F424477

General Info

Members Datasets Scaffolds Average Seq Length
367 212 734 121

Family's Representative Sequence

Representative Sequence 3300047319|Ga0495674_0185899|Ga0495674_0185899_928_1323
Length 131
Sequence MDNRFPMGDCMASITGFGGIFLRADDPKALYQWYERHLGLVMSDGSFAFPASTQRAQVIFALFKQDNAYFPPAQKAMINLHVDDLDGVLDRLIDEGVTVDPKRESYDFGKFGWITDPEGNRVELWQPVATD

Samples

Sample ID Description Type Environment
1 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
117 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
118 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
124 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
125 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
142 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
143 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
159 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
160 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
164 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
165 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
166 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
182 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
190 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
198 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
199 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
211 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
212 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.09
Metatranscriptomes 1.91
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.09
Nodule 0
Rhizoplane 0.54
Rhizosphere 92.92
Stem 0
Stem Tuber 0
Unclassified 9.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495674_0185899 3300047319 Bacteria 1729
2 JGI24743J22301_10028217 3300001991 Unclassified 1098
3 rootH1_10089238 3300003316 Bacteria 3032
4 rootL2_10116133 3300003322 Bacteria 4165
5 Ga0070658_10053929 3300005327 Bacteria 3264
6 Ga0070683_100007565 3300005329 Bacteria 9184
7 Ga0070683_100054447 3300005329 Bacteria 3709
8 Ga0070670_100155548 3300005331 Bacteria 1980
9 Ga0068869_100091898 3300005334 Bacteria 2283
10 Ga0070666_10068118 3300005335 Bacteria 2418
11 Ga0070666_10838578 3300005335 Unclassified 678
12 Ga0070666_11006897 3300005335 Bacteria 618
13 Ga0068868_100134771 3300005338 Bacteria 2023
14 Ga0068868_100700574 3300005338 Bacteria 906
15 Ga0070661_100114112 3300005344 Bacteria 2019
16 Ga0070668_101193739 3300005347 Bacteria 689
17 Ga0070671_100002115 3300005355 Bacteria 15325
18 Ga0070671_100031450 3300005355 Bacteria 4384
19 Ga0070671_101623982 3300005355 Bacteria 573
20 Ga0070673_100391336 3300005364 Bacteria 1241
21 Ga0070667_100025371 3300005367 Bacteria 4928
22 Ga0070667_100062307 3300005367 Bacteria 3159
23 Ga0070709_10766064 3300005434 Unclassified 755
24 Ga0070714_100110116 3300005435 Bacteria 2437
25 Ga0070713_100134310 3300005436 Bacteria 2185
26 Ga0070710_10165190 3300005437 Bacteria 1375
27 Ga0070710_10556682 3300005437 Unclassified 793
28 Ga0070711_100095756 3300005439 Bacteria 2149
29 Ga0070663_100058190 3300005455 Bacteria 2775
30 Ga0070681_10088709 3300005458 Bacteria 3044
31 Ga0068867_102047382 3300005459 Unclassified 542
32 Ga0070679_100002203 3300005530 Bacteria 17607
33 Ga0070679_101300109 3300005530 Unclassified 673
34 Ga0070684_100093652 3300005535 Bacteria 2674
35 Ga0070684_100420646 3300005535 Bacteria 1233
36 Ga0070697_102036830 3300005536 Bacteria 514
37 Ga0068853_100020566 3300005539 Bacteria 5490
38 Ga0070686_100192572 3300005544 Bacteria 1456
39 Ga0070665_100027705 3300005548 Bacteria 5704
40 Ga0070665_100033923 3300005548 Bacteria 5134
41 Ga0070665_100084688 3300005548 Bacteria 3175
42 Ga0070665_100136537 3300005548 Bacteria 2455
43 Ga0068855_100824923 3300005563 Unclassified 984
44 Ga0068855_101262385 3300005563 Bacteria 766
45 Ga0070664_100581534 3300005564 Bacteria 1038
46 Ga0068857_100001160 3300005577 Bacteria 20581
47 Ga0068857_100025652 3300005577 Bacteria 5189
48 Ga0068854_100734114 3300005578 Unclassified 855
