F424661

General Info

Members Datasets Scaffolds Average Seq Length
368 180 736 80

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10258058|Ga0075433_102580582
Length 80
Sequence VIEEANDALRAKGYSEAQLVVVASPLPGKALLKGNRIVSPFSDTPETIARVTQRAVPPLADLGTRRLTPHELRDWLSSEG

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
42 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
46 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
69 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
70 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
71 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
72 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
73 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
74 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
77 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
78 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
79 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
80 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
85 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
92 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
100 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
101 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
102 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
103 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
119 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
120 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
127 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
176 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.28
Metatranscriptomes 2.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.7
Rhizosphere 90.76
Stem 0
Stem Tuber 0
Unclassified 17.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10258058 3300006852 Bacteria 1545
2 Ga0070658_10004145 3300005327 Bacteria 11870
3 Ga0070658_10063970 3300005327 Bacteria 3000
4 Ga0070658_10234713 3300005327 Bacteria 1554
5 Ga0070683_100033304 3300005329 Bacteria 4698
6 Ga0070683_101212312 3300005329 Unclassified 725
7 Ga0070680_100178164 3300005336 Bacteria 1790
8 Ga0070680_100182550 3300005336 Unclassified 1767
9 Ga0070680_100444642 3300005336 Bacteria 1107
10 Ga0070682_100005200 3300005337 Bacteria 7239
11 Ga0070660_100008592 3300005339 Bacteria 7151
12 Ga0070660_100045142 3300005339 Bacteria 3372
13 Ga0070660_100055361 3300005339 Bacteria 3065
14 Ga0070660_100248414 3300005339 Bacteria 1450
15 Ga0070661_100058855 3300005344 Bacteria 2816
16 Ga0070659_100107364 3300005366 Bacteria 2251
17 Ga0070659_100418348 3300005366 Bacteria 1133
18 Ga0070659_101463357 3300005366 Bacteria 608
19 Ga0070709_10172611 3300005434 Bacteria 1512
20 Ga0070709_10797444 3300005434 Bacteria 741
21 Ga0070714_100022060 3300005435 Bacteria 5217
22 Ga0070714_100371296 3300005435 Bacteria 1347
23 Ga0070714_101357553 3300005435 Bacteria 694
24 Ga0070705_100714793 3300005440 Bacteria 788
25 Ga0070681_10011312 3300005458 Bacteria 8830
26 Ga0070681_10038054 3300005458 Bacteria 4823
27 Ga0070681_10062851 3300005458 Bacteria 3685
28 Ga0070681_10370535 3300005458 Bacteria 1342
29 Ga0070681_10422428 3300005458 Unclassified 1245
30 Ga0070681_11633215 3300005458 Bacteria 570
31 Ga0070706_100677360 3300005467 Bacteria 957
32 Ga0070707_100133572 3300005468 Bacteria 2414
33 Ga0070698_100074590 3300005471 Bacteria 3398
34 Ga0070699_101124541 3300005518 Bacteria 720
35 Ga0070699_101253948 3300005518 Unclassified 680
36 Ga0070679_100091994 3300005530 Bacteria 3021
37 Ga0070679_100092160 3300005530 Bacteria 3018
38 Ga0070679_100217198 3300005530 Bacteria 1874
39 Ga0070679_100310988 3300005530 Bacteria 1525
40 Ga0070679_101188199 3300005530 Bacteria 708
