F424294

General Info

Members Datasets Scaffolds Average Seq Length
367 161 734 148

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10027113|Ga0081455_100271133
Length 173
Sequence MDIVIRAAIVFIFIWVLMRVIGRRELSSMEPFDLIMLVMIGDLVQQGITQNDFSVTGMLLVGSTVALLTVALSYTNFRFPRLRPVLEGEPVIVVQDGKPIERNLRRNRITLEELHALARGQQPRDPFTRSTSRHRSILARSGIPKVCTGRRAKVKSRILPACPRLTTCLPCRT

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
3 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
10 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
19 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
35 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
45 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
47 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
48 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
49 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
50 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
51 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
52 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
53 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
54 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
55 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
56 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
57 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
58 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
59 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
60 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
61 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
62 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
63 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
64 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
65 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
66 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
67 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
68 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
69 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
70 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
71 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
72 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
73 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
74 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
75 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
76 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
77 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
78 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
79 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
80 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
81 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
82 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
83 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
84 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
85 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
86 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
87 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
88 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
93 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
94 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
95 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
96 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
97 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
98 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
99 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
100 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
101 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
102 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
103 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
104 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
111 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
112 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
113 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
118 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
134 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
145 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
149 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
150 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
157 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
161 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.18
Nodule 0
Rhizoplane 8.17
Rhizosphere 87.19
Stem 0
Stem Tuber 0
Unclassified 15.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10027113 3300005937 Bacteria 5254
2 Ga0070675_100099258 3300005354 Bacteria 2451
3 Ga0070674_100753416 3300005356 Bacteria 837
4 Ga0070714_100040721 3300005435 Bacteria 3917
5 Ga0070714_100713483 3300005435 Unclassified 968
6 Ga0070713_100011873 3300005436 Bacteria 6367
7 Ga0070710_10726329 3300005437 Unclassified 703
8 Ga0070662_100584915 3300005457 Bacteria 938
9 Ga0070699_101486249 3300005518 Bacteria 621
10 Ga0070695_100532396 3300005545 Unclassified 913
11 Ga0070693_100522952 3300005547 Bacteria 845
12 Ga0070665_100090323 3300005548 Bacteria 3069
13 Ga0070704_101441002 3300005549 Unclassified 632
14 Ga0068856_100601502 3300005614 Bacteria 1121
15 Ga0070702_100659760 3300005615 Bacteria 792
16 Ga0070702_100660215 3300005615 Bacteria 792
17 Ga0081455_10024019 3300005937 Bacteria 5656
18 Ga0081455_10194616 3300005937 Bacteria 1524
19 Ga0081455_10380291 3300005937 Bacteria 986
20 Ga0081455_10547761 3300005937 Bacteria 766
21 Ga0070717_10033031 3300006028 Bacteria 4172
22 Ga0070717_10222366 3300006028 Bacteria 1660
23 Ga0075365_10019603 3300006038 Bacteria 4178
24 Ga0075365_10250101 3300006038 Bacteria 1246
25 Ga0075364_10251442 3300006051 Bacteria 1201
26 Ga0075432_10059507 3300006058 Unclassified 1358
27 Ga0070716_100009059 3300006173 Bacteria 4954
28 Ga0070712_100071200 3300006175 Bacteria 2487
29 Ga0075362_10136937 3300006177 Bacteria 1168
30 Ga0075428_100582259 3300006844 Bacteria 1196
31 Ga0075430_100389756 3300006846 Bacteria 1150
32 Ga0075431_100007223 3300006847 Bacteria 11050
33 Ga0075431_100450609 3300006847 Bacteria 1283
34 Ga0075434_100778783 3300006871 Unclassified 973
35 Ga0075435_100558058 3300007076 Unclassified 992
36 Ga0111539_10040879 3300009094 Bacteria 5579
37 Ga0111539_10087109 3300009094 Bacteria 3669
38 Ga0111539_10161298 3300009094 Bacteria 2622
39 Ga0111539_10430466 3300009094 Bacteria 1536
40 Ga0111539_10747740 3300009094 Bacteria 1138
41 Ga0111539_10785262 3300009094 Bacteria 1108
42 Ga0111539_11110439 3300009094 Unclassified 919
43 Ga0111539_11663546 3300009094 Bacteria 740
44 Ga0114129_10052468 3300009147 Bacteria 5722
45 Ga0114129_10188280 3300009147 Bacteria 2804
46 Ga0114129_10264785 3300009147 Bacteria 2302
47 Ga0114129_10830878 3300009147 Unclassified 1176
48 Ga0114129_10915561 3300009147 Bacteria 1110
49 Ga0114129_11307473 3300009147 Bacteria 898
50 Ga0114129_13501317 3300009147 Unclassified 502
51 Ga0105248_11593949 3300009177 Bacteria 740
52 Ga0105249_11229409 3300009553 Bacteria 820
53 Ga0105239_10141956 3300010375 Bacteria 2677
54 Ga0105239_10604183 3300010375 Bacteria 1251
55 Ga0157374_10140696 3300013296 Bacteria 2342
56 Ga0157380_11621106 3300014326 Bacteria 703
57 Ga0157377_10020174 3300014745 Bacteria 3489
58 Ga0207699_10163468 3300025906 Bacteria 1484
59 Ga0207693_10018507 3300025915 Bacteria 5547
60 Ga0207659_10250007 3300025926 Bacteria 1438
61 Ga0207700_10000001 3300025928 Bacteria 1122509
62 Ga0207700_10205109 3300025928 Bacteria 1663
63 Ga0207664_10015589 3300025929 Bacteria 5523
64 Ga0207664_10660617 3300025929 Unclassified 940
65 Ga0207669_10640492 3300025937 Bacteria 868
66 Ga0207665_10001446 3300025939 Bacteria 15979
67 Ga0207665_10067657 3300025939 Unclassified 2433
68 Ga0207702_10772183 3300026078 Bacteria 949
69 Ga0207702_10797312 3300026078 Bacteria 933
70 Ga0207683_10079951 3300026121 Bacteria 2899
71 Ga0207428_10119811 3300027907 Bacteria 2019
72 Ga0207428_10205122 3300027907 Unclassified 1483
73 Ga0207428_10365840 3300027907 Bacteria 1060
74 Ga0268266_10335208 3300028379 Bacteria 1419
75 Ga0307408_100336058 3300031548 Bacteria 1277
76 Ga0307408_100517080 3300031548 Unclassified 1048
77 Ga0307408_100958543 3300031548 Unclassified 786
78 Ga0307405_10623078 3300031731 Unclassified 883
79 Ga0307410_10120224 3300031852 Bacteria 1914
80 Ga0307410_10912717 3300031852 Bacteria 753
81 Ga0307406_10623584 3300031901 Unclassified 892
82 Ga0307412_10729354 3300031911 Bacteria 853
83 Ga0307409_100151734 3300031995 Bacteria 2012
84 Ga0307416_100135758 3300032002 Bacteria 2225
85 Ga0307416_101253245 3300032002 Bacteria 847
86 Ga0307414_10207675 3300032004 Bacteria 1598
87 Ga0307411_10408462 3300032005 Unclassified 1124
88 Ga0307411_11430023 3300032005 Bacteria 634
