 Ga0070666_10008432
392 Ga0070680_100031723
393 Ga0068868_100005908
394 Ga0068868_100015433
395 Ga0068868_100070570
396 Ga0070660_100072059
397 Ga0070689_100006248
398 Ga0070689_100016483
399 Ga0070689_100028361
400 Ga0070687_100006656
401 Ga0070661_100063353
402 Ga0070661_100121861
403 Ga0070668_100006355
404 Ga0070668_100094760
405 Ga0070669_100002334
406 Ga0070669_100138587
407 Ga0070675_100008883
408 Ga0070675_100014772
409 Ga0070675_100020815
410 Ga0070675_100093822
411 Ga0070671_100021697
412 Ga0070674_100053224
413 Ga0070673_100016350
414 Ga0070673_100020667
415 Ga0070673_100026285
416 Ga0070673_100077900
417 Ga0070688_100006713
418 Ga0070688_100020245
419 Ga0070688_100161163
420 Ga0070659_100043994
421 Ga0070659_100053927
422 Ga0070667_100000353
423 Ga0070667_100010694
424 Ga0070709_10147470
425 Ga0070708_100004218
426 Ga0070708_100006989
427 Ga0070708_100035065
428 Ga0070708_100058794
429 Ga0070708_100181188
430 Ga0070708_100306698
431 Ga0070663_100025545
432 Ga0070663_100198682
433 Ga0070678_100005309
434 Ga0070678_100044440
435 Ga0070662_100000885
436 Ga0070662_100089761
437 Ga0070681_10009528
438 Ga0068867_100019032
439 Ga0068867_100042203
440 Ga0070685_10004773
441 Ga0070706_100012944
442 Ga0070706_100021163
443 Ga0070706_100023817
444 Ga0070706_100110565
445 Ga0070707_100003505
446 Ga0070707_100020984
447 Ga0070707_100071698
448 Ga0070707_100080337
449 Ga0070707_100090449
450 Ga0070707_100156402
451 Ga0070707_100283803
452 Ga0070698_100040343
453 Ga0070699_100030184
454 Ga0070699_100078491
455 Ga0070679_100006792
456 Ga0070684_100117139
457 Ga0070697_100002929
458 Ga0070697_100009301
459 Ga0070697_100009443
460 Ga0070697_100053395
461 Ga0070697_100174016
462 Ga0070672_100079499
463 Ga0070686_100007125
464 Ga0070696_100068400
465 Ga0070665_100005244
466 Ga0070665_100009057
467 Ga0070665_100089687
468 Ga0070704_100049680
469 Ga0070664_100002262
470 Ga0070664_100008113
471 Ga0070664_100086993
472 Ga0070664_100147774
473 Ga0068856_100012851
474 Ga0068856_100061876
475 Ga0068856_100112309
476 Ga0070702_100004936
477 Ga0068859_100010544
478 Ga0068859_100100573
479 Ga0068859_100130741
480 Ga0068864_100008622
481 Ga0068864_100032969
482 Ga0068864_100221709
483 Ga0068866_10097244
484 Ga0068870_10012899
485 Ga0068863_100008265
486 Ga0068863_100009546
487 Ga0068863_100021877
488 Ga0068863_100099606
489 Ga0068858_100004067
490 Ga0068858_100143563
491 Ga0068860_100000950
492 Ga0068860_100019715
493 Ga0068860_100071046
494 Ga0068860_100155610
495 Ga0068860_100279204
496 Ga0068860_100290487
497 Ga0068862_100009449
498 Ga0068862_100059412
499 Ga0081455_10006566
500 Ga0081455_10015115
501 Ga0081455_10030005
502 Ga0081540_1020427
503 Ga0081539_10019219
504 Ga0081539_10024948
505 Ga0081539_10051049
506 Ga0081539_10090853
507 Ga0070716_100034432
508 Ga0097621_100097438
509 Ga0097621_100154244
510 Ga0068871_100017890
511 Ga0068871_100026651
512 Ga0075433_10035406
513 Ga0075434_100002252
514 Ga0068865_100088536
515 Ga0097620_100010545
516 Ga0097620_100100573
517 Ga0097620_100130746
518 Ga0111539_10229780
519 Ga0105245_10029378
520 Ga0114129_10002576
521 Ga0114129_10003755
522 Ga0114129_10100384
523 Ga0114129_10141437
524 Ga0114129_10309782