41 Ga0070679_101942069 3300005530 Bacteria 537
42 Ga0070684_100202394 3300005535 Bacteria 1809
43 Ga0070684_100519360 3300005535 Bacteria 1104
44 Ga0070684_100577618 3300005535 Unclassified 1044
45 Ga0070697_100113887 3300005536 Bacteria 2257
46 Ga0070697_101008978 3300005536 Bacteria 740
47 Ga0068853_101557649 3300005539 Bacteria 640
48 Ga0070695_100841657 3300005545 Unclassified 738
49 Ga0070695_101067141 3300005545 Bacteria 660
50 Ga0070695_101160056 3300005545 Unclassified 634
51 Ga0070696_100969643 3300005546 Unclassified 709
52 Ga0068855_100219192 3300005563 Bacteria 2134
53 Ga0068855_100250076 3300005563 Bacteria 1977
54 Ga0068855_100305276 3300005563 Bacteria 1762
55 Ga0068855_102119144 3300005563 Unclassified 566
56 Ga0068854_100822821 3300005578 Bacteria 811
57 Ga0068852_100134954 3300005616 Bacteria 2278
58 Ga0068852_100210846 3300005616 Bacteria 1843
59 Ga0068852_100961955 3300005616 Bacteria 872
60 Ga0068851_10421385 3300005834 Bacteria 788
61 Ga0068851_10866923 3300005834 Unclassified 564
62 Ga0070715_10241616 3300006163 Bacteria 939
63 Ga0070712_100246394 3300006175 Bacteria 1425
64 Ga0070712_101551652 3300006175 Unclassified 579
65 Ga0075433_11374762 3300006852 Bacteria 611
66 Ga0075434_100386922 3300006871 Bacteria 1419
67 Ga0105240_10680146 3300009093 Bacteria 1125
68 Ga0105240_10853638 3300009093 Bacteria 982
69 Ga0111539_11064338 3300009094 Unclassified 940
70 Ga0114129_13103440 3300009147 Bacteria 543
71 Ga0105249_12301786 3300009553 Unclassified 611
72 Ga0157373_10610941 3300013100 Unclassified 794
73 Ga0157373_10630234 3300013100 Bacteria 782
74 Ga0157373_10740773 3300013100 Bacteria 722
75 Ga0157373_10802654 3300013100 Bacteria 694
76 Ga0157371_10292889 3300013102 Bacteria 1177
77 Ga0157371_10586104 3300013102 Bacteria 829
78 Ga0157370_10006447 3300013104 Bacteria 12945
79 Ga0157370_10121797 3300013104 Bacteria 2435
80 Ga0157370_10498319 3300013104 Bacteria 1119
81 Ga0157369_10019193 3300013105 Bacteria 7650
82 Ga0157369_10043198 3300013105 Bacteria 4914
83 Ga0157369_10127978 3300013105 Bacteria 2692
84 Ga0157369_10510345 3300013105 Bacteria 1244
85 Ga0157369_11356392 3300013105 Bacteria 724
86 Ga0157369_11425819 3300013105 Bacteria 705
87 Ga0157374_11326908 3300013296 Bacteria 742
88 Ga0157372_10218808 3300013307 Bacteria 2207
89 Ga0157372_10736590 3300013307 Bacteria 1146
90 Ga0157372_11892010 3300013307 Unclassified 686
91 Ga0182008_10241194 3300014497 Unclassified 930
92 Ga0182007_10177650 3300015262 Bacteria 735
93 Ga0206356_10506402 3300020070 Bacteria 558
94 Ga0206356_10942301 3300020070 Bacteria 4559
95 Ga0206354_10478962 3300020081 Bacteria 1544
96 Ga0206354_10844404 3300020081 Bacteria 3185
97 Ga0206353_10049987 3300020082 Bacteria 577
98 Ga0206353_10628334 3300020082 Bacteria 555
99 Ga0206353_10683122 3300020082 Bacteria 2474
100 Ga0206353_10943226 3300020082 Bacteria 1643
101 Ga0206353_11119038 3300020082 Bacteria 1671
102 Ga0206353_12014982 3300020082 Bacteria 505
103 Ga0213871_10080392 3300021441 Bacteria 933
104 Ga0207656_10218725 3300025321 Bacteria 925
105 Ga0207699_10150003 3300025906 Bacteria 1542
106 Ga0207705_10142758 3300025909 Bacteria 1789
107 Ga0207705_10871144 3300025909 Bacteria 698
108 Ga0207705_10999921 3300025909 Unclassified 646
109 Ga0207707_10013319 3300025912 Bacteria 7168
110 Ga0207707_10025443 3300025912 Bacteria 5178
111 Ga0207707_10066270 3300025912 Bacteria 3145
112 Ga0207707_10170756 3300025912 Bacteria 1900
113 Ga0207707_10882645 3300025912 Bacteria 740
114 Ga0207707_10920314 3300025912 Bacteria 722
115 Ga0207695_10054347 3300025913 Bacteria 4183
116 Ga0207695_11330861 3300025913 Bacteria 599