89 Ga0307415_100222252 3300032126 Unclassified 1515
90 Ga0307415_100382551 3300032126 Unclassified 1195
91 Ga0307415_101311745 3300032126 Bacteria 686
92 Ga0373952_0218906 3300035092 Unclassified 565
93 Ga0373960_0335522 3300035121 Bacteria 570
94 Ga0373947_0325983 3300035725 Unclassified 1028
95 Ga0395899_0013793 3300037312 Bacteria 6177
96 Ga0395899_0018133 3300037312 Bacteria 5356
97 Ga0395899_0073450 3300037312 Bacteria 2501
98 Ga0395899_0176243 3300037312 Unclassified 1503
99 Ga0395899_0345549 3300037312 Unclassified 996
100 Ga0395899_0371720 3300037312 Bacteria 952
101 Ga0395900_0004046 3300037418 Bacteria 15641
102 Ga0395900_0006998 3300037418 Bacteria 11683
103 Ga0395900_0008636 3300037418 Bacteria 10470
104 Ga0395900_0017312 3300037418 Bacteria 7356
105 Ga0395900_0024189 3300037418 Bacteria 6219
106 Ga0395900_0228296 3300037418 Unclassified 1873
107 Ga0395900_0429067 3300037418 Bacteria 1281
108 Ga0395898_0009044 3300037466 Bacteria 10488
109 Ga0395898_0009457 3300037466 Bacteria 10238
110 Ga0395898_0022251 3300037466 Bacteria 6423
111 Ga0395898_0032860 3300037466 Bacteria 5180
112 Ga0395898_0040529 3300037466 Bacteria 4605
113 Ga0395898_0141778 3300037466 Bacteria 2301
114 Ga0395898_0282298 3300037466 Bacteria 1584
115 Ga0395898_0859473 3300037466 Viruses 846
116 Ga0395898_0870814 3300037466 Unclassified 839
117 Ga0395905_0013665 3300037471 Bacteria 7776
118 Ga0395905_0033479 3300037471 Bacteria 4827
119 Ga0395905_0047888 3300037471 Bacteria 4006
120 Ga0395905_0084085 3300037471 Bacteria 2981
121 Ga0395905_0124351 3300037471 Bacteria 2425
122 Ga0395905_0398788 3300037471 Bacteria 1270
123 Ga0395905_0439709 3300037471 Bacteria 1201
124 Ga0395905_0790160 3300037471 Bacteria 852
125 Ga0395905_0935967 3300037471 Bacteria 769
126 Ga0395901_0002203 3300038443 Bacteria 19874
127 Ga0395901_0002881 3300038443 Bacteria 17362
128 Ga0395901_0010147 3300038443 Bacteria 9541
129 Ga0395901_0027773 3300038443 Bacteria 5819
130 Ga0395901_0063812 3300038443 Bacteria 3834
131 Ga0395901_0137305 3300038443 Bacteria 2569
132 Ga0395901_0234466 3300038443 Bacteria 1915
133 Ga0395901_0323063 3300038443 Unclassified 1596
134 Ga0395901_0387161 3300038443 Bacteria 1438
135 Ga0395901_0727438 3300038443 Bacteria 987
136 Ga0395901_1024163 3300038443 Bacteria 800
137 Ga0395901_1192790 3300038443 Bacteria 727
138 Ga0439461_0002557 3300041410 Bacteria 2922
139 Ga0439461_0024859 3300041410 Bacteria 1213
140 Ga0451789_0924977 3300041443 Unclassified 1671
141 Ga0451800_0819868 3300041459 Bacteria 2678
142 Ga0451806_144549 3300041462 Unclassified 1016
143 Ga0451807_2557920 3300041486 Unclassified 1371
144 Ga0451835_0008314 3300041492 Bacteria 5061
145 Ga0451835_0575396 3300041492 Unclassified 656
146 Ga0451839_0488434 3300041496 Unclassified 1234
147 Ga0451845_0422071 3300041501 Bacteria 1587
148 Ga0451847_0508009 3300041503 Bacteria 722
149 Ga0451849_0079408 3300041505 Bacteria 3347
150 Ga0451851_0471034 3300041507 Bacteria 3141
151 Ga0451855_1172095 3300041511 Bacteria 1678
152 Ga0451853_4037851 3300041512 Bacteria 2950
153 Ga0439431_0005127 3300041997 Bacteria 2890
154 Ga0439431_0135164 3300041997 Unclassified 694
155 Ga0439449_0224701 3300042007 Bacteria 704
156 Ga0439451_016948 3300042009 Bacteria 1467
157 Ga0439455_0070310 3300042012 Bacteria 940
158 Ga0450920_032786 3300042122 Bacteria 1026
159 Ga0450920_036197 3300042122 Unclassified 979
160 Ga0450920_066752 3300042122 Bacteria 730
161 Ga0450910_080995 3300042147 Bacteria 567
162 Ga0439446_0058443 3300042156 Bacteria 1163
163 Ga0439434_0022604 3300042435 Bacteria 1890
164 Ga0439434_0033718 3300042435 Bacteria 1562
165 Ga0439434_0038046 3300042435 Bacteria 1474
166 Ga0439460_0272877 3300042461 Bacteria 588
167 Ga0450918_029206 3300042531 Unclassified 972
168 Ga0439440_0153934 3300042993 Bacteria 660
169 Ga0466965_0204272 3300044683 Bacteria 1049
170 Ga0466966_0084136 3300044684 Bacteria 1979
171 Ga0466961_0130093 3300044693 Bacteria 1578
172 Ga0466963_0663529 3300044694 Bacteria 736
173 Ga0466959_0134589 3300045049 Bacteria 1750
174 Ga0495641_0107951 3300046461 Bacteria 1242
175 Ga0495580_0348148 3300046472 Bacteria 1004
176 Ga0495665_0084619 3300046531 Bacteria 1667
177 Ga0495640_0221872 3300046533 Bacteria 1192
178 Ga0495586_0032820 3300046535 Bacteria 2784
179 Ga0495634_0075951 3300046642 Bacteria 2206