49 Ga0068856_100006406 3300005614 Bacteria 11550
50 Ga0068856_100174087 3300005614 Bacteria 2165
51 Ga0068856_100356115 3300005614 Unclassified 1482
52 Ga0068856_101466415 3300005614 Bacteria 696
53 Ga0068852_100151006 3300005616 Bacteria 2160
54 Ga0068852_100244198 3300005616 Bacteria 1717
55 Ga0068852_100300233 3300005616 Unclassified 1554
56 Ga0068852_100400477 3300005616 Unclassified 1350
57 Ga0068859_100004546 3300005617 Bacteria 14147
58 Ga0068864_100175782 3300005618 Bacteria 1955
59 Ga0068864_100632990 3300005618 Bacteria 1040
60 Ga0068866_11253558 3300005718 Unclassified 537
61 Ga0068851_10036490 3300005834 Bacteria 2461
62 Ga0068863_100023526 3300005841 Bacteria 5881
63 Ga0068863_100127481 3300005841 Bacteria 2429
64 Ga0068858_100049834 3300005842 Bacteria 3877
65 Ga0068858_101163053 3300005842 Bacteria 758
66 Ga0068860_100000794 3300005843 Bacteria 35433
67 Ga0068860_100224215 3300005843 Bacteria 1826
68 Ga0068862_100195184 3300005844 Bacteria 1823
69 Ga0070717_10251698 3300006028 Bacteria 1561
70 Ga0070717_10747830 3300006028 Bacteria 889
71 Ga0070717_10751358 3300006028 Unclassified 887
72 Ga0070716_100993843 3300006173 Bacteria 663
73 Ga0070712_100048598 3300006175 Bacteria 2941
74 Ga0097621_100172273 3300006237 Bacteria 1866
75 Ga0068871_100005298 3300006358 Bacteria 9030
76 Ga0097620_100004546 3300006931 Bacteria 14147
77 Ga0075435_100055238 3300007076 Bacteria 3207
78 Ga0105240_10012799 3300009093 Bacteria 11560
79 Ga0105240_10032349 3300009093 Bacteria 6774
80 Ga0105240_10893236 3300009093 Bacteria 956
81 Ga0105245_10000823 3300009098 Bacteria 28285
82 Ga0105245_10658590 3300009098 Bacteria 1078
83 Ga0105247_10004945 3300009101 Bacteria 8471
84 Ga0105243_11539950 3300009148 Unclassified 690
85 Ga0105241_10006528 3300009174 Bacteria 8597
86 Ga0105241_10018288 3300009174 Bacteria 5154
87 Ga0105241_10086893 3300009174 Bacteria 2460
88 Ga0105248_10006297 3300009177 Bacteria 13023
89 Ga0105248_10010351 3300009177 Bacteria 10268
90 Ga0105248_10041372 3300009177 Bacteria 5166
91 Ga0105248_10124212 3300009177 Bacteria 2911
92 Ga0105248_10346597 3300009177 Bacteria 1672
93 Ga0105237_10017511 3300009545 Bacteria 7425
94 Ga0105237_10543022 3300009545 Bacteria 1169
95 Ga0105238_10009985 3300009551 Bacteria 9519
96 Ga0105238_10013374 3300009551 Bacteria 8282
97 Ga0105238_10960899 3300009551 Bacteria 874
98 Ga0105249_10762677 3300009553 Bacteria 1030
99 Ga0105239_10059945 3300010375 Bacteria 4176
100 Ga0105239_10440736 3300010375 Unclassified 1477
101 Ga0105239_10788587 3300010375 Bacteria 1088
102 Ga0105239_11671139 3300010375 Bacteria 737
103 Ga0105246_10002271 3300011119 Bacteria 11598
104 Ga0157371_11289403 3300013102 Unclassified 565
105 Ga0157370_10018471 3300013104 Bacteria 7010
106 Ga0157369_10004548 3300013105 Bacteria 16312
107 Ga0157369_10008554 3300013105 Bacteria 11736
108 Ga0157369_10146281 3300013105 Bacteria 2499
109 Ga0157369_10341498 3300013105 Bacteria 1555
110 Ga0157374_10009539 3300013296 Bacteria 8335
111 Ga0157374_10011329 3300013296 Bacteria 7715
112 Ga0157374_10012948 3300013296 Bacteria 7270
113 Ga0157374_10272343 3300013296 Bacteria 1670
114 Ga0157374_12409093 3300013296 Bacteria 554
115 Ga0157378_10034899 3300013297 Bacteria 4447
116 Ga0157378_10264682 3300013297 Bacteria 1651
117 Ga0157378_11496281 3300013297 Bacteria 720
118 Ga0163162_10031111 3300013306 Bacteria 5291
119 Ga0163162_10035067 3300013306 Bacteria 4995
120 Ga0163162_10207057 3300013306 Bacteria 2091
121 Ga0163162_10293690 3300013306 Bacteria 1757
122 Ga0163162_11855019 3300013306 Unclassified 690
123 Ga0157372_10009955 3300013307 Bacteria 10110
124 Ga0157372_10061398 3300013307 Bacteria 4209
125 Ga0157372_10076517 3300013307 Bacteria 3779
126 Ga0157375_10086356 3300013308 Bacteria 3188
127 Ga0157375_12921219 3300013308 Unclassified 571
128 Ga0163163_10001776 3300014325 Bacteria 18190
129 Ga0163163_10006722 3300014325 Bacteria 10080