525 Ga0105241_10059047
526 Ga0105241_10126945
527 Ga0105242_10311705
528 Ga0105249_10358653
529 Ga0105239_10084401
530 Ga0105239_10122773
531 Ga0157371_10116182
532 Ga0157371_10146173
533 Ga0157370_10053940
534 Ga0157369_10015389
535 Ga0157374_10031769
536 Ga0157374_10052219
537 Ga0157374_10092387
538 Ga0157378_10015302
539 Ga0157378_10026842
540 Ga0157378_10050380
541 Ga0157378_10137757
542 Ga0157378_10174104
543 Ga0163162_10004119
544 Ga0163162_10127525
545 Ga0157372_10031351
546 Ga0157372_10066773
547 Ga0157375_10000609
548 Ga0157375_10001657
549 Ga0157375_10017285
550 Ga0157375_10078272
551 Ga0157375_10089172
552 Ga0163163_10009449
553 Ga0163163_10047707
554 Ga0163163_10075289
555 Ga0157380_10099603
556 Ga0157377_10136079
557 Ga0157379_10007634
558 Ga0157379_10099033
559 Ga0157376_10002219
560 Ga0157376_10012412
561 Ga0157376_10013043
562 Ga0157376_10071566
563 Ga0157376_10227390
564 Ga0207673_1000583
565 Ga0207697_10000012
566 Ga0207697_10004095
567 Ga0207697_10004912
568 Ga0207697_10052679
569 Ga0207682_10024761
570 Ga0207688_10010873
571 Ga0207680_10002771
572 Ga0207680_10014783
573 Ga0207647_10055403
574 Ga0207645_10000363
575 Ga0207645_10025268
576 Ga0207643_10002286
577 Ga0207684_10008700
578 Ga0207684_10012387
579 Ga0207684_10017018
580 Ga0207684_10029451
581 Ga0207684_10127266
582 Ga0207707_10008525
583 Ga0207660_10067284
584 Ga0207662_10000175
585 Ga0207657_10326215
586 Ga0207649_10082983
587 Ga0207652_10027672
588 Ga0207646_10041092
589 Ga0207646_10052447
590 Ga0207646_10052979
591 Ga0207646_10058664
592 Ga0207646_10104045
593 Ga0207646_10271546
594 Ga0207681_10001796
595 Ga0207650_10172107
596 Ga0207659_10003392
597 Ga0207659_10003844
598 Ga0207659_10013319
599 Ga0207659_10114282
600 Ga0207700_10118911
601 Ga0207664_10171509
602 Ga0207644_10064461
603 Ga0207690_10040616
604 Ga0207690_10062422
605 Ga0207706_10000319
606 Ga0207706_10023146
607 Ga0207706_10081972
608 Ga0207670_10010047
609 Ga0207670_10014061
610 Ga0207670_10017202
611 Ga0207670_10018557
612 Ga0207670_10069030
613 Ga0207669_10030594
614 Ga0207704_10009366
615 Ga0207665_10010858
616 Ga0207665_10043949
617 Ga0207691_10003216
618 Ga0207691_10034667
619 Ga0207691_10043921
620 Ga0207691_10075194
621 Ga0207711_10000394
622 Ga0207689_10006020
623 Ga0207689_10173194
624 Ga0207679_10007498
625 Ga0207651_10084651
626 Ga0207651_10249875
627 Ga0207651_10292103
628 Ga0207712_10062772
629 Ga0207712_10072762
630 Ga0207668_10001263
631 Ga0207668_10019131
632 Ga0207658_10002706
633 Ga0207658_10019013
634 Ga0207677_10013716
635 Ga0207677_10052639
636 Ga0207677_10053657
637 Ga0207702_10005743
638 Ga0207702_10012853
639 Ga0207702_10176771
640 Ga0207641_10155193
641 Ga0207648_10007447
642 Ga0207648_10040211
643 Ga0207674_10085547
644 Ga0207675_100009154
645 Ga0207683_10001001
646 Ga0207683_10037325
647 Ga0207683_10050056
648 Ga0207683_10050627
649 Ga0268266_10020725
650 Ga0268266_10022985
651 Ga0268266_10043679
652 Ga0268266_10067594
653 Ga0268264_10001283
654 Ga0268264_10015246
655 Ga0268264_10153394
656 Ga0265316_10010109
657 Ga0373936_0026068
658 Ga0373954_0048794
659 Ga0373956_0107251
660 Ga0373935_0006184
661 Ga0373935_0259656
662 Ga0373933_0007117