180 Ga0495659_0049042 3300046664 Bacteria 1532
181 Ga0495647_0213597 3300046681 Bacteria 849
182 Ga0495613_0074604 3300046689 Bacteria 2470
183 Ga0495589_0292510 3300046794 Bacteria 756
184 Ga0495581_0732140 3300047315 Bacteria 569
185 Ga0495674_0073371 3300047319 Bacteria 2950
186 Ga0496101_0324354 3300048904 Bacteria 1208
187 Ga0496101_0458116 3300048904 Unclassified 1006
188 Ga0496101_0634258 3300048904 Bacteria 844
189 Ga0496102_0001216 3300048905 Bacteria 23348
190 Ga0496102_0307927 3300048905 Bacteria 1493
191 Ga0496102_0701078 3300048905 Bacteria 935
192 Ga0496103_0035655 3300048906 Bacteria 3046
193 Ga0496104_0373288 3300048907 Bacteria 1339
194 Ga0496104_0517491 3300048907 Bacteria 1104
195 Ga0496105_0609001 3300048908 Bacteria 847
196 Ga0496106_0018184 3300048909 Bacteria 5199
197 Ga0496107_0334033 3300048910 Bacteria 1128
198 Ga0496107_0526078 3300048910 Bacteria 877
199 Ga0496108_0365289 3300048911 Bacteria 1260
200 Ga0496108_0532175 3300048911 Bacteria 1026
201 Ga0496109_0016825 3300048912 Bacteria 6399
202 Ga0496110_0077269 3300048913 Bacteria 2961
203 Ga0496110_0097471 3300048913 Bacteria 2635
204 Ga0496110_0106138 3300048913 Bacteria 2520
205 Ga0496111_0762529 3300048914 Unclassified 701
206 Ga0496112_0434229 3300048915 Unclassified 1251
207 Ga0496112_1107938 3300048915 Bacteria 710
208 Ga0496113_0283192 3300048916 Bacteria 1326
209 Ga0496113_0679668 3300048916 Bacteria 822
210 Ga0496114_0028397 3300048917 Bacteria 4591
211 Ga0496114_0123840 3300048917 Bacteria 2226
212 Ga0501031_0011699 3300049568 Bacteria 5723
213 Ga0501031_0014475 3300049568 Bacteria 5127
214 Ga0501031_0766360 3300049568 Bacteria 619
215 Ga0501032_0025952 3300049569 Bacteria 4036
216 Ga0501032_0149935 3300049569 Unclassified 1533
217 Ga0501032_0260885 3300049569 Bacteria 1123
218 Ga0501033_0003469 3300049570 Bacteria 12934
219 Ga0501033_0189533 3300049570 Bacteria 1472
220 Ga0501036_0002242 3300049572 Bacteria 15100
221 Ga0501036_0011829 3300049572 Bacteria 7234
222 Ga0501036_0013647 3300049572 Bacteria 6755
223 Ga0501036_0377534 3300049572 Bacteria 1183
224 Ga0501036_0948680 3300049572 Unclassified 705
225 Ga0501037_0685603 3300049573 Bacteria 683
226 Ga0501038_0026555 3300049574 Bacteria 5157
227 Ga0501038_0267583 3300049574 Bacteria 1349
228 Ga0501038_0592048 3300049574 Bacteria 840
229 Ga0501039_0008692 3300049575 Bacteria 7734
230 Ga0501039_0024242 3300049575 Bacteria 4659
231 Ga0501039_0180993 3300049575 Bacteria 1658
232 Ga0501039_0889552 3300049575 Unclassified 693
233 Ga0501040_0000727 3300049576 Bacteria 20373
234 Ga0501040_0002721 3300049576 Bacteria 11388
235 Ga0501040_0005158 3300049576 Bacteria 8452
236 Ga0501040_0024175 3300049576 Bacteria 4077
237 Ga0501040_0340593 3300049576 Bacteria 1074
238 Ga0501041_0005409 3300049577 Bacteria 7481
239 Ga0501041_0008600 3300049577 Bacteria 6012
240 Ga0501041_0049094 3300049577 Bacteria 2571
241 Ga0501041_0154714 3300049577 Bacteria 1432
242 Ga0501041_0170290 3300049577 Bacteria 1363
243 Ga0501041_0203038 3300049577 Unclassified 1243
244 Ga0501042_0003191 3300049578 Bacteria 10238
245 Ga0501042_0011611 3300049578 Bacteria 5949
246 Ga0501042_0015859 3300049578 Bacteria 5165
247 Ga0501042_0042295 3300049578 Bacteria 3243
248 Ga0501042_0277473 3300049578 Bacteria 1210
249 Ga0501042_0373378 3300049578 Bacteria 1032
250 Ga0501042_0510941 3300049578 Unclassified 873
251 Ga0501042_0961143 3300049578 Bacteria 622
252 Ga0501043_0166086 3300049579 Unclassified 1724
253 Ga0501043_0428283 3300049579 Bacteria 997
254 Ga0501046_0024089 3300049580 Bacteria 4998
255 Ga0501046_0049786 3300049580 Bacteria 3313
256 Ga0501047_0495796 3300049581 Bacteria 1048
257 Ga0501048_0009122 3300049582 Bacteria 7466
258 Ga0501048_0015211 3300049582 Bacteria 5684
259 Ga0501048_0019354 3300049582 Bacteria 4995
260 Ga0501048_0094310 3300049582 Bacteria 2111
261 Ga0501048_0265973 3300049582 Unclassified 1218
262 Ga0501068_0001653 3300049584 Bacteria 11918
263 Ga0501068_0981748 3300049584 Bacteria 557
264 Ga0501069_0002448 3300049585 Bacteria 9467
265 Ga0501069_0204301 3300049585 Bacteria 1145
266 Ga0501069_0288822 3300049585 Unclassified 961
267 Ga0501069_0652560 3300049585 Bacteria 633
268 Ga0501070_0067483 3300049586 Bacteria 2962
269 Ga0501071_0000117 3300049587 Bacteria 31405
270 Ga0501071_0004894 3300049587 Bacteria 8542
271 Ga0501071_0008189 3300049587 Bacteria 6897