117 Ga0207693_10144262 3300025915 Bacteria 1872
118 Ga0207693_10388357 3300025915 Bacteria 1091
119 Ga0207660_10295160 3300025917 Bacteria 1289
120 Ga0207660_10534083 3300025917 Unclassified 953
121 Ga0207657_10004357 3300025919 Bacteria 14991
122 Ga0207657_10004556 3300025919 Bacteria 14649
123 Ga0207657_10016836 3300025919 Bacteria 7038
124 Ga0207657_10019998 3300025919 Bacteria 6342
125 Ga0207649_10053535 3300025920 Bacteria 2508
126 Ga0207652_10033006 3300025921 Bacteria 4358
127 Ga0207652_10431493 3300025921 Unclassified 1188
128 Ga0207652_10774377 3300025921 Unclassified 853
129 Ga0207652_10810880 3300025921 Bacteria 831
130 Ga0207652_11248757 3300025921 Bacteria 645
131 Ga0207646_10382432 3300025922 Bacteria 1272
132 Ga0207646_11247521 3300025922 Unclassified 650
133 Ga0207664_10019393 3300025929 Bacteria 5026
134 Ga0207664_10045017 3300025929 Bacteria 3459
135 Ga0207664_10449506 3300025929 Bacteria 1150
136 Ga0207664_10816085 3300025929 Bacteria 839
137 Ga0207690_10184109 3300025932 Bacteria 1575
138 Ga0207690_10661776 3300025932 Bacteria 856
139 Ga0207665_10164151 3300025939 Bacteria 1600
140 Ga0207665_11327535 3300025939 Bacteria 573
141 Ga0207661_10033277 3300025944 Bacteria 3999
142 Ga0207661_10500969 3300025944 Unclassified 1110
143 Ga0207667_10124872 3300025949 Bacteria 2650
144 Ga0207667_10168165 3300025949 Unclassified 2254
145 Ga0207667_11910104 3300025949 Unclassified 556
146 Ga0207640_10681287 3300025981 Unclassified 879
147 Ga0207639_10862215 3300026041 Bacteria 846
148 Ga0207678_10592815 3300026067 Bacteria 971
149 Ga0207678_10749188 3300026067 Bacteria 861
150 Ga0207702_11692456 3300026078 Bacteria 625
151 Ga0207674_11541245 3300026116 Bacteria 633
152 Ga0207698_10128442 3300026142 Bacteria 2161
153 Ga0207698_10405865 3300026142 Unclassified 1303
154 Ga0207698_10787469 3300026142 Bacteria 952
155 Ga0265337_1043242 3300028556 Bacteria 1289
156 Ga0265337_1111684 3300028556 Bacteria 742
157 Ga0265326_10012087 3300028558 Bacteria 2540
158 Ga0265326_10172199 3300028558 Bacteria 620
159 Ga0265319_1010758 3300028563 Bacteria 3799
160 Ga0265334_10005330 3300028573 Bacteria 5618
161 Ga0265334_10197095 3300028573 Unclassified 700
162 Ga0265318_10003545 3300028577 Bacteria 7819
163 Ga0265318_10014189 3300028577 Bacteria 3349
164 Ga0265323_10012367 3300028653 Bacteria 3423
165 Ga0265322_10003122 3300028654 Bacteria 5048
166 Ga0265322_10025118 3300028654 Bacteria 1704
167 Ga0265338_10043571 3300028800 Bacteria 4159
168 Ga0265338_10063842 3300028800 Bacteria 3208
169 Ga0265338_10120005 3300028800 Unclassified 2098
170 Ga0265338_10276565 3300028800 Bacteria 1228
171 Ga0265324_10007471 3300029957 Bacteria 4421
172 Ga0265330_10003912 3300031235 Bacteria 7660
173 Ga0265330_10527486 3300031235 Bacteria 503
174 Ga0265332_10019883 3300031238 Bacteria 2964
175 Ga0265328_10000908 3300031239 Bacteria 13679
176 Ga0265328_10168167 3300031239 Unclassified 828
177 Ga0265320_10036628 3300031240 Bacteria 2477
178 Ga0265320_10324975 3300031240 Bacteria 680
179 Ga0265320_10457462 3300031240 Unclassified 563
180 Ga0265325_10002171 3300031241 Bacteria 13375
181 Ga0265325_10123601 3300031241 Unclassified 1245
182 Ga0265329_10009965 3300031242 Bacteria 3515
183 Ga0265329_10069976 3300031242 Bacteria 1109
184 Ga0265340_10043820 3300031247 Bacteria 2192
185 Ga0265340_10107320 3300031247 Bacteria 1293
186 Ga0265339_10009175 3300031249 Bacteria 6240
187 Ga0265339_10271128 3300031249 Unclassified 816
188 Ga0265331_10011569 3300031250 Bacteria 4827
189 Ga0265327_10029825 3300031251 Bacteria 3095
190 Ga0265327_10133386 3300031251 Bacteria 1166
191 Ga0265316_10015171 3300031344 Bacteria 6747
