F424664

General Info

Members Datasets Scaffolds Average Seq Length
368 253 736 111

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100117490|Ga0075436_1001174903
Length 115
Sequence MDPLSKWAFAVLLNGLGEAGVKAVSLGAHHGYGVLLRIEQITGGALAIEQGALYPALYRLEHQGLLDAEWGTSDNNRRAKFYRLTAAGRRRLRAETERWHRTALAMNTALDAQEA

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
154 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
155 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
156 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
159 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
160 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
161 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
174 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
175 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
176 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
177 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
178 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
184 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
231 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
232 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.36
Nodule 0
Rhizoplane 3.8
Rhizosphere 93.48
Stem 0
Stem Tuber 0
Unclassified 19.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100117490 3300006914 Unclassified 1859
2 MBSR1b_contig_9144436 2162886012 Bacteria 811
3 rootH2_10122913 3300003320 Bacteria 5514
4 Ga0065712_10117252 3300005290 Bacteria 1723
5 Ga0065715_10119430 3300005293 Bacteria 2287
6 Ga0065715_10143165 3300005293 Bacteria 1824
7 Ga0065715_10206506 3300005293 Bacteria 1334
8 Ga0065707_10212494 3300005295 Unclassified 1259
9 Ga0065707_10343456 3300005295 Bacteria 930
10 Ga0070676_10027845 3300005328 Bacteria 3208
11 Ga0070676_10521846 3300005328 Unclassified 846
12 Ga0070690_100079025 3300005330 Bacteria 2150
13 Ga0070670_100223201 3300005331 Bacteria 1640
14 Ga0070670_101046693 3300005331 Unclassified 743
15 Ga0070666_11507015 3300005335 Bacteria 503
16 Ga0070660_100096834 3300005339 Bacteria 2334
17 Ga0070689_100061307 3300005340 Bacteria 2926
18 Ga0070687_100165431 3300005343 Bacteria 1311
19 Ga0070661_100029591 3300005344 Bacteria 3954
20 Ga0070671_100125967 3300005355 Bacteria 2156
21 Ga0070671_100305390 3300005355 Bacteria 1355
22 Ga0070674_100081621 3300005356 Bacteria 2311
23 Ga0070673_100002223 3300005364 Bacteria 11734
24 Ga0070673_100898789 3300005364 Bacteria 821
25 Ga0070688_100471386 3300005365 Bacteria 942
26 Ga0070688_100657021 3300005365 Bacteria 808
27 Ga0070659_100083439 3300005366 Unclassified 2554
28 Ga0070667_101288108 3300005367 Bacteria 685
29 Ga0070709_10946744 3300005434 Bacteria 683
30 Ga0070713_100491544 3300005436 Bacteria 1157
31 Ga0070710_10419163 3300005437 Unclassified 901
32 Ga0070701_10010142 3300005438 Bacteria 4155
33 Ga0070711_100089725 3300005439 Bacteria 2212
34 Ga0070705_100203410 3300005440 Bacteria 1359
35 Ga0070700_100071928 3300005441 Bacteria 2209
36 Ga0070700_101041462 3300005441 Bacteria 675
37 Ga0070694_100252406 3300005444 Bacteria 1335
38 Ga0070694_100332311 3300005444 Bacteria 1173
39 Ga0070663_101044708 3300005455 Bacteria 712
40 Ga0070678_100028893 3300005456 Bacteria 3789
41 Ga0070678_101061512 3300005456 Bacteria 747
42 Ga0070662_100250486 3300005457 Bacteria 1424
43 Ga0070681_10384522 3300005458 Bacteria 1314
44 Ga0070681_10400286 3300005458 Bacteria 1284
45 Ga0070681_10480905 3300005458 Bacteria 1155
46 Ga0068867_100871392 3300005459 Bacteria 808
47 Ga0070707_100630981 3300005468 Bacteria 1034
48 Ga0070698_100066295 3300005471 Bacteria 3635
49 Ga0070698_101285389 3300005471 Bacteria 682