272 Ga0501071_0091284 3300049587 Bacteria 2237
273 Ga0501071_0553427 3300049587 Unclassified 884
274 Ga0501071_0798202 3300049587 Bacteria 728
275 Ga0501072_0001248 3300049588 Bacteria 18995
276 Ga0501072_0002352 3300049588 Bacteria 14179
277 Ga0501072_0031377 3300049588 Bacteria 4159
278 Ga0501072_0033257 3300049588 Bacteria 4041
279 Ga0501072_0462851 3300049588 Unclassified 1004
280 Ga0501072_0891014 3300049588 Unclassified 695
281 Ga0501074_0014672 3300049590 Bacteria 5699
282 Ga0501074_0030699 3300049590 Bacteria 3894
283 Ga0501074_0466365 3300049590 Bacteria 895
284 Ga0501074_0676684 3300049590 Bacteria 729
285 Ga0501075_0010132 3300049591 Bacteria 6615
286 Ga0501075_0013826 3300049591 Bacteria 5772
287 Ga0501075_0065397 3300049591 Bacteria 2743
288 Ga0501075_0103380 3300049591 Bacteria 2165
289 Ga0501075_0289494 3300049591 Bacteria 1248
290 Ga0501075_0344194 3300049591 Bacteria 1136
291 Ga0501075_0642455 3300049591 Bacteria 809
292 Ga0501076_0001090 3300049592 Bacteria 17846
293 Ga0501076_0016690 3300049592 Bacteria 5569
294 Ga0501076_0017404 3300049592 Bacteria 5462
295 Ga0501076_0084467 3300049592 Bacteria 2550
296 Ga0501076_0118391 3300049592 Bacteria 2144
297 Ga0501076_0250194 3300049592 Bacteria 1450
298 Ga0501076_1250813 3300049592 Bacteria 611
299 Ga0501077_0006489 3300049593 Bacteria 7182
300 Ga0501077_0056932 3300049593 Bacteria 2482
301 Ga0501079_0008205 3300049741 Bacteria 7915
302 Ga0501079_0009124 3300049741 Bacteria 7509
303 Ga0501079_0096433 3300049741 Bacteria 2292
304 Ga0501079_0254612 3300049741 Bacteria 1372
305 Ga0501079_0611445 3300049741 Bacteria 858
306 Ga0501080_0012553 3300049742 Bacteria 7768
307 Ga0501080_0171491 3300049742 Unclassified 2001
308 Ga0501080_0237510 3300049742 Bacteria 1664
309 Ga0501081_0005881 3300049743 Bacteria 7940
310 Ga0501081_0013180 3300049743 Bacteria 5437
311 Ga0501081_0045967 3300049743 Bacteria 2999
312 Ga0501081_0068941 3300049743 Bacteria 2463
313 Ga0501081_0266253 3300049743 Bacteria 1253
314 Ga0501081_0302390 3300049743 Unclassified 1174
315 Ga0501081_0568829 3300049743 Unclassified 847
316 Ga0501083_0035808 3300049744 Bacteria 3390
317 Ga0501083_0208614 3300049744 Bacteria 1274
318 Ga0501035_0032847 3300049822 Bacteria 4719
319 Ga0501035_0046300 3300049822 Bacteria 3912
320 Ga0501035_0054334 3300049822 Bacteria 3579
321 Ga0501035_0285207 3300049822 Bacteria 1395
322 Ga0501044_0286958 3300049823 Bacteria 1578
323 Ga0501044_0402086 3300049823 Bacteria 1282
324 Ga0501045_0001381 3300049824 Bacteria 16190
325 Ga0501045_0002381 3300049824 Bacteria 12768
326 Ga0501045_0017808 3300049824 Bacteria 5045
327 Ga0501045_0067216 3300049824 Bacteria 2632
328 Ga0501045_0403487 3300049824 Unclassified 1017
329 Ga0501045_0443271 3300049824 Bacteria 965
330 Ga0501045_0702340 3300049824 Unclassified 746
331 nmdc:mga00v17_521409_c1 3300050491 Bacteria 769
332 nmdc:mga00v17_70387_c1 3300050491 Bacteria 2166
333 nmdc:mga0yw44_1059589_c1 3300050492 Bacteria 548
334 nmdc:mga0yw44_45241_c1 3300050492 Bacteria 2638
335 nmdc:mga05p37_1014542_c1 3300050507 Bacteria 880
336 nmdc:mga05p37_1659090_c1 3300050507 Unclassified 626
337 nmdc:mga05p37_178710_c1 3300050507 Bacteria 2583
338 nmdc:mga05p37_62416_c1 3300050507 Bacteria 4586
339 nmdc:mga0qj67_24864_c1 3300050509 Bacteria 4621
340 nmdc:mga06r32_305302_c1 3300050510 Bacteria 1577
341 nmdc:mga08y16_114747_c1 3300050511 Bacteria 2804
342 nmdc:mga08y16_1598270_c1 3300050511 Bacteria 610
343 nmdc:mga08y16_372421_c1 3300050511 Unclassified 1465
344 nmdc:mga08y16_73121_c1 3300050511 Bacteria 3572
345 nmdc:mga08y16_869703_c1 3300050511 Bacteria 889
346 nmdc:mga0n895_1590051_c1 3300050512 Unclassified 618
347 nmdc:mga0n895_229803_c1 3300050512 Bacteria 1883
348 nmdc:mga0n895_820071_c1 3300050512 Bacteria 920
349 nmdc:mga0rr50_454945_c1 3300050513 Bacteria 1085
350 nmdc:mga08x19_514926_c1 3300050514 Bacteria 845
351 nmdc:mga0a205_108643_c1 3300050515 Bacteria 2672
352 nmdc:mga0a205_275965_c1 3300050515 Bacteria 1557
353 Ga0501084_0007683 3300054114 Bacteria 8883
354 Ga0501084_0015455 3300054114 Bacteria 6329
355 Ga0501084_0018081 3300054114 Bacteria 5871
356 Ga0501084_0034107 3300054114 Bacteria 4256
357 Ga0501084_1653958 3300054114 Bacteria 535
358 Ga0501082_0005431 3300060353 Bacteria 11062
359 Ga0501082_0022397 3300060353 Bacteria 5442
360 Ga0501082_0041810 3300060353 Bacteria 3952