192 Ga0265316_10026895 3300031344 Bacteria 4774
193 Ga0265313_10049613 3300031595 Bacteria 2018
194 Ga0265314_10013091 3300031711 Bacteria 6723
195 Ga0265342_10012095 3300031712 Bacteria 5858
196 Ga0265342_10270338 3300031712 Bacteria 902
197 Ga0316583_10033339 3300032133 Bacteria 1830
198 Ga0316583_10075053 3300032133 Bacteria 1182
199 Ga0373947_0561129 3300035725 Bacteria 777
200 Ga0373925_0057759 3300037068 Bacteria 2908
201 Ga0395899_0014799 3300037312 Bacteria 5954
202 Ga0395899_0276254 3300037312 Bacteria 1144
203 Ga0395899_0497564 3300037312 Bacteria 791
204 Ga0395900_0100145 3300037418 Bacteria 2976
205 Ga0395900_0185586 3300037418 Bacteria 2111
206 Ga0395900_0288058 3300037418 Bacteria 1632
207 Ga0395900_0721988 3300037418 Unclassified 929
208 Ga0395900_0852836 3300037418 Bacteria 836
209 Ga0395900_0862920 3300037418 Unclassified 830
210 Ga0395900_0908539 3300037418 Unclassified 803
211 Ga0395900_1749701 3300037418 Bacteria 532
212 Ga0395898_0061967 3300037466 Bacteria 3633
213 Ga0395898_0094179 3300037466 Bacteria 2878
214 Ga0395898_0134588 3300037466 Bacteria 2366
215 Ga0395898_0186376 3300037466 Bacteria 1983
216 Ga0395898_0199301 3300037466 Bacteria 1912
217 Ga0395898_0565255 3300037466 Bacteria 1080
218 Ga0395898_1446231 3300037466 Unclassified 614
219 Ga0395905_0020037 3300037471 Bacteria 6337
220 Ga0395905_0022195 3300037471 Bacteria 6005
221 Ga0395901_0022548 3300038443 Bacteria 6454
222 Ga0395901_0070426 3300038443 Bacteria 3643
223 Ga0395901_0193711 3300038443 Unclassified 2131
224 Ga0395901_1056482 3300038443 Bacteria 785
225 Ga0395901_1494883 3300038443 Bacteria 631
226 Ga0395901_1998620 3300038443 Bacteria 526
227 Ga0436360_0741409 3300039438 Bacteria 7115
228 Ga0436360_0746441 3300039438 Bacteria 588
229 Ga0451789_0349142 3300041443 Unclassified 577
230 Ga0451802_2086249 3300041460 Bacteria 677
231 Ga0451853_0022410 3300041512 Bacteria 536
232 Ga0451853_3031509 3300041512 Bacteria 829
233 Ga0466969_0009852 3300044656 Bacteria 5067
234 Ga0466966_0010565 3300044684 Bacteria 6137
235 Ga0466966_0033795 3300044684 Bacteria 3310
236 Ga0466966_0305173 3300044684 Bacteria 957
237 Ga0466961_0102190 3300044693 Bacteria 1805
238 Ga0466961_0211574 3300044693 Bacteria 1197
239 Ga0466963_0014427 3300044694 Bacteria 4871
240 Ga0466963_0295756 3300044694 Bacteria 1138
241 Ga0466963_0727036 3300044694 Bacteria 700
242 Ga0466964_0477365 3300044706 Bacteria 666
243 Ga0466971_0005088 3300044719 Bacteria 5696
244 Ga0466957_0095483 3300044842 Bacteria 1867
245 Ga0466957_0302748 3300044842 Bacteria 1075
246 Ga0466957_1274246 3300044842 Unclassified 533
247 Ga0466959_0034443 3300045049 Bacteria 3745
248 Ga0466959_0104348 3300045049 Bacteria 2028
249 Ga0466959_1049158 3300045049 Bacteria 542
250 Ga0466958_0006291 3300045836 Bacteria 6452
251 Ga0466958_0180025 3300045836 Bacteria 1341
252 Ga0466967_0311963 3300045976 Bacteria 1515
253 Ga0466967_0327636 3300045976 Bacteria 1478
254 Ga0466967_0491035 3300045976 Bacteria 1204
255 Ga0466967_1959704 3300045976 Bacteria 582
256 Ga0495603_0009435 3300046455 Bacteria 5898
257 Ga0495629_0123890 3300046459 Bacteria 1800
258 Ga0495629_1005390 3300046459 Unclassified 543
259 Ga0495641_0107104 3300046461 Bacteria 1247
260 Ga0495651_0618690 3300046462 Bacteria 681
261 Ga0495653_0015369 3300046463 Bacteria 6238
262 Ga0495653_0141654 3300046463 Bacteria 1690
263 Ga0495653_0158865 3300046463 Bacteria 1571
264 Ga0495582_0082973 3300046473 Bacteria 1781
265 Ga0495639_0190524 3300046475 Bacteria 1001
266 Ga0495662_0662640 3300046476 Bacteria 509
267 Ga0495608_0378304 3300046511 Unclassified 868
268 Ga0495628_0007369 3300046516 Bacteria 9522