663 Ga0373937_0007650
664 Ga0373937_0094718
665 Ga0373925_0192246
666 Ga0395900_0046049
667 Ga0395900_0055201
668 Ga0395898_0010235
669 Ga0395905_0000566
670 Ga0395905_0001219
671 Ga0395905_0002098
672 Ga0395905_0005126
673 Ga0395901_0092712
674 Ga0395901_0195681
675 Ga0439455_0011128
676 Ga0439458_0003752
677 Ga0453684_0017766
678 Ga0466971_0058084
679 Ga0451576_0152945
680 Ga0466967_0214182
681 Ga0495592_0069494
682 Ga0495629_0084491
683 Ga0495629_0102639
684 Ga0495641_0022751
685 Ga0495582_0093295
686 Ga0495628_0043829
687 Ga0495666_0113687
688 Ga0495652_0039448
689 Ga0495586_0082844
690 Ga0495587_0061039
691 Ga0495645_0020555
692 Ga0495634_0070392
693 Ga0495635_0021596
694 Ga0495659_0017111
695 Ga0495657_0096610
696 Ga0495646_0032495
697 Ga0495581_0074273
698 Ga0495684_0021607
699 Ga0495684_0053161
700 Ga0495602_0071981
701 Ga0496102_0030874
702 Ga0496102_0176263
703 Ga0496102_0364104
704 Ga0496104_0042092
705 Ga0496105_0211784
706 Ga0496106_0010295
707 Ga0496107_0001277
708 Ga0496108_0000134
709 Ga0496109_0378915
710 Ga0496110_0055508
711 Ga0496110_0163640
712 Ga0496110_0208570
713 Ga0496111_0003371
714 Ga0496112_0028788
715 Ga0496112_0158206
716 Ga0496113_0272013
717 Ga0496114_0043831
718 Ga0496115_0002460
719 Ga0496115_0017262
720 Ga0496115_0043148
721 Ga0496116_0005752
722 Ga0496126_0129869
723 Ga0501076_0160722
724 Ga0501079_0069835
725 Ga0501081_0156163
726 nmdc:mga05p37_11146_c1
727 nmdc:mga05p37_11331_c1
728 nmdc:mga0n895_664_c1
729 nmdc:mga0rr50_102044_c1
730 nmdc:mga0rr50_1233_c1
731 nmdc:mga0a205_1995_c1
732 nmdc:mga0a205_9351_c1
733 Ga0495601_0031712
734 Ga0495619_0020870
735 Ga0501082_0143694
736 Ga0466962_0012986

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c82-assembly1.cif.gz_A-2 crystal structure of nourseothricin acetyltransferase 0.8301 56 123
3pp9-assembly2.cif.gz_B 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.7867 56 172
7daj-assembly1.cif.gz_B the crystal structure of serotonin n-acetyltransferase in complex with acetyl-coa from oryza sativa 0.7765 199 364
4qvt-assembly2.cif.gz_D crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli 0.7762 200 364
7dal-assembly1.cif.gz_B the crystal structure of a serotonin n-acetyltransferase in complex with serotonin and acetyl-coa from oryza sativa 0.7697 199 364
ID Description Score Start End Superfamily
af_Q46840_21_390_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.936 7 375 3.40.630.30
af_Q46840_21_390_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9311 7 375 3.40.630.30
af_Q54LZ9_6_162_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8313 199 362 3.40.630.30
af_P16691_3_141_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7975 199 364 3.40.630.30
af_I1MSW7_129_252_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7854 304 362 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2V6MP99-F1-model_v4 N-acetyltransferase 0.9985 1 377 GO:0016747
AF-A0A2V6MXT6-F1-model_v4 N-acetyltransferase 0.9971 2 377 GO:0016747
AF-A0A2V6MP99-F1-model_v4 N-acetyltransferase 0.9959 1 377 GO:0016747
AF-A0A2V6L5P2-F1-model_v4 N-acetyltransferase 0.9935 1 314 GO:0016740
AF-A0A2V6HUC2-F1-model_v4 N-acetyltransferase 0.9929 2 378 GO:0016747

Map