361 Ga0501082_0325727 3300060353 Bacteria 1339
362 Ga0501082_0424381 3300060353 Bacteria 1161
363 Ga0530510_0011618 3300061734 Bacteria 6179
364 Ga0530510_0015425 3300061734 Bacteria 5399
365 Ga0530510_0023356 3300061734 Bacteria 4406
366 Ga0530510_0143899 3300061734 Bacteria 1758
367 Ga0530510_0641044 3300061734 Unclassified 809
368 Ga0081455_10027113
369 Ga0070675_100099258
370 Ga0070674_100753416
371 Ga0070714_100040721
372 Ga0070714_100713483
373 Ga0070713_100011873
374 Ga0070710_10726329
375 Ga0070662_100584915
376 Ga0070699_101486249
377 Ga0070695_100532396
378 Ga0070693_100522952
379 Ga0070665_100090323
380 Ga0070704_101441002
381 Ga0068856_100601502
382 Ga0070702_100659760
383 Ga0070702_100660215
384 Ga0081455_10024019
385 Ga0081455_10194616
386 Ga0081455_10380291
387 Ga0081455_10547761
388 Ga0070717_10033031
389 Ga0070717_10222366
390 Ga0075365_10019603
391 Ga0075365_10250101
392 Ga0075364_10251442
393 Ga0075432_10059507
394 Ga0070716_100009059
395 Ga0070712_100071200
396 Ga0075362_10136937
397 Ga0075428_100582259
398 Ga0075430_100389756
399 Ga0075431_100007223
400 Ga0075431_100450609
401 Ga0075434_100778783
402 Ga0075435_100558058
403 Ga0111539_10040879
404 Ga0111539_10087109
405 Ga0111539_10161298
406 Ga0111539_10430466
407 Ga0111539_10747740
408 Ga0111539_10785262
409 Ga0111539_11110439
410 Ga0111539_11663546
411 Ga0114129_10052468
412 Ga0114129_10188280
413 Ga0114129_10264785
414 Ga0114129_10830878
415 Ga0114129_10915561
416 Ga0114129_11307473
417 Ga0114129_13501317
418 Ga0105248_11593949
419 Ga0105249_11229409
420 Ga0105239_10141956
421 Ga0105239_10604183
422 Ga0157374_10140696
423 Ga0157380_11621106
424 Ga0157377_10020174
425 Ga0207699_10163468
426 Ga0207693_10018507
427 Ga0207659_10250007
428 Ga0207700_10000001
429 Ga0207700_10205109
430 Ga0207664_10015589
431 Ga0207664_10660617
432 Ga0207669_10640492
433 Ga0207665_10001446
434 Ga0207665_10067657
435 Ga0207702_10772183
436 Ga0207702_10797312
437 Ga0207683_10079951
438 Ga0207428_10119811
439 Ga0207428_10205122
440 Ga0207428_10365840
441 Ga0268266_10335208
442 Ga0307408_100336058
443 Ga0307408_100517080
444 Ga0307408_100958543
445 Ga0307405_10623078
446 Ga0307410_10120224
447 Ga0307410_10912717
448 Ga0307406_10623584
449 Ga0307412_10729354
450 Ga0307409_100151734
451 Ga0307416_100135758
452 Ga0307416_101253245
453 Ga0307414_10207675
454 Ga0307411_10408462
455 Ga0307411_11430023
456 Ga0307415_100222252
457 Ga0307415_100382551
458 Ga0307415_101311745
459 Ga0373952_0218906
460 Ga0373960_0335522
461 Ga0373947_0325983
462 Ga0395899_0013793
463 Ga0395899_0018133
464 Ga0395899_0073450
465 Ga0395899_0176243
466 Ga0395899_0345549
467 Ga0395899_0371720
468 Ga0395900_0004046
469 Ga0395900_0006998
470 Ga0395900_0008636
471 Ga0395900_0017312
472 Ga0395900_0024189
473 Ga0395900_0228296
474 Ga0395900_0429067
475 Ga0395898_0009044
476 Ga0395898_0009457
477 Ga0395898_0022251
478 Ga0395898_0032860
479 Ga0395898_0040529
480 Ga0395898_0141778
481 Ga0395898_0282298
482 Ga0395898_0859473
483 Ga0395898_0870814
484 Ga0395905_0013665
485 Ga0395905_0033479
486 Ga0395905_0047888
487 Ga0395905_0084085
488 Ga0395905_0124351
489 Ga0395905_0398788
490 Ga0395905_0439709
491 Ga0395905_0790160
492 Ga0395905_0935967
493 Ga0395901_0002203
494 Ga0395901_0002881
495 Ga0395901_0010147
496 Ga0395901_0027773
497 Ga0395901_0063812
498 Ga0395901_0137305
499 Ga0395901_0234466
500 Ga0395901_0323063
501 Ga0395901_0387161
502 Ga0395901_0727438
503 Ga0395901_1024163
504 Ga0395901_1192790
505 Ga0439461_0002557
506 Ga0439461_0024859
507 Ga0451789_0924977
508 Ga0451800_0819868
509 Ga0451806_144549
510 Ga0451807_2557920
511 Ga0451835_0008314
512 Ga0451835_0575396
513 Ga0451839_0488434
514 Ga0451845_0422071
515 Ga0451847_0508009
516 Ga0451849_0079408
517 Ga0451851_0471034
518 Ga0451855_1172095
519 Ga0451853_4037851
520 Ga0439431_0005127
521 Ga0439431_0135164
522 Ga0439449_0224701
523 Ga0439451_016948
524 Ga0439455_0070310
525 Ga0450920_032786
526 Ga0450920_036197
527 Ga0450920_066752
528 Ga0450910_080995
529 Ga0439446_0058443
530 Ga0439434_0022604
531 Ga0439434_0033718
532 Ga0439434_0038046
533 Ga0439460_0272877
534 Ga0450918_029206
535 Ga0439440_0153934
536 Ga0466965_0204272
537 Ga0466966_0084136
538 Ga0466961_0130093
539 Ga0466963_0663529
540 Ga0466959_0134589
541 Ga0495641_0107951
542 Ga0495580_0348148
543 Ga0495665_0084619