130 Ga0163163_12432742 3300014325 Unclassified 582
131 Ga0157379_10009206 3300014968 Bacteria 8600
132 Ga0157379_10350283 3300014968 Bacteria 1352
133 Ga0157379_10477469 3300014968 Bacteria 1153
134 Ga0157379_12202865 3300014968 Bacteria 547
135 Ga0157379_12274285 3300014968 Unclassified 539
136 Ga0157376_10001272 3300014969 Bacteria 16562
137 Ga0157376_10052921 3300014969 Bacteria 3378
138 Ga0157376_10056683 3300014969 Bacteria 3275
139 Ga0157376_10535713 3300014969 Bacteria 1156
140 Ga0157376_10593636 3300014969 Bacteria 1101
141 Ga0213875_10250165 3300021388 Bacteria 836
142 Ga0213875_10393236 3300021388 Bacteria 661
143 Ga0209233_1034170 3300025261 Bacteria 1160
144 Ga0207656_10076805 3300025321 Bacteria 1494
145 Ga0207692_10436972 3300025898 Bacteria 822
146 Ga0207710_10003973 3300025900 Bacteria 6521
147 Ga0207680_10166592 3300025903 Unclassified 1481
148 Ga0207680_10555001 3300025903 Bacteria 820
149 Ga0207680_10973186 3300025903 Bacteria 608
150 Ga0207647_10359046 3300025904 Unclassified 824
151 Ga0207685_10187055 3300025905 Bacteria 964
152 Ga0207705_10070471 3300025909 Bacteria 2534
153 Ga0207705_11059893 3300025909 Unclassified 625
154 Ga0207654_10006723 3300025911 Bacteria 5781
155 Ga0207654_10193177 3300025911 Unclassified 1336
156 Ga0207707_10035905 3300025912 Bacteria 4334
157 Ga0207695_10005225 3300025913 Bacteria 17358
158 Ga0207671_10000181 3300025914 Bacteria 96293
159 Ga0207671_10642805 3300025914 Bacteria 845
160 Ga0207693_10166349 3300025915 Bacteria 1736
161 Ga0207663_10013278 3300025916 Bacteria 4474
162 Ga0207663_10917674 3300025916 Bacteria 701
163 Ga0207649_10040903 3300025920 Bacteria 2820
164 Ga0207652_10002277 3300025921 Bacteria 16290
165 Ga0207694_10003144 3300025924 Bacteria 13201
166 Ga0207694_10036218 3300025924 Bacteria 3787
167 Ga0207694_10307401 3300025924 Bacteria 1306
168 Ga0207650_10243248 3300025925 Unclassified 1455
169 Ga0207687_10004077 3300025927 Bacteria 9795
170 Ga0207687_10368755 3300025927 Unclassified 1174
171 Ga0207700_10261206 3300025928 Bacteria 1483
172 Ga0207700_10341696 3300025928 Bacteria 1302
173 Ga0207644_10001775 3300025931 Bacteria 13958
174 Ga0207644_10310875 3300025931 Unclassified 1272
175 Ga0207686_10081595 3300025934 Bacteria 2111
176 Ga0207665_10274562 3300025939 Bacteria 1253
177 Ga0207711_10060946 3300025941 Bacteria 3253
178 Ga0207711_10398392 3300025941 Bacteria 1279
179 Ga0207689_10004361 3300025942 Bacteria 12881
180 Ga0207661_10009303 3300025944 Bacteria 7042
181 Ga0207661_10452884 3300025944 Bacteria 1169
182 Ga0207679_10101189 3300025945 Bacteria 2254
183 Ga0207667_10667420 3300025949 Unclassified 1044
184 Ga0207651_10637103 3300025960 Bacteria 935
185 Ga0207668_10153709 3300025972 Bacteria 1785
186 Ga0207668_10783711 3300025972 Bacteria 843
187 Ga0207640_10831964 3300025981 Unclassified 802
188 Ga0207658_10006104 3300025986 Bacteria 8226
189 Ga0207658_10143085 3300025986 Bacteria 1938
190 Ga0207677_10003820 3300026023 Bacteria 8008
191 Ga0207677_10379965 3300026023 Bacteria 1192
192 Ga0207677_11730757 3300026023 Bacteria 580
193 Ga0207703_10958537 3300026035 Unclassified 820
194 Ga0207703_11019252 3300026035 Bacteria 794
195 Ga0207639_10212513 3300026041 Bacteria 1666
196 Ga0207678_10032232 3300026067 Bacteria 4567
197 Ga0207678_10256111 3300026067 Bacteria 1499
198 Ga0207702_10012203 3300026078 Bacteria 7151
199 Ga0207702_10141237 3300026078 Bacteria 2179
200 Ga0207702_10309025 3300026078 Unclassified 1503
201 Ga0207702_10634064 3300026078 Bacteria 1050
202 Ga0207702_12408154 3300026078 Bacteria 513
203 Ga0207641_10141454 3300026088 Bacteria 2171
204 Ga0207641_10142307 3300026088 Bacteria 2165
205 Ga0207641_12623247 3300026088 Bacteria 502
206 Ga0207648_10793751 3300026089 Unclassified 881
207 Ga0207676_10050192 3300026095 Bacteria 3251
208 Ga0207676_11897219 3300026095 Bacteria 594
209 Ga0207674_10003665 3300026116 Bacteria 18738
210 Ga0207674_10012236 3300026116 Bacteria 9599
211 Ga0207698_10126581 3300026142 Bacteria 2174