50 Ga0070699_100322184 3300005518 Bacteria 1389
51 Ga0070699_100457472 3300005518 Bacteria 1157
52 Ga0070679_101546052 3300005530 Bacteria 611
53 Ga0070684_100481639 3300005535 Unclassified 1148
54 Ga0070697_101153734 3300005536 Unclassified 690
55 Ga0068853_100163917 3300005539 Bacteria 2007
56 Ga0068853_100715676 3300005539 Bacteria 956
57 Ga0070672_100053187 3300005543 Bacteria 3165
58 Ga0070672_100061871 3300005543 Bacteria 2952
59 Ga0070686_100023417 3300005544 Bacteria 3690
60 Ga0070686_100894641 3300005544 Bacteria 722
61 Ga0070695_100030635 3300005545 Bacteria 3351
62 Ga0070696_100206965 3300005546 Bacteria 1467
63 Ga0070696_100390316 3300005546 Bacteria 1087
64 Ga0070693_100006941 3300005547 Bacteria 5507
65 Ga0070704_100181819 3300005549 Bacteria 1682
66 Ga0068855_100011189 3300005563 Bacteria 10835
67 Ga0070664_100057672 3300005564 Bacteria 3301
68 Ga0070664_100311236 3300005564 Bacteria 1425
69 Ga0068857_100048393 3300005577 Bacteria 3775
70 Ga0068854_100096905 3300005578 Bacteria 2204
71 Ga0068854_100481058 3300005578 Bacteria 1042
72 Ga0068856_100073934 3300005614 Bacteria 3374
73 Ga0068856_100827447 3300005614 Unclassified 945
74 Ga0070702_100540840 3300005615 Bacteria 863
75 Ga0068852_101532274 3300005616 Bacteria 689
76 Ga0068859_100018001 3300005617 Bacteria 7100
77 Ga0068859_100278099 3300005617 Bacteria 1766
78 Ga0068864_100044044 3300005618 Bacteria 3823
79 Ga0068861_100268084 3300005719 Bacteria 1465
80 Ga0068851_10162712 3300005834 Bacteria 1227
81 Ga0068863_100021095 3300005841 Bacteria 6223
82 Ga0068860_100106809 3300005843 Bacteria 2674
83 Ga0068860_100834701 3300005843 Bacteria 936
84 Ga0068862_100109303 3300005844 Bacteria 2425
85 Ga0068862_102598959 3300005844 Unclassified 518
86 Ga0081455_10044014 3300005937 Unclassified 3900
87 Ga0081539_10299729 3300005985 Unclassified 691
88 Ga0070717_11594234 3300006028 Bacteria 592
89 Ga0075365_10659499 3300006038 Bacteria 739
90 Ga0075365_11245027 3300006038 Unclassified 523
91 Ga0075366_10318781 3300006195 Unclassified 952
92 Ga0097621_100025794 3300006237 Bacteria 4601
93 Ga0068871_101626148 3300006358 Bacteria 612
94 Ga0075428_100944016 3300006844 Bacteria 914
95 Ga0075431_100146580 3300006847 Bacteria 2433
96 Ga0075431_100302039 3300006847 Bacteria 1617
97 Ga0075431_100748979 3300006847 Bacteria 952
98 Ga0075434_100000175 3300006871 Bacteria 41562
99 Ga0075434_100522971 3300006871 Bacteria 1207
100 Ga0075429_100331607 3300006880 Bacteria 1332
101 Ga0075436_100000193 3300006914 Bacteria 37638
102 Ga0075436_100163482 3300006914 Bacteria 1570
103 Ga0097620_100018000 3300006931 Bacteria 7100
104 Ga0097620_100278103 3300006931 Bacteria 1766
105 Ga0075435_100000032 3300007076 Bacteria 71881
106 Ga0075435_100001880 3300007076 Bacteria 13659
107 Ga0075435_100310906 3300007076 Unclassified 1348
108 Ga0111539_10267170 3300009094 Bacteria 1991
109 Ga0111539_10533800 3300009094 Bacteria 1367
110 Ga0111539_10864762 3300009094 Bacteria 1052
111 Ga0111539_12098834 3300009094 Bacteria 656
112 Ga0111539_12557489 3300009094 Bacteria 592
113 Ga0105245_10440535 3300009098 Bacteria 1309
114 Ga0105245_13098292 3300009098 Unclassified 515
115 Ga0105245_13267062 3300009098 Bacteria 502
116 Ga0105247_10628044 3300009101 Bacteria 800
117 Ga0114129_10004001 3300009147 Bacteria 20820
118 Ga0114129_10155463 3300009147 Bacteria 3128
119 Ga0114129_10202235 3300009147 Unclassified 2690
120 Ga0114129_10260826 3300009147 Bacteria 2323
121 Ga0114129_13425642 3300009147 Bacteria 509
122 Ga0105243_10429848 3300009148 Bacteria 1234
123 Ga0105243_10538774 3300009148 Bacteria 1113