269 Ga0495630_0360733 3300046517 Bacteria 1112
270 Ga0495630_0695423 3300046517 Bacteria 778
271 Ga0495652_0036009 3300046529 Bacteria 4305
272 Ga0495652_0977262 3300046529 Unclassified 555
273 Ga0495640_0919956 3300046533 Unclassified 518
274 Ga0495586_0061970 3300046535 Bacteria 2036
275 Ga0495587_0115808 3300046536 Bacteria 1537
276 Ga0495645_0038607 3300046543 Bacteria 3482
277 Ga0495622_0299158 3300046557 Bacteria 701
278 Ga0495667_0115113 3300046559 Bacteria 1737
279 Ga0495667_0323517 3300046559 Unclassified 976
280 Ga0495634_0050502 3300046642 Bacteria 2792
281 Ga0495634_0664782 3300046642 Unclassified 601
282 Ga0495635_0161257 3300046663 Bacteria 1526
283 Ga0495635_0197156 3300046663 Bacteria 1366
284 Ga0495635_0692986 3300046663 Bacteria 661
285 Ga0495657_0044155 3300046675 Bacteria 3034
286 Ga0495657_0564313 3300046675 Unclassified 660
287 Ga0495599_0109428 3300046678 Bacteria 1721
288 Ga0495599_0327164 3300046678 Unclassified 922
289 Ga0495658_0091212 3300046683 Bacteria 1804
290 Ga0495613_0068975 3300046689 Bacteria 2578
291 Ga0495613_0097592 3300046689 Bacteria 2124
292 Ga0495613_0601475 3300046689 Unclassified 732
293 Ga0495600_0046393 3300046809 Bacteria 2835
294 Ga0495604_0807026 3300047317 Bacteria 591
295 Ga0495674_0159584 3300047319 Bacteria 1887
296 Ga0495674_0445047 3300047319 Unclassified 1042
297 Ga0495676_0017948 3300047321 Bacteria 6244
298 Ga0495680_0034738 3300047322 Bacteria 4068
299 Ga0495680_0202062 3300047322 Bacteria 1425
300 Ga0495680_0288499 3300047322 Bacteria 1155
301 Ga0495680_0324794 3300047322 Bacteria 1076
302 Ga0495593_0324562 3300047673 Unclassified 769
303 Ga0495602_0064594 3300048088 Bacteria 3163
304 Ga0496100_0186894 3300048903 Bacteria 1502
305 Ga0496100_1224074 3300048903 Unclassified 592
306 Ga0496101_0316123 3300048904 Bacteria 1225
307 Ga0496101_1573755 3300048904 Unclassified 511
308 Ga0496102_1845578 3300048905 Bacteria 521
309 Ga0496103_0270685 3300048906 Unclassified 1093
310 Ga0496104_0803546 3300048907 Bacteria 847
311 Ga0496104_1611246 3300048907 Bacteria 552
312 Ga0496104_1703624 3300048907 Unclassified 533
313 Ga0496105_0268153 3300048908 Unclassified 1379
314 Ga0496106_0018196 3300048909 Bacteria 5196
315 Ga0496107_0006357 3300048910 Bacteria 8120
316 Ga0496108_0118507 3300048911 Unclassified 2269
317 Ga0496108_0360003 3300048911 Bacteria 1270
318 Ga0496108_1065840 3300048911 Unclassified 688
319 Ga0496109_0669576 3300048912 Bacteria 975
320 Ga0496109_1205370 3300048912 Bacteria 694
321 Ga0496110_0104230 3300048913 Bacteria 2545
322 Ga0496110_0109999 3300048913 Unclassified 2475
323 Ga0496110_1011512 3300048913 Unclassified 739
324 Ga0496112_0036874 3300048915 Bacteria 4770
325 Ga0496112_0045135 3300048915 Bacteria 4320
326 Ga0496112_0059220 3300048915 Bacteria 3773
327 Ga0496112_0070895 3300048915 Bacteria 3444
328 Ga0496112_0466865 3300048915 Bacteria 1199
329 Ga0496112_1047300 3300048915 Unclassified 735
330 Ga0496112_1291927 3300048915 Bacteria 645
331 Ga0496113_0033309 3300048916 Bacteria 3751
332 Ga0496113_1139678 3300048916 Bacteria 611
333 Ga0496114_0071516 3300048917 Bacteria 2916
334 Ga0501034_0005741 3300049571 Bacteria 13496
335 Ga0501047_0213028 3300049581 Bacteria 1790
336 Ga0501067_0004898 3300049583 Bacteria 7437
337 Ga0501068_0510646 3300049584 Bacteria 780
338 Ga0501069_0151355 3300049585 Bacteria 1333
339 Ga0501069_0554253 3300049585 Bacteria 688
340 Ga0501070_0009660 3300049586 Bacteria 8156
341 Ga0501070_0032810 3300049586 Bacteria 4344
342 Ga0501072_0339325 3300049588 Bacteria 1193
343 Ga0501073_0048253 3300049589 Bacteria 2989
344 Ga0501073_0106011 3300049589 Bacteria 1950
345 Ga0501074_0008242 3300049590 Bacteria 7557