212 Ga0207698_10265914 3300026142 Bacteria 1578
213 Ga0207698_10355404 3300026142 Bacteria 1385
214 Ga0207698_10356475 3300026142 Unclassified 1384
215 Ga0265354_1004738 3300028016 Bacteria 1409
216 Ga0265354_1023046 3300028016 Bacteria 594
217 Ga0265356_1004587 3300028017 Bacteria 1680
218 Ga0265357_1018239 3300028023 Bacteria 756
219 Ga0268266_10001930 3300028379 Bacteria 23319
220 Ga0268266_10003145 3300028379 Bacteria 16767
221 Ga0268266_10026261 3300028379 Bacteria 4956
222 Ga0268266_10168530 3300028379 Bacteria 1986
223 Ga0268266_12355076 3300028379 Bacteria 503
224 Ga0268265_10522369 3300028380 Bacteria 1122
225 Ga0268265_12350322 3300028380 Bacteria 540
226 Ga0268264_10074919 3300028381 Bacteria 2876
227 Ga0268264_10254526 3300028381 Bacteria 1633
228 Ga0265338_10001312 3300028800 Bacteria 40739
229 Ga0265324_10038030 3300029957 Bacteria 1671
230 Ga0307512_10322859 3300030522 Bacteria 701
231 Ga0265762_1141058 3300030760 Bacteria 566
232 Ga0265775_105625 3300030762 Bacteria 725
233 Ga0265766_1000101 3300030863 Bacteria 2816
234 Ga0265770_1005543 3300030878 Bacteria 1742
235 Ga0265765_1000534 3300030879 Bacteria 3036
236 Ga0265771_1005815 3300031010 Bacteria 796
237 Ga0265760_10015203 3300031090 Bacteria 2206
238 Ga0265339_10043296 3300031249 Bacteria 2490
239 Ga0307510_10010780 3300033180 Bacteria 10872
240 Ga0307510_10062304 3300033180 Bacteria 3812
241 Ga0316212_1000900 3300033547 Bacteria 3873
242 Ga0316212_1038942 3300033547 Bacteria 671
243 Ga0373931_0261157 3300035691 Bacteria 1057
244 Ga0436364_0146620 3300037853 Bacteria 1366
245 Ga0436364_0178690 3300037853 Bacteria 1562
246 Ga0436364_0213711 3300037853 Unclassified 2205
247 Ga0436364_0302517 3300037853 Bacteria 3758
248 Ga0436365_1431157 3300039437 Bacteria 1637
249 Ga0436360_0996019 3300039438 Bacteria 892
250 Ga0436363_0047472 3300039450 Bacteria 859
251 Ga0436363_0524243 3300039450 Bacteria 967
252 Ga0451577_0109829 3300042876 Bacteria 2466
253 Ga0466972_0170169 3300044658 Bacteria 1023
254 Ga0453683_0275297 3300044673 Bacteria 1074
255 Ga0453684_0137123 3300044712 Bacteria 2927
256 Ga0451576_0644295 3300045051 Bacteria 1113
257 Ga0495617_219044 3300046452 Bacteria 592
258 Ga0495592_0055374 3300046454 Bacteria 2935
259 Ga0495603_0000324 3300046455 Bacteria 25797
260 Ga0495638_0526901 3300046460 Bacteria 591
261 Ga0495651_0083642 3300046462 Bacteria 2406
262 Ga0495651_0171091 3300046462 Bacteria 1547
263 Ga0495650_0000006 3300046471 Bacteria 721347
264 Ga0495650_0015721 3300046471 Bacteria 3869
265 Ga0495580_0023634 3300046472 Bacteria 4510
266 Ga0495580_0352301 3300046472 Bacteria 997
267 Ga0495582_0096561 3300046473 Bacteria 1652
268 Ga0495582_0139105 3300046473 Bacteria 1375
269 Ga0495605_0011499 3300046474 Bacteria 4930
270 Ga0495662_0001851 3300046476 Bacteria 10607
271 Ga0495664_0055906 3300046477 Bacteria 2347
272 Ga0495664_0080647 3300046477 Bacteria 1950
273 Ga0495664_0252415 3300046477 Bacteria 1066
274 Ga0495585_0047777 3300046492 Bacteria 2382
275 Ga0495594_0000060 3300046499 Bacteria 47170
276 Ga0495594_0000794 3300046499 Bacteria 16298
277 Ga0495594_0016846 3300046499 Bacteria 3855
278 Ga0495596_0414252 3300046500 Bacteria 525
279 Ga0495583_0062229 3300046506 Bacteria 1662
280 Ga0495583_0165561 3300046506 Bacteria 910
281 Ga0495606_0027013 3300046507 Bacteria 4078
282 Ga0495606_0096751 3300046507 Bacteria 1805
283 Ga0495608_0267194 3300046511 Bacteria 1064
284 Ga0495628_0284065 3300046516 Bacteria 1228
285 Ga0495631_0124896 3300046518 Bacteria 1106
286 Ga0495643_0146272 3300046522 Bacteria 1174
287 Ga0495644_0000069 3300046523 Bacteria 50727
288 Ga0495666_0008353 3300046526 Bacteria 5189
289 Ga0495652_0036961 3300046529 Bacteria 4240
290 Ga0495652_0082913 3300046529 Bacteria 2641
291 Ga0495665_0007655 3300046531 Bacteria 5847
292 Ga0495586_0653084 3300046535 Bacteria 608
293 Ga0495587_0032250 3300046536 Bacteria 3168
294 Ga0495587_0202652 3300046536 Bacteria 1122