124 Ga0105241_10138528 3300009174 Bacteria 1979
125 Ga0105241_10478453 3300009174 Bacteria 1106
126 Ga0105242_10051894 3300009176 Bacteria 3344
127 Ga0105242_10159335 3300009176 Bacteria 1974
128 Ga0105242_10819000 3300009176 Unclassified 923
129 Ga0105248_10084635 3300009177 Bacteria 3567
130 Ga0105248_10299040 3300009177 Unclassified 1812
131 Ga0105248_11493438 3300009177 Bacteria 765
132 Ga0105237_10458317 3300009545 Bacteria 1281
133 Ga0105237_10722547 3300009545 Bacteria 1003
134 Ga0105249_10433833 3300009553 Bacteria 1350
135 Ga0157373_10374336 3300013100 Unclassified 1018
136 Ga0157369_10021029 3300013105 Bacteria 7294
137 Ga0157369_10075682 3300013105 Bacteria 3609
138 Ga0157369_11320279 3300013105 Unclassified 735
139 Ga0157374_10018225 3300013296 Bacteria 6194
140 Ga0157374_10277265 3300013296 Bacteria 1655
141 Ga0157378_10097388 3300013297 Bacteria 2681
142 Ga0163162_10602263 3300013306 Bacteria 1225
143 Ga0157372_10068979 3300013307 Unclassified 3976
144 Ga0157375_11384551 3300013308 Bacteria 828
145 Ga0163163_10008552 3300014325 Bacteria 9097
146 Ga0157380_11322311 3300014326 Bacteria 769
147 Ga0157380_12994752 3300014326 Bacteria 538
148 Ga0157379_11071362 3300014968 Bacteria 771
149 Ga0157376_10031457 3300014969 Unclassified 4250
150 Ga0157376_10135825 3300014969 Bacteria 2201
151 Ga0163161_10023175 3300017792 Bacteria 4377
152 Ga0213876_10023500 3300021384 Bacteria 3257
153 Ga0207666_1065960 3300025271 Unclassified 581
154 Ga0207653_10089352 3300025885 Bacteria 1077
155 Ga0207688_10112234 3300025901 Bacteria 1583
156 Ga0207680_11229695 3300025903 Bacteria 534
157 Ga0207647_10030162 3300025904 Bacteria 3501
158 Ga0207699_10842411 3300025906 Bacteria 675
159 Ga0207645_10016482 3300025907 Bacteria 4891
160 Ga0207645_10563395 3300025907 Unclassified 773
161 Ga0207684_10169133 3300025910 Unclassified 1884
162 Ga0207654_10180527 3300025911 Bacteria 1377
163 Ga0207707_10244145 3300025912 Bacteria 1561
164 Ga0207671_10525786 3300025914 Bacteria 943
165 Ga0207663_10114685 3300025916 Unclassified 1834
166 Ga0207662_10019865 3300025918 Bacteria 3828
167 Ga0207657_10078244 3300025919 Bacteria 2785
168 Ga0207649_10016340 3300025920 Bacteria 4181
169 Ga0207652_10723594 3300025921 Bacteria 887
170 Ga0207646_10548974 3300025922 Bacteria 1039
171 Ga0207650_11825018 3300025925 Unclassified 514
172 Ga0207659_11760950 3300025926 Unclassified 527
173 Ga0207687_10311580 3300025927 Bacteria 1271
174 Ga0207687_10623008 3300025927 Bacteria 911
175 Ga0207700_10065916 3300025928 Bacteria 2765
176 Ga0207644_10162999 3300025931 Bacteria 1734
177 Ga0207644_10223125 3300025931 Bacteria 1495
178 Ga0207706_10188980 3300025933 Bacteria 1808
179 Ga0207686_10167205 3300025934 Bacteria 1547
180 Ga0207686_10323472 3300025934 Bacteria 1153
181 Ga0207709_10183226 3300025935 Bacteria 1481
182 Ga0207709_11408961 3300025935 Bacteria 577
183 Ga0207670_10027559 3300025936 Bacteria 3593
184 Ga0207691_10298121 3300025940 Bacteria 1385
185 Ga0207711_10110339 3300025941 Bacteria 2446
186 Ga0207711_10269530 3300025941 Unclassified 1566
187 Ga0207689_10079332 3300025942 Bacteria 2698
188 Ga0207689_11619101 3300025942 Unclassified 538
189 Ga0207679_10042585 3300025945 Bacteria 3264
190 Ga0207679_11156332 3300025945 Bacteria 710
191 Ga0207667_10027030 3300025949 Bacteria 6257
192 Ga0207651_10012246 3300025960 Bacteria 4844
193 Ga0207651_11184443 3300025960 Unclassified 686
194 Ga0207658_12080346 3300025986 Bacteria 516
195 Ga0207703_11831045 3300026035 Bacteria 583
196 Ga0207639_10274286 3300026041 Bacteria 1481
197 Ga0207639_10450467 3300026041 Bacteria 1168
198 Ga0207639_11015225 3300026041 Bacteria 777