346 Ga0501074_0009246 3300049590 Bacteria 7158
347 Ga0501079_0070288 3300049741 Bacteria 2703
348 Ga0501080_0007666 3300049742 Bacteria 9758
349 Ga0501080_0114048 3300049742 Bacteria 2505
350 Ga0501080_0292199 3300049742 Bacteria 1480
351 Ga0501083_0003877 3300049744 Bacteria 10504
352 Ga0501083_0229826 3300049744 Bacteria 1208
353 Ga0501044_1251926 3300049823 Bacteria 609
354 nmdc:mga08y16_436800_c1 3300050511 Bacteria 1336
355 nmdc:mga0n895_392709_c1 3300050512 Bacteria 1403
356 nmdc:mga0n895_527494_c1 3300050512 Unclassified 1188
357 nmdc:mga0a205_640954_c1 3300050515 Unclassified 914
358 Ga0495601_0014402 3300053077 Bacteria 4765
359 Ga0495601_0872759 3300053077 Unclassified 569
360 Ga0495612_0099156 3300053078 Bacteria 1239
361 Ga0495595_0002546 3300053084 Bacteria 7154
362 Ga0495595_0182304 3300053084 Bacteria 1041
363 Ga0495619_0017355 3300053085 Bacteria 4557
364 Ga0495619_0092687 3300053085 Bacteria 2047
365 Ga0501084_0182689 3300054114 Bacteria 1770
366 Ga0501082_0151086 3300060353 Bacteria 2017
367 Ga0466962_0047445 3300061719 Bacteria 2052
368 Ga0466962_0232896 3300061719 Bacteria 903
369 Ga0075433_10258058
370 Ga0070658_10004145
371 Ga0070658_10063970
372 Ga0070658_10234713
373 Ga0070683_100033304
374 Ga0070683_101212312
375 Ga0070680_100178164
376 Ga0070680_100182550
377 Ga0070680_100444642
378 Ga0070682_100005200
379 Ga0070660_100008592
380 Ga0070660_100045142
381 Ga0070660_100055361
382 Ga0070660_100248414
383 Ga0070661_100058855
384 Ga0070659_100107364
385 Ga0070659_100418348
386 Ga0070659_101463357
387 Ga0070709_10172611
388 Ga0070709_10797444
389 Ga0070714_100022060
390 Ga0070714_100371296
391 Ga0070714_101357553
392 Ga0070705_100714793
393 Ga0070681_10011312
394 Ga0070681_10038054
395 Ga0070681_10062851
396 Ga0070681_10370535
397 Ga0070681_10422428
398 Ga0070681_11633215
399 Ga0070706_100677360
400 Ga0070707_100133572
401 Ga0070698_100074590
402 Ga0070699_101124541
403 Ga0070699_101253948
404 Ga0070679_100091994
405 Ga0070679_100092160
406 Ga0070679_100217198
407 Ga0070679_100310988
408 Ga0070679_101188199
409 Ga0070679_101942069
410 Ga0070684_100202394
411 Ga0070684_100519360
412 Ga0070684_100577618
413 Ga0070697_100113887
414 Ga0070697_101008978
415 Ga0068853_101557649
416 Ga0070695_100841657
417 Ga0070695_101067141
418 Ga0070695_101160056
419 Ga0070696_100969643
420 Ga0068855_100219192
421 Ga0068855_100250076
422 Ga0068855_100305276
423 Ga0068855_102119144
424 Ga0068854_100822821
425 Ga0068852_100134954
426 Ga0068852_100210846
427 Ga0068852_100961955
428 Ga0068851_10421385
429 Ga0068851_10866923
430 Ga0070715_10241616
431 Ga0070712_100246394
432 Ga0070712_101551652
433 Ga0075433_11374762
434 Ga0075434_100386922
435 Ga0105240_10680146
436 Ga0105240_10853638
437 Ga0111539_11064338
438 Ga0114129_13103440
439 Ga0105249_12301786
440 Ga0157373_10610941
441 Ga0157373_10630234
442 Ga0157373_10740773
443 Ga0157373_10802654
444 Ga0157371_10292889
445 Ga0157371_10586104
446 Ga0157370_10006447
447 Ga0157370_10121797
448 Ga0157370_10498319
449 Ga0157369_10019193
450 Ga0157369_10043198
451 Ga0157369_10127978
452 Ga0157369_10510345
453 Ga0157369_11356392
454 Ga0157369_11425819
455 Ga0157374_11326908
456 Ga0157372_10218808
457 Ga0157372_10736590
458 Ga0157372_11892010
459 Ga0182008_10241194
460 Ga0182007_10177650
461 Ga0206356_10506402
462 Ga0206356_10942301
463 Ga0206354_10478962
464 Ga0206354_10844404
465 Ga0206353_10049987
466 Ga0206353_10628334
467 Ga0206353_10683122
468 Ga0206353_10943226
469 Ga0206353_11119038
470 Ga0206353_12014982
471 Ga0213871_10080392
472 Ga0207656_10218725
473 Ga0207699_10150003
474 Ga0207705_10142758
475 Ga0207705_10871144
476 Ga0207705_10999921