295 Ga0495609_0007878 3300046538 Bacteria 5267
296 Ga0495609_0023709 3300046538 Bacteria 2819
297 Ga0495645_0000402 3300046543 Bacteria 29852
298 Ga0495645_0587451 3300046543 Bacteria 686
299 Ga0495622_0118754 3300046557 Bacteria 1208
300 Ga0495633_0115706 3300046558 Bacteria 1242
301 Ga0495667_0115214 3300046559 Bacteria 1736
302 Ga0495668_0027819 3300046616 Bacteria 3203
303 Ga0495668_0252754 3300046616 Bacteria 965
304 Ga0495634_0007565 3300046642 Bacteria 8144
305 Ga0495611_0012184 3300046648 Bacteria 3655
306 Ga0495625_0000087 3300046660 Bacteria 151648
307 Ga0495625_0015909 3300046660 Bacteria 5935
308 Ga0495625_0016906 3300046660 Bacteria 5726
309 Ga0495625_0050816 3300046660 Bacteria 2973
310 Ga0495625_0097077 3300046660 Bacteria 2029
311 Ga0495635_0026384 3300046663 Bacteria 4043
312 Ga0495635_0209727 3300046663 Bacteria 1320
313 Ga0495635_0832528 3300046663 Bacteria 593
314 Ga0495659_0057508 3300046664 Bacteria 1429
315 Ga0495661_0268146 3300046665 Bacteria 865
316 Ga0495588_0441069 3300046674 Bacteria 683
317 Ga0495599_0073952 3300046678 Bacteria 2127
318 Ga0495599_0135222 3300046678 Bacteria 1530
319 Ga0495623_0027187 3300046679 Bacteria 3679
320 Ga0495623_0177607 3300046679 Bacteria 1239
321 Ga0495623_0493976 3300046679 Bacteria 647
322 Ga0495646_0022579 3300046680 Bacteria 3968
323 Ga0495646_0084847 3300046680 Bacteria 1838
324 Ga0495669_0001251 3300046684 Bacteria 10570
325 Ga0495613_0006966 3300046689 Bacteria 8429
326 Ga0495613_0050962 3300046689 Bacteria 3052
327 Ga0495613_0165466 3300046689 Bacteria 1571
328 Ga0495624_0124158 3300046690 Bacteria 1585
329 Ga0495649_0021863 3300046694 Bacteria 3583
330 Ga0495649_0046519 3300046694 Bacteria 2363
331 Ga0495649_0088776 3300046694 Bacteria 1649
332 Ga0495649_0229571 3300046694 Bacteria 958
333 Ga0495649_0386380 3300046694 Unclassified 704
334 Ga0495600_0008744 3300046809 Bacteria 6231
335 Ga0495581_0012501 3300047315 Bacteria 4917
336 Ga0495581_0238858 3300047315 Bacteria 1062
337 Ga0495581_0360212 3300047315 Bacteria 849
338 Ga0495604_0010597 3300047317 Bacteria 7310
339 Ga0495604_0036920 3300047317 Bacteria 3850
340 Ga0495674_0008674 3300047319 Bacteria 9667
341 Ga0495674_0160957 3300047319 Bacteria 1878
342 Ga0495674_0180772 3300047319 Bacteria 1756
343 Ga0495672_0003326 3300047320 Bacteria 13870
344 Ga0495676_0082477 3300047321 Bacteria 2433
345 Ga0495676_0390155 3300047321 Bacteria 925
346 Ga0495680_0211361 3300047322 Bacteria 1389
347 Ga0495683_0031607 3300047323 Bacteria 2698
348 Ga0495683_0090031 3300047323 Bacteria 1488
349 Ga0495675_0274781 3300047444 Bacteria 1006
350 Ga0495677_0043306 3300047445 Bacteria 1650
351 Ga0495684_0068890 3300047471 Bacteria 2690
352 Ga0495684_0088305 3300047471 Bacteria 2350
353 Ga0495684_0419572 3300047471 Bacteria 936
354 Ga0495684_0622138 3300047471 Bacteria 726
355 Ga0495593_0108214 3300047673 Bacteria 1421
356 Ga0495602_0066559 3300048088 Bacteria 3103
357 Ga0496105_0143970 3300048908 Bacteria 1961
358 Ga0496112_0214432 3300048915 Bacteria 1882
359 Ga0496119_0095272 3300048922 Bacteria 1682
360 Ga0496120_0087157 3300048923 Bacteria 1677
361 Ga0496126_0000767 3300048929 Bacteria 58096
362 Ga0496126_0005892 3300048929 Bacteria 13825
363 nmdc:mga0rr50_49097_c1 3300050513 Bacteria 3123
364 nmdc:mga08x19_284237_c1 3300050514 Bacteria 1147
365 Ga0500651_0000023 3300053093 Bacteria 129532
366 Ga0500595_038203 3300053119 Bacteria 1561
367 Ga0500661_011903 3300055283 Bacteria 1573
368 Ga0495674_0185899
369 JGI24743J22301_10028217
370 rootH1_10089238
371 rootL2_10116133
372 Ga0070658_10053929
373 Ga0070683_100007565
374 Ga0070683_100054447
375 Ga0070670_100155548
376 Ga0068869_100091898
377 Ga0070666_10068118
378 Ga0070666_10838578
379 Ga0070666_11006897
380 Ga0068868_100134771
381 Ga0068868_100700574
382 Ga0070661_100114112
383 Ga0070668_101193739
384 Ga0070671_100002115
385 Ga0070671_100031450
386 Ga0070671_101623982
387 Ga0070673_100391336
388 Ga0070667_100025371