544 Ga0495640_0221872
545 Ga0495586_0032820
546 Ga0495634_0075951
547 Ga0495659_0049042
548 Ga0495647_0213597
549 Ga0495613_0074604
550 Ga0495589_0292510
551 Ga0495581_0732140
552 Ga0495674_0073371
553 Ga0496101_0324354
554 Ga0496101_0458116
555 Ga0496101_0634258
556 Ga0496102_0001216
557 Ga0496102_0307927
558 Ga0496102_0701078
559 Ga0496103_0035655
560 Ga0496104_0373288
561 Ga0496104_0517491
562 Ga0496105_0609001
563 Ga0496106_0018184
564 Ga0496107_0334033
565 Ga0496107_0526078
566 Ga0496108_0365289
567 Ga0496108_0532175
568 Ga0496109_0016825
569 Ga0496110_0077269
570 Ga0496110_0097471
571 Ga0496110_0106138
572 Ga0496111_0762529
573 Ga0496112_0434229
574 Ga0496112_1107938
575 Ga0496113_0283192
576 Ga0496113_0679668
577 Ga0496114_0028397
578 Ga0496114_0123840
579 Ga0501031_0011699
580 Ga0501031_0014475
581 Ga0501031_0766360
582 Ga0501032_0025952
583 Ga0501032_0149935
584 Ga0501032_0260885
585 Ga0501033_0003469
586 Ga0501033_0189533
587 Ga0501036_0002242
588 Ga0501036_0011829
589 Ga0501036_0013647
590 Ga0501036_0377534
591 Ga0501036_0948680
592 Ga0501037_0685603
593 Ga0501038_0026555
594 Ga0501038_0267583
595 Ga0501038_0592048
596 Ga0501039_0008692
597 Ga0501039_0024242
598 Ga0501039_0180993
599 Ga0501039_0889552
600 Ga0501040_0000727
601 Ga0501040_0002721
602 Ga0501040_0005158
603 Ga0501040_0024175
604 Ga0501040_0340593
605 Ga0501041_0005409
606 Ga0501041_0008600
607 Ga0501041_0049094
608 Ga0501041_0154714
609 Ga0501041_0170290
610 Ga0501041_0203038
611 Ga0501042_0003191
612 Ga0501042_0011611
613 Ga0501042_0015859
614 Ga0501042_0042295
615 Ga0501042_0277473
616 Ga0501042_0373378
617 Ga0501042_0510941
618 Ga0501042_0961143
619 Ga0501043_0166086
620 Ga0501043_0428283
621 Ga0501046_0024089
622 Ga0501046_0049786
623 Ga0501047_0495796
624 Ga0501048_0009122
625 Ga0501048_0015211
626 Ga0501048_0019354
627 Ga0501048_0094310
628 Ga0501048_0265973
629 Ga0501068_0001653
630 Ga0501068_0981748
631 Ga0501069_0002448
632 Ga0501069_0204301
633 Ga0501069_0288822
634 Ga0501069_0652560
635 Ga0501070_0067483
636 Ga0501071_0000117
637 Ga0501071_0004894
638 Ga0501071_0008189
639 Ga0501071_0091284
640 Ga0501071_0553427
641 Ga0501071_0798202
642 Ga0501072_0001248
643 Ga0501072_0002352
644 Ga0501072_0031377
645 Ga0501072_0033257
646 Ga0501072_0462851
647 Ga0501072_0891014
648 Ga0501074_0014672
649 Ga0501074_0030699
650 Ga0501074_0466365
651 Ga0501074_0676684
652 Ga0501075_0010132
653 Ga0501075_0013826
654 Ga0501075_0065397
655 Ga0501075_0103380
656 Ga0501075_0289494
657 Ga0501075_0344194
658 Ga0501075_0642455
659 Ga0501076_0001090
660 Ga0501076_0016690
661 Ga0501076_0017404
662 Ga0501076_0084467
663 Ga0501076_0118391
664 Ga0501076_0250194
665 Ga0501076_1250813
666 Ga0501077_0006489
667 Ga0501077_0056932
668 Ga0501079_0008205
669 Ga0501079_0009124
670 Ga0501079_0096433
671 Ga0501079_0254612
672 Ga0501079_0611445
673 Ga0501080_0012553
674 Ga0501080_0171491
675 Ga0501080_0237510
676 Ga0501081_0005881
677 Ga0501081_0013180
678 Ga0501081_0045967
679 Ga0501081_0068941
680 Ga0501081_0266253
681 Ga0501081_0302390
682 Ga0501081_0568829
683 Ga0501083_0035808
684 Ga0501083_0208614
685 Ga0501035_0032847
686 Ga0501035_0046300
687 Ga0501035_0054334
688 Ga0501035_0285207
689 Ga0501044_0286958
690 Ga0501044_0402086
691 Ga0501045_0001381
692 Ga0501045_0002381
693 Ga0501045_0017808
694 Ga0501045_0067216
695 Ga0501045_0403487
696 Ga0501045_0443271
697 Ga0501045_0702340
698 nmdc:mga00v17_521409_c1
699 nmdc:mga00v17_70387_c1
700 nmdc:mga0yw44_1059589_c1
701 nmdc:mga0yw44_45241_c1
702 nmdc:mga05p37_1014542_c1
703 nmdc:mga05p37_1659090_c1
704 nmdc:mga05p37_178710_c1
705 nmdc:mga05p37_62416_c1
706 nmdc:mga0qj67_24864_c1
707 nmdc:mga06r32_305302_c1
708 nmdc:mga08y16_114747_c1
709 nmdc:mga08y16_1598270_c1
710 nmdc:mga08y16_372421_c1
711 nmdc:mga08y16_73121_c1
712 nmdc:mga08y16_869703_c1
713 nmdc:mga0n895_1590051_c1
714 nmdc:mga0n895_229803_c1
715 nmdc:mga0n895_820071_c1
716 nmdc:mga0rr50_454945_c1
717 nmdc:mga08x19_514926_c1
718 nmdc:mga0a205_108643_c1
719 nmdc:mga0a205_275965_c1
720 Ga0501084_0007683
721 Ga0501084_0015455
722 Ga0501084_0018081
723 Ga0501084_0034107
724 Ga0501084_1653958
725 Ga0501082_0005431
726 Ga0501082_0022397
727 Ga0501082_0041810
728 Ga0501082_0325727
729 Ga0501082_0424381
730 Ga0530510_0011618
731 Ga0530510_0015425
732 Ga0530510_0023356
733 Ga0530510_0143899
734 Ga0530510_0641044