199 Ga0207678_10322837 3300026067 Eukaryota 1328
200 Ga0207708_10045817 3300026075 Bacteria 3333
201 Ga0207708_11882499 3300026075 Bacteria 524
202 Ga0207702_10392996 3300026078 Unclassified 1336
203 Ga0207641_11197357 3300026088 Bacteria 759
204 Ga0207648_10011389 3300026089 Bacteria 8382
205 Ga0207648_10448758 3300026089 Bacteria 1174
206 Ga0207676_10008220 3300026095 Bacteria 7426
207 Ga0207676_10245097 3300026095 Bacteria 1610
208 Ga0207674_10144430 3300026116 Bacteria 2338
209 Ga0207675_100013392 3300026118 Bacteria 7653
210 Ga0207683_10021203 3300026121 Bacteria 5560
211 Ga0207698_10094484 3300026142 Unclassified 2458
212 Ga0207698_10867702 3300026142 Bacteria 908
213 Ga0209971_1072428 3300027682 Bacteria 837
214 Ga0207428_10413196 3300027907 Bacteria 987
215 Ga0268265_10359709 3300028380 Bacteria 1332
216 Ga0268265_11655321 3300028380 Unclassified 645
217 Ga0268264_10068577 3300028381 Bacteria 2997
218 Ga0268264_10080178 3300028381 Bacteria 2787
219 Ga0265760_10235598 3300031090 Unclassified 629
220 Ga0307408_101366962 3300031548 Bacteria 666
221 Ga0307405_10279275 3300031731 Bacteria 1256
222 Ga0307410_10091915 3300031852 Bacteria 2156
223 Ga0307409_100314723 3300031995 Bacteria 1462
224 Ga0307416_100680201 3300032002 Bacteria 1116
225 Ga0307411_10147193 3300032005 Bacteria 1745
226 Ga0373938_0032887 3300034957 Bacteria 1119
227 Ga0373929_0075931 3300035085 Bacteria 811
228 Ga0373951_0047495 3300035091 Bacteria 1049
229 Ga0373952_0057478 3300035092 Unclassified 943
230 Ga0373923_0132591 3300035111 Bacteria 1121
231 Ga0373939_0093296 3300035114 Bacteria 1021
232 Ga0373945_0062553 3300035116 Unclassified 1392
233 Ga0373961_0027922 3300035241 Bacteria 1553
234 Ga0373962_0310527 3300035242 Unclassified 561
235 Ga0373931_0074152 3300035691 Bacteria 1864
236 Ga0373927_0007640 3300035695 Bacteria 7315
237 Ga0373933_0944646 3300035724 Bacteria 568
238 Ga0373947_0000662 3300035725 Bacteria 20403
239 Ga0373947_0530396 3300035725 Unclassified 801
240 Ga0373937_0231859 3300036401 Bacteria 1739
241 Ga0373925_0000170 3300037068 Bacteria 70413
242 Ga0395898_0581073 3300037466 Unclassified 1063
243 Ga0395905_0707481 3300037471 Unclassified 910
244 Ga0436365_1758546 3300039437 Bacteria 1846
245 Ga0451839_1274051 3300041496 Unclassified 537
246 Ga0451853_2909311 3300041512 Unclassified 782
247 Ga0439431_0142600 3300041997 Unclassified 677
248 Ga0439445_0113064 3300042004 Bacteria 776
249 Ga0450894_008507 3300042131 Bacteria 1328
250 Ga0450895_000122 3300042132 Bacteria 3299
251 Ga0450896_000718 3300042133 Bacteria 3688
252 Ga0450896_006386 3300042133 Unclassified 1616
253 Ga0450906_025097 3300042145 Bacteria 1059
254 Ga0466969_0544940 3300044656 Unclassified 531
255 Ga0466963_0708268 3300044694 Bacteria 710
256 Ga0466963_0984192 3300044694 Archaea 594
257 Ga0466957_0070201 3300044842 Bacteria 2165
258 Ga0495629_0346641 3300046459 Unclassified 1014
259 Ga0495653_0385460 3300046463 Bacteria 894
260 Ga0495662_0357180 3300046476 Unclassified 718
261 Ga0495630_0271054 3300046517 Bacteria 1297
262 Ga0495640_0505129 3300046533 Bacteria 735
263 Ga0495586_0822044 3300046535 Bacteria 536
264 Ga0495634_0079020 3300046642 Bacteria 2155
265 Ga0495635_0121884 3300046663 Bacteria 1778
266 Ga0495658_0364420 3300046683 Unclassified 919
267 Ga0495613_0659643 3300046689 Unclassified 692
268 Ga0495600_0297324 3300046809 Bacteria 1019
269 Ga0495604_0353291 3300047317 Bacteria 976
270 Ga0495674_0062101 3300047319 Bacteria 3254
271 Ga0495674_0438393 3300047319 Unclassified 1051
272 Ga0495680_0253446 3300047322 Bacteria 1247
273 Ga0496101_0088372 3300048904 Bacteria 2302