389 Ga0070667_100062307
390 Ga0070709_10766064
391 Ga0070714_100110116
392 Ga0070713_100134310
393 Ga0070710_10165190
394 Ga0070710_10556682
395 Ga0070711_100095756
396 Ga0070663_100058190
397 Ga0070681_10088709
398 Ga0068867_102047382
399 Ga0070679_100002203
400 Ga0070679_101300109
401 Ga0070684_100093652
402 Ga0070684_100420646
403 Ga0070697_102036830
404 Ga0068853_100020566
405 Ga0070686_100192572
406 Ga0070665_100027705
407 Ga0070665_100033923
408 Ga0070665_100084688
409 Ga0070665_100136537
410 Ga0068855_100824923
411 Ga0068855_101262385
412 Ga0070664_100581534
413 Ga0068857_100001160
414 Ga0068857_100025652
415 Ga0068854_100734114
416 Ga0068856_100006406
417 Ga0068856_100174087
418 Ga0068856_100356115
419 Ga0068856_101466415
420 Ga0068852_100151006
421 Ga0068852_100244198
422 Ga0068852_100300233
423 Ga0068852_100400477
424 Ga0068859_100004546
425 Ga0068864_100175782
426 Ga0068864_100632990
427 Ga0068866_11253558
428 Ga0068851_10036490
429 Ga0068863_100023526
430 Ga0068863_100127481
431 Ga0068858_100049834
432 Ga0068858_101163053
433 Ga0068860_100000794
434 Ga0068860_100224215
435 Ga0068862_100195184
436 Ga0070717_10251698
437 Ga0070717_10747830
438 Ga0070717_10751358
439 Ga0070716_100993843
440 Ga0070712_100048598
441 Ga0097621_100172273
442 Ga0068871_100005298
443 Ga0097620_100004546
444 Ga0075435_100055238
445 Ga0105240_10012799
446 Ga0105240_10032349
447 Ga0105240_10893236
448 Ga0105245_10000823
449 Ga0105245_10658590
450 Ga0105247_10004945
451 Ga0105243_11539950
452 Ga0105241_10006528
453 Ga0105241_10018288
454 Ga0105241_10086893
455 Ga0105248_10006297
456 Ga0105248_10010351
457 Ga0105248_10041372
458 Ga0105248_10124212
459 Ga0105248_10346597
460 Ga0105237_10017511
461 Ga0105237_10543022
462 Ga0105238_10009985
463 Ga0105238_10013374
464 Ga0105238_10960899
465 Ga0105249_10762677
466 Ga0105239_10059945
467 Ga0105239_10440736
468 Ga0105239_10788587
469 Ga0105239_11671139
470 Ga0105246_10002271
471 Ga0157371_11289403
472 Ga0157370_10018471
473 Ga0157369_10004548
474 Ga0157369_10008554
475 Ga0157369_10146281
476 Ga0157369_10341498
477 Ga0157374_10009539
478 Ga0157374_10011329
479 Ga0157374_10012948
480 Ga0157374_10272343
481 Ga0157374_12409093
482 Ga0157378_10034899
483 Ga0157378_10264682
484 Ga0157378_11496281
485 Ga0163162_10031111
486 Ga0163162_10035067
487 Ga0163162_10207057
488 Ga0163162_10293690
489 Ga0163162_11855019
490 Ga0157372_10009955
491 Ga0157372_10061398
492 Ga0157372_10076517
493 Ga0157375_10086356
494 Ga0157375_12921219
495 Ga0163163_10001776
496 Ga0163163_10006722
497 Ga0163163_12432742
498 Ga0157379_10009206
499 Ga0157379_10350283
500 Ga0157379_10477469
501 Ga0157379_12202865
502 Ga0157379_12274285
503 Ga0157376_10001272
504 Ga0157376_10052921
505 Ga0157376_10056683
506 Ga0157376_10535713
507 Ga0157376_10593636
508 Ga0213875_10250165
509 Ga0213875_10393236
510 Ga0209233_1034170
511 Ga0207656_10076805
512 Ga0207692_10436972
513 Ga0207710_10003973
514 Ga0207680_10166592
515 Ga0207680_10555001
516 Ga0207680_10973186
517 Ga0207647_10359046
518 Ga0207685_10187055
519 Ga0207705_10070471
520 Ga0207705_11059893
521 Ga0207654_10006723
522 Ga0207654_10193177
523 Ga0207707_10035905
524 Ga0207695_10005225
525 Ga0207671_10000181
526 Ga0207671_10642805
527 Ga0207693_10166349
528 Ga0207663_10013278
529 Ga0207663_10917674
530 Ga0207649_10040903
531 Ga0207652_10002277
532 Ga0207694_10003144
533 Ga0207694_10036218
534 Ga0207694_10307401
535 Ga0207650_10243248
536 Ga0207687_10004077
537 Ga0207687_10368755
538 Ga0207700_10261206
539 Ga0207700_10341696
540 Ga0207644_10001775
541 Ga0207644_10310875
542 Ga0207686_10081595
543 Ga0207665_10274562
544 Ga0207711_10060946
545 Ga0207711_10398392
546 Ga0207689_10004361
547 Ga0207661_10009303
548 Ga0207661_10452884
549 Ga0207679_10101189
550 Ga0207667_10667420
551 Ga0207651_10637103
552 Ga0207668_10153709
553 Ga0207668_10783711
554 Ga0207640_10831964
555 Ga0207658_10006104
556 Ga0207658_10143085
557 Ga0207677_10003820