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04239

DUF421

YetF C-terminal domain

77

125

0.92

PF20730

YetF_N

YetF N-terminal transmembrane domain

1

75

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c6f-assembly1.cif.gz_C crystal structure of protein bsu07140 from bacillus subtilis 0.9309 91 147
1k5h-assembly2.cif.gz_B 1-deoxy-d-xylulose-5-phosphate reductoisomerase 0.5262 128 148
8s9s-assembly1.cif.gz_4 structure of the human er membrane protein complex (emc) in gdn 0.4616 2 76
6x40-assembly1.cif.gz_E human gabaa receptor alpha1-beta2-gamma2 subtype in complex with gaba plus picrotoxin 0.4389 5 85
1cop-assembly1.cif.gz_E three-dimensional dimer structure of the lambda-cro repressor in solution as determined by heteronuclear multidimensional nmr 0.4225 102 145
ID Description Score Start End Superfamily
3c6fC02 Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains 0.9282 89 144 3.30.240.20
3c6fD01 Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains 0.9279 91 147 3.30.240.20
af_P75839_95_166_3.30.240.20 Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains 0.8652 78 147 3.30.240.20
3c6fD01 Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains 0.8446 91 147 3.30.240.20
af_P75839_95_166_3.30.240.20 Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains 0.8333 78 147 3.30.240.20
ID Description Score Start End GO Terms
AF-A0A357D205-F1-model_v4 YetF C-terminal domain-containing protein 0.9118 64 146 GO:0005886
AF-A0A7W0JQC3-F1-model_v4 DUF421 domain-containing protein 0.8958 2 148 GO:0005886
AF-A0A7S8IZR0-F1-model_v4 YetF C-terminal domain-containing protein 0.886 3 147 GO:0005886
AF-A0A7W0JQC3-F1-model_v4 DUF421 domain-containing protein 0.8734 2 148 GO:0005886
AF-A0A1F8TY96-F1-model_v4 YetF C-terminal domain-containing protein 0.8729 54 147 GO:0005886

Map