274 Ga0496102_1311464 3300048905 Bacteria 643
275 Ga0496104_0059114 3300048907 Bacteria 3629
276 Ga0496106_0269625 3300048909 Bacteria 1363
277 Ga0496107_0479577 3300048910 Bacteria 923
278 Ga0496107_0487323 3300048910 Bacteria 915
279 Ga0496108_0397818 3300048911 Bacteria 1203
280 Ga0496109_0451412 3300048912 Bacteria 1214
281 Ga0496109_0572365 3300048912 Bacteria 1065
282 Ga0496110_1090723 3300048913 Bacteria 706
283 Ga0496111_0884861 3300048914 Bacteria 644
284 Ga0496112_0346167 3300048915 Bacteria 1429
285 Ga0496114_0086959 3300048917 Bacteria 2649
286 Ga0496115_0318441 3300048918 Unclassified 1273
287 Ga0501031_0066919 3300049568 Bacteria 2341
288 Ga0501032_0002639 3300049569 Bacteria 13982
289 Ga0501034_0026379 3300049571 Bacteria 5916
290 Ga0501034_0314268 3300049571 Bacteria 1500
291 Ga0501036_0005839 3300049572 Bacteria 9968
292 Ga0501036_0034264 3300049572 Bacteria 4294
293 Ga0501037_0096363 3300049573 Bacteria 2138
294 Ga0501037_0103860 3300049573 Bacteria 2049
295 Ga0501038_0001162 3300049574 Bacteria 23890
296 Ga0501038_0536011 3300049574 Unclassified 892
297 Ga0501039_0003443 3300049575 Bacteria 11819
298 Ga0501039_0093491 3300049575 Unclassified 2344
299 Ga0501039_0853477 3300049575 Bacteria 709
300 Ga0501040_0525634 3300049576 Unclassified 853
301 Ga0501041_0133677 3300049577 Bacteria 1545
302 Ga0501042_0086295 3300049578 Bacteria 2251
303 Ga0501043_0062066 3300049579 Bacteria 2934
304 Ga0501046_0002100 3300049580 Bacteria 18887
305 Ga0501046_0066898 3300049580 Bacteria 2799
306 Ga0501046_0542353 3300049580 Bacteria 830
307 Ga0501047_0000576 3300049581 Bacteria 39085
308 Ga0501047_0027123 3300049581 Bacteria 5517
309 Ga0501068_0014795 3300049584 Bacteria 4465
310 Ga0501068_0313734 3300049584 Unclassified 1005
311 Ga0501069_0120185 3300049585 Unclassified 1500
312 Ga0501070_0748263 3300049586 Bacteria 770
313 Ga0501071_0360115 3300049587 Bacteria 1108
314 Ga0501072_0146540 3300049588 Unclassified 1882
315 Ga0501072_0230898 3300049588 Bacteria 1474
316 Ga0501073_0030158 3300049589 Bacteria 3873
317 Ga0501074_1027239 3300049590 Unclassified 579
318 Ga0501074_1232673 3300049590 Unclassified 524
319 Ga0501075_0034743 3300049591 Bacteria 3755
320 Ga0501076_0166506 3300049592 Unclassified 1796
321 Ga0501077_0292163 3300049593 Bacteria 1038
322 Ga0501077_0614278 3300049593 Bacteria 698
323 Ga0501077_0882724 3300049593 Unclassified 575
324 Ga0501217_134535 3300049661 Bacteria 728
325 Ga0501243_074719 3300049675 Bacteria 650
326 Ga0501079_1644824 3300049741 Bacteria 505
327 Ga0501080_0000262 3300049742 Bacteria 39808
328 Ga0501080_0502355 3300049742 Bacteria 1084
329 Ga0501080_0983428 3300049742 Bacteria 732
330 Ga0501080_1270669 3300049742 Unclassified 631
331 Ga0501083_0010101 3300049744 Bacteria 6652
332 Ga0501083_0083975 3300049744 Bacteria 2109
333 Ga0501083_0386347 3300049744 Bacteria 910
334 Ga0501035_0019111 3300049822 Bacteria 6308
335 Ga0501035_0036179 3300049822 Bacteria 4475
336 Ga0501035_1329338 3300049822 Unclassified 553
337 Ga0501044_0008961 3300049823 Bacteria 10938
338 Ga0501044_0714516 3300049823 Bacteria 886
339 Ga0501045_0261905 3300049824 Bacteria 1287
340 Ga0501045_1130817 3300049824 Unclassified 572
341 nmdc:mga00v17_459431_c1 3300050491 Bacteria 826
342 nmdc:mga0yw44_4332_c1 3300050492 Bacteria 6484
343 nmdc:mga05p37_197120_c1 3300050507 Unclassified 2441
344 nmdc:mga05p37_329816_c1 3300050507 Bacteria 1803
345 nmdc:mga09592_1624965_c1 3300050508 Unclassified 523
346 nmdc:mga0qj67_1402079_c1 3300050509 Bacteria 539
347 nmdc:mga06r32_286374_c1 3300050510 Bacteria 1634
348 nmdc:mga06r32_487025_c1 3300050510 Bacteria 1211