558 Ga0207677_10379965
559 Ga0207677_11730757
560 Ga0207703_10958537
561 Ga0207703_11019252
562 Ga0207639_10212513
563 Ga0207678_10032232
564 Ga0207678_10256111
565 Ga0207702_10012203
566 Ga0207702_10141237
567 Ga0207702_10309025
568 Ga0207702_10634064
569 Ga0207702_12408154
570 Ga0207641_10141454
571 Ga0207641_10142307
572 Ga0207641_12623247
573 Ga0207648_10793751
574 Ga0207676_10050192
575 Ga0207676_11897219
576 Ga0207674_10003665
577 Ga0207674_10012236
578 Ga0207698_10126581
579 Ga0207698_10265914
580 Ga0207698_10355404
581 Ga0207698_10356475
582 Ga0265354_1004738
583 Ga0265354_1023046
584 Ga0265356_1004587
585 Ga0265357_1018239
586 Ga0268266_10001930
587 Ga0268266_10003145
588 Ga0268266_10026261
589 Ga0268266_10168530
590 Ga0268266_12355076
591 Ga0268265_10522369
592 Ga0268265_12350322
593 Ga0268264_10074919
594 Ga0268264_10254526
595 Ga0265338_10001312
596 Ga0265324_10038030
597 Ga0307512_10322859
598 Ga0265762_1141058
599 Ga0265775_105625
600 Ga0265766_1000101
601 Ga0265770_1005543
602 Ga0265765_1000534
603 Ga0265771_1005815
604 Ga0265760_10015203
605 Ga0265339_10043296
606 Ga0307510_10010780
607 Ga0307510_10062304
608 Ga0316212_1000900
609 Ga0316212_1038942
610 Ga0373931_0261157
611 Ga0436364_0146620
612 Ga0436364_0178690
613 Ga0436364_0213711
614 Ga0436364_0302517
615 Ga0436365_1431157
616 Ga0436360_0996019
617 Ga0436363_0047472
618 Ga0436363_0524243
619 Ga0451577_0109829
620 Ga0466972_0170169
621 Ga0453683_0275297
622 Ga0453684_0137123
623 Ga0451576_0644295
624 Ga0495617_219044
625 Ga0495592_0055374
626 Ga0495603_0000324
627 Ga0495638_0526901
628 Ga0495651_0083642
629 Ga0495651_0171091
630 Ga0495650_0000006
631 Ga0495650_0015721
632 Ga0495580_0023634
633 Ga0495580_0352301
634 Ga0495582_0096561
635 Ga0495582_0139105
636 Ga0495605_0011499
637 Ga0495662_0001851
638 Ga0495664_0055906
639 Ga0495664_0080647
640 Ga0495664_0252415
641 Ga0495585_0047777
642 Ga0495594_0000060
643 Ga0495594_0000794
644 Ga0495594_0016846
645 Ga0495596_0414252
646 Ga0495583_0062229
647 Ga0495583_0165561
648 Ga0495606_0027013
649 Ga0495606_0096751
650 Ga0495608_0267194
651 Ga0495628_0284065
652 Ga0495631_0124896
653 Ga0495643_0146272
654 Ga0495644_0000069
655 Ga0495666_0008353
656 Ga0495652_0036961
657 Ga0495652_0082913
658 Ga0495665_0007655
659 Ga0495586_0653084
660 Ga0495587_0032250
661 Ga0495587_0202652
662 Ga0495609_0007878
663 Ga0495609_0023709
664 Ga0495645_0000402
665 Ga0495645_0587451
666 Ga0495622_0118754
667 Ga0495633_0115706
668 Ga0495667_0115214
669 Ga0495668_0027819
670 Ga0495668_0252754
671 Ga0495634_0007565
672 Ga0495611_0012184
673 Ga0495625_0000087
674 Ga0495625_0015909
675 Ga0495625_0016906
676 Ga0495625_0050816
677 Ga0495625_0097077
678 Ga0495635_0026384
679 Ga0495635_0209727
680 Ga0495635_0832528
681 Ga0495659_0057508
682 Ga0495661_0268146
683 Ga0495588_0441069
684 Ga0495599_0073952
685 Ga0495599_0135222
686 Ga0495623_0027187
687 Ga0495623_0177607
688 Ga0495623_0493976
689 Ga0495646_0022579
690 Ga0495646_0084847
691 Ga0495669_0001251
692 Ga0495613_0006966
693 Ga0495613_0050962
694 Ga0495613_0165466
695 Ga0495624_0124158
696 Ga0495649_0021863
697 Ga0495649_0046519
698 Ga0495649_0088776
699 Ga0495649_0229571
700 Ga0495649_0386380
701 Ga0495600_0008744
702 Ga0495581_0012501
703 Ga0495581_0238858
704 Ga0495581_0360212
705 Ga0495604_0010597
706 Ga0495604_0036920
707 Ga0495674_0008674
708 Ga0495674_0160957
709 Ga0495674_0180772
710 Ga0495672_0003326
711 Ga0495676_0082477
712 Ga0495676_0390155
713 Ga0495680_0211361
714 Ga0495683_0031607
715 Ga0495683_0090031
716 Ga0495675_0274781
717 Ga0495677_0043306
718 Ga0495684_0068890
719 Ga0495684_0088305
720 Ga0495684_0419572
721 Ga0495684_0622138
722 Ga0495593_0108214
723 Ga0495602_0066559
724 Ga0496105_0143970
725 Ga0496112_0214432
726 Ga0496119_0095272
727 Ga0496120_0087157
728 Ga0496126_0000767
729 Ga0496126_0005892
730 nmdc:mga0rr50_49097_c1
731 nmdc:mga08x19_284237_c1
732 Ga0500651_0000023
733 Ga0500595_038203
734 Ga0500661_011903