477 Ga0207707_10013319
478 Ga0207707_10025443
479 Ga0207707_10066270
480 Ga0207707_10170756
481 Ga0207707_10882645
482 Ga0207707_10920314
483 Ga0207695_10054347
484 Ga0207695_11330861
485 Ga0207693_10144262
486 Ga0207693_10388357
487 Ga0207660_10295160
488 Ga0207660_10534083
489 Ga0207657_10004357
490 Ga0207657_10004556
491 Ga0207657_10016836
492 Ga0207657_10019998
493 Ga0207649_10053535
494 Ga0207652_10033006
495 Ga0207652_10431493
496 Ga0207652_10774377
497 Ga0207652_10810880
498 Ga0207652_11248757
499 Ga0207646_10382432
500 Ga0207646_11247521
501 Ga0207664_10019393
502 Ga0207664_10045017
503 Ga0207664_10449506
504 Ga0207664_10816085
505 Ga0207690_10184109
506 Ga0207690_10661776
507 Ga0207665_10164151
508 Ga0207665_11327535
509 Ga0207661_10033277
510 Ga0207661_10500969
511 Ga0207667_10124872
512 Ga0207667_10168165
513 Ga0207667_11910104
514 Ga0207640_10681287
515 Ga0207639_10862215
516 Ga0207678_10592815
517 Ga0207678_10749188
518 Ga0207702_11692456
519 Ga0207674_11541245
520 Ga0207698_10128442
521 Ga0207698_10405865
522 Ga0207698_10787469
523 Ga0265337_1043242
524 Ga0265337_1111684
525 Ga0265326_10012087
526 Ga0265326_10172199
527 Ga0265319_1010758
528 Ga0265334_10005330
529 Ga0265334_10197095
530 Ga0265318_10003545
531 Ga0265318_10014189
532 Ga0265323_10012367
533 Ga0265322_10003122
534 Ga0265322_10025118
535 Ga0265338_10043571
536 Ga0265338_10063842
537 Ga0265338_10120005
538 Ga0265338_10276565
539 Ga0265324_10007471
540 Ga0265330_10003912
541 Ga0265330_10527486
542 Ga0265332_10019883
543 Ga0265328_10000908
544 Ga0265328_10168167
545 Ga0265320_10036628
546 Ga0265320_10324975
547 Ga0265320_10457462
548 Ga0265325_10002171
549 Ga0265325_10123601
550 Ga0265329_10009965
551 Ga0265329_10069976
552 Ga0265340_10043820
553 Ga0265340_10107320
554 Ga0265339_10009175
555 Ga0265339_10271128
556 Ga0265331_10011569
557 Ga0265327_10029825
558 Ga0265327_10133386
559 Ga0265316_10015171
560 Ga0265316_10026895
561 Ga0265313_10049613
562 Ga0265314_10013091
563 Ga0265342_10012095
564 Ga0265342_10270338
565 Ga0316583_10033339
566 Ga0316583_10075053
567 Ga0373947_0561129
568 Ga0373925_0057759
569 Ga0395899_0014799
570 Ga0395899_0276254
571 Ga0395899_0497564
572 Ga0395900_0100145
573 Ga0395900_0185586
574 Ga0395900_0288058
575 Ga0395900_0721988
576 Ga0395900_0852836
577 Ga0395900_0862920
578 Ga0395900_0908539
579 Ga0395900_1749701
580 Ga0395898_0061967
581 Ga0395898_0094179
582 Ga0395898_0134588
583 Ga0395898_0186376
584 Ga0395898_0199301
585 Ga0395898_0565255
586 Ga0395898_1446231
587 Ga0395905_0020037
588 Ga0395905_0022195
589 Ga0395901_0022548
590 Ga0395901_0070426
591 Ga0395901_0193711
592 Ga0395901_1056482
593 Ga0395901_1494883
594 Ga0395901_1998620
595 Ga0436360_0741409
596 Ga0436360_0746441
597 Ga0451789_0349142
598 Ga0451802_2086249
599 Ga0451853_0022410
600 Ga0451853_3031509
601 Ga0466969_0009852
602 Ga0466966_0010565
603 Ga0466966_0033795
604 Ga0466966_0305173
605 Ga0466961_0102190
606 Ga0466961_0211574
607 Ga0466963_0014427
608 Ga0466963_0295756
609 Ga0466963_0727036
610 Ga0466964_0477365
611 Ga0466971_0005088
612 Ga0466957_0095483
613 Ga0466957_0302748
614 Ga0466957_1274246
615 Ga0466959_0034443
616 Ga0466959_0104348
617 Ga0466959_1049158
618 Ga0466958_0006291
619 Ga0466958_0180025
620 Ga0466967_0311963
621 Ga0466967_0327636
622 Ga0466967_0491035
623 Ga0466967_1959704
624 Ga0495603_0009435
625 Ga0495629_0123890
626 Ga0495629_1005390
627 Ga0495641_0107104
628 Ga0495651_0618690
629 Ga0495653_0015369
630 Ga0495653_0141654
631 Ga0495653_0158865
632 Ga0495582_0082973
633 Ga0495639_0190524
634 Ga0495662_0662640
635 Ga0495608_0378304
636 Ga0495628_0007369
637 Ga0495630_0360733
638 Ga0495630_0695423