349 nmdc:mga06r32_581351_c1 3300050510 Bacteria 1092
350 nmdc:mga08y16_226745_c1 3300050511 Bacteria 1933
351 nmdc:mga0n895_388252_c1 3300050512 Bacteria 1412
352 nmdc:mga0n895_39443_c1 3300050512 Bacteria 4582
353 nmdc:mga0n895_3_c1 3300050512 Bacteria 134167
354 nmdc:mga0n895_644002_c1 3300050512 Bacteria 1059
355 nmdc:mga0rr50_16987_c1 3300050513 Bacteria 4848
356 nmdc:mga0rr50_283571_c1 3300050513 Unclassified 1383
357 nmdc:mga0rr50_30_c1 3300050513 Bacteria 105385
358 nmdc:mga08x19_127333_c1 3300050514 Bacteria 1711
359 nmdc:mga08x19_141599_c1 3300050514 Unclassified 1625
360 nmdc:mga08x19_73_c1 3300050514 Bacteria 96390
361 nmdc:mga0a205_44347_c1 3300050515 Bacteria 4286
362 Ga0495601_0021825 3300053077 Bacteria 3925
363 Ga0495619_0002663 3300053085 Bacteria 11676
364 Ga0501084_0036835 3300054114 Bacteria 4087
365 Ga0501084_0078629 3300054114 Bacteria 2765
366 Ga0501084_1078923 3300054114 Bacteria 674
367 Ga0501082_0026338 3300060353 Bacteria 5010
368 Ga0501082_0074925 3300060353 Unclassified 2915
369 Ga0075436_100117490
370 MBSR1b_contig_9144436
371 rootH2_10122913
372 Ga0065712_10117252
373 Ga0065715_10119430
374 Ga0065715_10143165
375 Ga0065715_10206506
376 Ga0065707_10212494
377 Ga0065707_10343456
378 Ga0070676_10027845
379 Ga0070676_10521846
380 Ga0070690_100079025
381 Ga0070670_100223201
382 Ga0070670_101046693
383 Ga0070666_11507015
384 Ga0070660_100096834
385 Ga0070689_100061307
386 Ga0070687_100165431
387 Ga0070661_100029591
388 Ga0070671_100125967
389 Ga0070671_100305390
390 Ga0070674_100081621
391 Ga0070673_100002223
392 Ga0070673_100898789
393 Ga0070688_100471386
394 Ga0070688_100657021
395 Ga0070659_100083439
396 Ga0070667_101288108
397 Ga0070709_10946744
398 Ga0070713_100491544
399 Ga0070710_10419163
400 Ga0070701_10010142
401 Ga0070711_100089725
402 Ga0070705_100203410
403 Ga0070700_100071928
404 Ga0070700_101041462
405 Ga0070694_100252406
406 Ga0070694_100332311
407 Ga0070663_101044708
408 Ga0070678_100028893
409 Ga0070678_101061512
410 Ga0070662_100250486
411 Ga0070681_10384522
412 Ga0070681_10400286
413 Ga0070681_10480905
414 Ga0068867_100871392
415 Ga0070707_100630981
416 Ga0070698_100066295
417 Ga0070698_101285389
418 Ga0070699_100322184
419 Ga0070699_100457472
420 Ga0070679_101546052
421 Ga0070684_100481639
422 Ga0070697_101153734
423 Ga0068853_100163917
424 Ga0068853_100715676
425 Ga0070672_100053187
426 Ga0070672_100061871
427 Ga0070686_100023417
428 Ga0070686_100894641
429 Ga0070695_100030635
430 Ga0070696_100206965
431 Ga0070696_100390316
432 Ga0070693_100006941
433 Ga0070704_100181819
434 Ga0068855_100011189
435 Ga0070664_100057672
436 Ga0070664_100311236
437 Ga0068857_100048393
438 Ga0068854_100096905
439 Ga0068854_100481058
440 Ga0068856_100073934
441 Ga0068856_100827447
442 Ga0070702_100540840
443 Ga0068852_101532274
444 Ga0068859_100018001
445 Ga0068859_100278099
446 Ga0068864_100044044
447 Ga0068861_100268084
448 Ga0068851_10162712
449 Ga0068863_100021095
450 Ga0068860_100106809
451 Ga0068860_100834701
452 Ga0068862_100109303
453 Ga0068862_102598959
454 Ga0081455_10044014
455 Ga0081539_10299729
456 Ga0070717_11594234
457 Ga0075365_10659499
458 Ga0075365_11245027
459 Ga0075366_10318781
460 Ga0097621_100025794
461 Ga0068871_101626148
462 Ga0075428_100944016
463 Ga0075431_100146580
464 Ga0075431_100302039
465 Ga0075431_100748979
466 Ga0075434_100000175
467 Ga0075434_100522971
468 Ga0075429_100331607
469 Ga0075436_100000193
470 Ga0075436_100163482
471 Ga0097620_100018000
472 Ga0097620_100278103
473 Ga0075435_100000032
474 Ga0075435_100001880
475 Ga0075435_100310906
476 Ga0111539_10267170