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

16

124

0.94

PF18029

Glyoxalase_6

Glyoxalase-like domain

19

125

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iuz-assembly1.cif.gz_A crystal structure of putative glyoxalase superfamily protein (yp_299723.1) from ralstonia eutropha jmp134 at 1.90 a resolution 0.8294 65 116
1yfo-assembly2.cif.gz_B receptor protein tyrosine phosphatase alpha, domain 1 from mouse 0.7488 87 119
2i5x-assembly2.cif.gz_B engineering the ptpbeta catalytic domain with improved crystallization properties 0.7441 87 117
2i5x-assembly1.cif.gz_A engineering the ptpbeta catalytic domain with improved crystallization properties 0.7432 87 117
2h63-assembly2.cif.gz_B crystal structure of human biliverdin reductase a 0.7339 87 116
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8783 66 114 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8689 66 118 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8158 66 114 3.30.720.110
4huzA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8149 66 116 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8143 66 118 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A7W8EAH5-F1-model_v4 Putative enzyme related to lactoylglutathione lyase 0.9762 69 120 GO:0016829
AF-A0A1G6LED8-F1-model_v4 VOC domain-containing protein 0.9733 69 119
AF-A0A7V9PWX8-F1-model_v4 VOC family protein 0.9465 64 119
AF-A0A836QFY2-F1-model_v4 Methylmalonyl-CoA epimerase 0.9419 66 118
AF-A0A2G9P4Y4-F1-model_v4 Methylmalonyl-CoA epimerase 0.935 67 120

Map