639 Ga0495652_0036009
640 Ga0495652_0977262
641 Ga0495640_0919956
642 Ga0495586_0061970
643 Ga0495587_0115808
644 Ga0495645_0038607
645 Ga0495622_0299158
646 Ga0495667_0115113
647 Ga0495667_0323517
648 Ga0495634_0050502
649 Ga0495634_0664782
650 Ga0495635_0161257
651 Ga0495635_0197156
652 Ga0495635_0692986
653 Ga0495657_0044155
654 Ga0495657_0564313
655 Ga0495599_0109428
656 Ga0495599_0327164
657 Ga0495658_0091212
658 Ga0495613_0068975
659 Ga0495613_0097592
660 Ga0495613_0601475
661 Ga0495600_0046393
662 Ga0495604_0807026
663 Ga0495674_0159584
664 Ga0495674_0445047
665 Ga0495676_0017948
666 Ga0495680_0034738
667 Ga0495680_0202062
668 Ga0495680_0288499
669 Ga0495680_0324794
670 Ga0495593_0324562
671 Ga0495602_0064594
672 Ga0496100_0186894
673 Ga0496100_1224074
674 Ga0496101_0316123
675 Ga0496101_1573755
676 Ga0496102_1845578
677 Ga0496103_0270685
678 Ga0496104_0803546
679 Ga0496104_1611246
680 Ga0496104_1703624
681 Ga0496105_0268153
682 Ga0496106_0018196
683 Ga0496107_0006357
684 Ga0496108_0118507
685 Ga0496108_0360003
686 Ga0496108_1065840
687 Ga0496109_0669576
688 Ga0496109_1205370
689 Ga0496110_0104230
690 Ga0496110_0109999
691 Ga0496110_1011512
692 Ga0496112_0036874
693 Ga0496112_0045135
694 Ga0496112_0059220
695 Ga0496112_0070895
696 Ga0496112_0466865
697 Ga0496112_1047300
698 Ga0496112_1291927
699 Ga0496113_0033309
700 Ga0496113_1139678
701 Ga0496114_0071516
702 Ga0501034_0005741
703 Ga0501047_0213028
704 Ga0501067_0004898
705 Ga0501068_0510646
706 Ga0501069_0151355
707 Ga0501069_0554253
708 Ga0501070_0009660
709 Ga0501070_0032810
710 Ga0501072_0339325
711 Ga0501073_0048253
712 Ga0501073_0106011
713 Ga0501074_0008242
714 Ga0501074_0009246
715 Ga0501079_0070288
716 Ga0501080_0007666
717 Ga0501080_0114048
718 Ga0501080_0292199
719 Ga0501083_0003877
720 Ga0501083_0229826
721 Ga0501044_1251926
722 nmdc:mga08y16_436800_c1
723 nmdc:mga0n895_392709_c1
724 nmdc:mga0n895_527494_c1
725 nmdc:mga0a205_640954_c1
726 Ga0495601_0014402
727 Ga0495601_0872759
728 Ga0495612_0099156
729 Ga0495595_0002546
730 Ga0495595_0182304
731 Ga0495619_0017355
732 Ga0495619_0092687
733 Ga0501084_0182689
734 Ga0501082_0151086
735 Ga0466962_0047445
736 Ga0466962_0232896

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qei-assembly1.cif.gz_A-2 two distinct conformational states of glyrs captured in crystal lattice 0.6524 31 58
5hyz-assembly1.cif.gz_A-2 crystal structure of scl7 in oryza sativa 0.6502 1 39
4x5o-assembly1.cif.gz_B human histidine trna synthetase 0.5925 13 59
5e6m-assembly1.cif.gz_B crystal structure of human wild type glyrs bound with trnagly 0.5894 31 78
7z31-assembly1.cif.gz_I structure of yeast rna polymerase iii-ty1 integrase complex at 2.7 a (focus subunit c11, no c11 c-terminal zn-ribbon in the funnel pore). 0.5595 23 47
ID Description Score Start End Superfamily
af_P36678_1_152_3.30.1360.100 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;General secretion pathway protein M, EpsM 0.7797 1 35 3.30.1360.100
af_Q06817_503_612_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.7259 32 55 3.40.50.800
4q15A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.6523 23 56 3.40.50.800
af_Q9VUK8_646_762_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.6438 28 58 3.40.50.800
1nj6A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.6236 22 58 3.40.50.800
ID Description Score Start End GO Terms
AF-A0A7V9CUA5-F1-model_v4 Uncharacterized protein 0.9858 6 80
AF-A0A537TK28-F1-model_v4 Uncharacterized protein 0.9842 4 80
AF-A0A2V2ST57-F1-model_v4 deleted 0.9512 1 80
AF-A0A538JIJ9-F1-model_v4 Uncharacterized protein 0.9439 1 78
AF-A0A2V2ST57-F1-model_v4 deleted 0.9283 1 80

Map