477 Ga0111539_10533800
478 Ga0111539_10864762
479 Ga0111539_12098834
480 Ga0111539_12557489
481 Ga0105245_10440535
482 Ga0105245_13098292
483 Ga0105245_13267062
484 Ga0105247_10628044
485 Ga0114129_10004001
486 Ga0114129_10155463
487 Ga0114129_10202235
488 Ga0114129_10260826
489 Ga0114129_13425642
490 Ga0105243_10429848
491 Ga0105243_10538774
492 Ga0105241_10138528
493 Ga0105241_10478453
494 Ga0105242_10051894
495 Ga0105242_10159335
496 Ga0105242_10819000
497 Ga0105248_10084635
498 Ga0105248_10299040
499 Ga0105248_11493438
500 Ga0105237_10458317
501 Ga0105237_10722547
502 Ga0105249_10433833
503 Ga0157373_10374336
504 Ga0157369_10021029
505 Ga0157369_10075682
506 Ga0157369_11320279
507 Ga0157374_10018225
508 Ga0157374_10277265
509 Ga0157378_10097388
510 Ga0163162_10602263
511 Ga0157372_10068979
512 Ga0157375_11384551
513 Ga0163163_10008552
514 Ga0157380_11322311
515 Ga0157380_12994752
516 Ga0157379_11071362
517 Ga0157376_10031457
518 Ga0157376_10135825
519 Ga0163161_10023175
520 Ga0213876_10023500
521 Ga0207666_1065960
522 Ga0207653_10089352
523 Ga0207688_10112234
524 Ga0207680_11229695
525 Ga0207647_10030162
526 Ga0207699_10842411
527 Ga0207645_10016482
528 Ga0207645_10563395
529 Ga0207684_10169133
530 Ga0207654_10180527
531 Ga0207707_10244145
532 Ga0207671_10525786
533 Ga0207663_10114685
534 Ga0207662_10019865
535 Ga0207657_10078244
536 Ga0207649_10016340
537 Ga0207652_10723594
538 Ga0207646_10548974
539 Ga0207650_11825018
540 Ga0207659_11760950
541 Ga0207687_10311580
542 Ga0207687_10623008
543 Ga0207700_10065916
544 Ga0207644_10162999
545 Ga0207644_10223125
546 Ga0207706_10188980
547 Ga0207686_10167205
548 Ga0207686_10323472
549 Ga0207709_10183226
550 Ga0207709_11408961
551 Ga0207670_10027559
552 Ga0207691_10298121
553 Ga0207711_10110339
554 Ga0207711_10269530
555 Ga0207689_10079332
556 Ga0207689_11619101
557 Ga0207679_10042585
558 Ga0207679_11156332
559 Ga0207667_10027030
560 Ga0207651_10012246
561 Ga0207651_11184443
562 Ga0207658_12080346
563 Ga0207703_11831045
564 Ga0207639_10274286
565 Ga0207639_10450467
566 Ga0207639_11015225
567 Ga0207678_10322837
568 Ga0207708_10045817
569 Ga0207708_11882499
570 Ga0207702_10392996
571 Ga0207641_11197357
572 Ga0207648_10011389
573 Ga0207648_10448758
574 Ga0207676_10008220
575 Ga0207676_10245097
576 Ga0207674_10144430
577 Ga0207675_100013392
578 Ga0207683_10021203
579 Ga0207698_10094484
580 Ga0207698_10867702
581 Ga0209971_1072428
582 Ga0207428_10413196
583 Ga0268265_10359709
584 Ga0268265_11655321
585 Ga0268264_10068577
586 Ga0268264_10080178
587 Ga0265760_10235598
588 Ga0307408_101366962
589 Ga0307405_10279275
590 Ga0307410_10091915
591 Ga0307409_100314723
592 Ga0307416_100680201
593 Ga0307411_10147193
594 Ga0373938_0032887
595 Ga0373929_0075931
596 Ga0373951_0047495
597 Ga0373952_0057478
598 Ga0373923_0132591
599 Ga0373939_0093296
600 Ga0373945_0062553
601 Ga0373961_0027922
602 Ga0373962_0310527
603 Ga0373931_0074152
604 Ga0373927_0007640
605 Ga0373933_0944646
606 Ga0373947_0000662
607 Ga0373947_0530396
608 Ga0373937_0231859
609 Ga0373925_0000170
610 Ga0395898_0581073
611 Ga0395905_0707481
612 Ga0436365_1758546
613 Ga0451839_1274051
614 Ga0451853_2909311
615 Ga0439431_0142600
616 Ga0439445_0113064
617 Ga0450894_008507
618 Ga0450895_000122
619 Ga0450896_000718
620 Ga0450896_006386
621 Ga0450906_025097
622 Ga0466969_0544940
623 Ga0466963_0708268
624 Ga0466963_0984192
625 Ga0466957_0070201
626 Ga0495629_0346641
627 Ga0495653_0385460
628 Ga0495662_0357180
629 Ga0495630_0271054
630 Ga0495640_0505129
631 Ga0495586_0822044
632 Ga0495634_0079020
633 Ga0495635_0121884
634 Ga0495658_0364420
635 Ga0495613_0659643
636 Ga0495600_0297324
637 Ga0495604_0353291
638 Ga0495674_0062101
639 Ga0495674_0438393
640 Ga0495680_0253446
641 Ga0496101_0088372
642 Ga0496102_1311464
643 Ga0496104_0059114
644 Ga0496106_0269625
645 Ga0496107_0479577
646 Ga0496107_0487323
647 Ga0496108_0397818
648 Ga0496109_0451412
649 Ga0496109_0572365
650 Ga0496110_1090723
651 Ga0496111_0884861
652 Ga0496112_0346167
653 Ga0496114_0086959
654 Ga0496115_0318441
655 Ga0501031_0066919
656 Ga0501032_0002639
657 Ga0501034_0026379
658 Ga0501034_0314268
659 Ga0501036_0005839
660 Ga0501036_0034264
661 Ga0501037_0096363
662 Ga0501037_0103860
663 Ga0501038_0001162
664 Ga0501038_0536011
665 Ga0501039_0003443
666 Ga0501039_0093491
667 Ga0501039_0853477
668 Ga0501040_0525634
669 Ga0501041_0133677
670 Ga0501042_0086295
671 Ga0501043_0062066
672 Ga0501046_0002100
673 Ga0501046_0066898
674 Ga0501046_0542353
675 Ga0501047_0000576
676 Ga0501047_0027123
677 Ga0501068_0014795
678 Ga0501068_0313734
679 Ga0501069_0120185
680 Ga0501070_0748263
681 Ga0501071_0360115
682 Ga0501072_0146540
683 Ga0501072_0230898
684 Ga0501073_0030158
685 Ga0501074_1027239
686 Ga0501074_1232673
687 Ga0501075_0034743
688 Ga0501076_0166506
689 Ga0501077_0292163
690 Ga0501077_0614278
691 Ga0501077_0882724
692 Ga0501217_134535
693 Ga0501243_074719
694 Ga0501079_1644824
695 Ga0501080_0000262
696 Ga0501080_0502355
697 Ga0501080_0983428
698 Ga0501080_1270669
699 Ga0501083_0010101
700 Ga0501083_0083975
701 Ga0501083_0386347
702 Ga0501035_0019111
703 Ga0501035_0036179
704 Ga0501035_1329338
705 Ga0501044_0008961
706 Ga0501044_0714516
707 Ga0501045_0261905
708 Ga0501045_1130817
709 nmdc:mga00v17_459431_c1
710 nmdc:mga0yw44_4332_c1
711 nmdc:mga05p37_197120_c1
712 nmdc:mga05p37_329816_c1
713 nmdc:mga09592_1624965_c1
714 nmdc:mga0qj67_1402079_c1
715 nmdc:mga06r32_286374_c1
716 nmdc:mga06r32_487025_c1
717 nmdc:mga06r32_581351_c1
718 nmdc:mga08y16_226745_c1
719 nmdc:mga0n895_388252_c1
720 nmdc:mga0n895_39443_c1
721 nmdc:mga0n895_3_c1
722 nmdc:mga0n895_644002_c1
723 nmdc:mga0rr50_16987_c1
724 nmdc:mga0rr50_283571_c1
725 nmdc:mga0rr50_30_c1
726 nmdc:mga08x19_127333_c1
727 nmdc:mga08x19_141599_c1
728 nmdc:mga08x19_73_c1
729 nmdc:mga0a205_44347_c1
730 Ga0495601_0021825
731 Ga0495619_0002663
732 Ga0501084_0036835
733 Ga0501084_0078629
734 Ga0501084_1078923
735 Ga0501082_0026338
736 Ga0501082_0074925

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

21

94

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9174 10 103
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9051 13 103
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9033 10 105
6abq-assembly1.cif.gz_B crystal structure of transcription factor from listeria monocytogenes 0.8957 10 105
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.8932 9 107
ID Description Score Start End Superfamily
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9051 13 103 1.10.10.10
5zqhA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8911 10 107 1.10.10.10
4esfA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8852 10 109 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.884 12 92 1.10.10.10
5dymA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8837 10 106 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V8VSP9-F1-model_v4 PadR family transcriptional regulator 0.9838 10 113
AF-A0A143PJ72-F1-model_v4 Lineage-specific thermal regulator protein 0.9823 5 113
AF-A0A2U3KUY7-F1-model_v4 Transcriptional regulator, PadR-family 0.9796 1 110
AF-A0A2V8YVR9-F1-model_v4 PadR family transcriptional regulator 0.9796 10 109
AF-A0A7V0Y414-F1-model_v4 PadR family transcriptional regulator 0.9782 1 107

Map