F424292

General Info

Members Datasets Scaffolds Average Seq Length
367 221 367 291

Family's Representative Sequence

Representative Sequence 3300005834|Ga0068851_10000296|Ga0068851_1000029615
Length 333
Sequence VRTWKLAERDLDLTRPIGAGIVNVTVDSMFEGARSGTPEQAVRDGLALAEAGFEMLDVGAVAAKAGPPVPPEDEAAALVPAVEGLVAELRGSLRTDTDRKEPRNEVPVSADTFSPEVARRAIGAGAAVVNDISGGCEEMFELVAETGCGYVLMHIEGPPRVDRQWREYDDVVDHLRAWFEGRVEVARDRGVAEEQIAIDPGLDFDLSPEQDLEILRRLGELRALGLPLYVSLSRKDFIGAVLAESWEERLPPGEREWGTVAAVTLAVREGADVLRIHDRSSLQAMRVAAGICRPNDGPINPTSVADGPKSLSRDDKSSRRLVDGDFSARRGVV

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
102 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
103 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
104 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
107 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
108 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
109 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
139 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
150 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
176 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
179 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
216 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
219 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
220 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.09
Nodule 0
Rhizoplane 12.53
Rhizosphere 82.02
Stem 0
Stem Tuber 0
Unclassified 4.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100020933 3300005329 Bacteria 5832
2 Ga0070683_100051305 3300005329 Bacteria 3819
3 Ga0070683_100082460 3300005329 Bacteria 3011
4 Ga0070683_100195984 3300005329 Bacteria 1918
5 Ga0070677_10000247 3300005333 Bacteria 18742
6 Ga0070666_10026254 3300005335 Bacteria 3803
7 Ga0070666_10048391 3300005335 Bacteria 2857
8 Ga0070682_100000040 3300005337 Bacteria 143944
9 Ga0070682_100214198 3300005337 Bacteria 1367
10 Ga0068868_100000008 3300005338 Bacteria 121926
11 Ga0068868_100000452 3300005338 Bacteria 27354
12 Ga0070691_10000010 3300005341 Bacteria 58327
13 Ga0070691_10011303 3300005341 Bacteria 4074
14 Ga0070661_100000052 3300005344 Bacteria 89458
15 Ga0070668_100028861 3300005347 Bacteria 4210
16 Ga0070675_100000008 3300005354 Bacteria 250004
17 Ga0070674_100000016 3300005356 Bacteria 91058
18 Ga0070674_100000426 3300005356 Bacteria 21283
19 Ga0070688_100000357 3300005365 Bacteria 23119
20 Ga0070688_100000423 3300005365 Bacteria 21412
21 Ga0070667_100003090 3300005367 Bacteria 14316
22 Ga0070667_100004010 3300005367 Bacteria 12466
23 Ga0070667_100308301 3300005367 Bacteria 1426
24 Ga0070713_100000055 3300005436 Bacteria 70759
25 Ga0070711_100023624 3300005439 Bacteria 4001
26 Ga0070700_100250145 3300005441 Bacteria 1271
27 Ga0070663_100000507 3300005455 Bacteria 20607
28 Ga0070678_100023929 3300005456 Bacteria 4079
29 Ga0070662_100000039 3300005457 Bacteria 74491
30 Ga0070685_10000351 3300005466 Bacteria 28123
31 Ga0070685_10000483 3300005466 Bacteria 23119
32 Ga0070679_100004329 3300005530 Bacteria 13110
33 Ga0070684_100026596 3300005535 Bacteria 4876
34 Ga0070684_100033232 3300005535 Bacteria 4403
35 Ga0070684_100041307 3300005535 Bacteria 3976
36 Ga0068853_100014306 3300005539 Bacteria 6493
37 Ga0070672_100000036 3300005543 Bacteria 59645
38 Ga0070693_100000471 3300005547 Bacteria 18102
39 Ga0070665_100093214 3300005548 Bacteria 3016
40 Ga0070665_100364834 3300005548 Bacteria 1451
41 Ga0070664_100031171 3300005564 Bacteria 4451
42 Ga0070664_100054689 3300005564 Bacteria 3388
43 Ga0068857_100174700 3300005577 Bacteria 1954
44 Ga0068854_100048444 3300005578 Bacteria 3032
45 Ga0068856_100001384 3300005614 Bacteria 25513
46 Ga0068856_100158657 3300005614 Bacteria 2272
47 Ga0068852_100000007 3300005616 Bacteria 158670
48 Ga0068852_100042150 3300005616 Bacteria 3863
49 Ga0068864_100000035 3300005618 Bacteria 195218
50 Ga0068866_10000002 3300005718 Bacteria 394090
51 Ga0068866_10037705 3300005718 Bacteria 2376
52 Ga0068866_10067803 3300005718 Bacteria 1874
53 Ga0068851_10000296 3300005834 Bacteria 22769
54 Ga0068851_10034393 3300005834 Bacteria 2530
55 Ga0068863_100000415 3300005841 Bacteria 43505
56 Ga0068858_100001041 3300005842 Bacteria 28635
57 Ga0068858_100153932 3300005842 Bacteria 2163
58 Ga0068858_100286400 3300005842 Bacteria 1570
59 Ga0068860_100034681 3300005843 Bacteria 4841
60 Ga0068862_100000391 3300005844 Bacteria 47191
61 Ga0081455_10026867 3300005937 Bacteria 5286
62 Ga0081455_10240243 3300005937 Bacteria 1331
63 Ga0070716_100111201 3300006173 Unclassified 1698
64 Ga0070712_100000834 3300006175 Bacteria 18285
65 Ga0068871_100192591 3300006358 Bacteria 1757
66 Ga0075431_100037377 3300006847 Bacteria 5003
67 Ga0075433_10002637 3300006852 Bacteria 13697
68 Ga0105245_10000012 3300009098 Bacteria 267151
69 Ga0105245_10000077 3300009098 Bacteria 101470
70 Ga0105245_10000308 3300009098 Bacteria 46809
71 Ga0105245_10021461 3300009098 Bacteria 5665
72 Ga0105241_10070571 3300009174 Bacteria 2711
73 Ga0105242_10000010 3300009176 Bacteria 151649
74 Ga0105242_10031906 3300009176 Bacteria 4211
75 Ga0105248_10000022 3300009177 Bacteria 275935
76 Ga0105238_10260296 3300009551 Unclassified 1714
77 Ga0105249_10000159 3300009553 Bacteria 82172
78 Ga0105249_10006112 3300009553 Bacteria 10443
79 Ga0105239_10207445 3300010375 Bacteria 2196
80 Ga0105239_10243990 3300010375 Bacteria 2016
81 Ga0157373_10200987 3300013100 Bacteria 1405
82 Ga0157371_10006824 3300013102 Bacteria 9330
83 Ga0157370_10005115 3300013104 Bacteria 14793
84 Ga0157378_10003113 3300013297 Bacteria 14748
85 Ga0163162_10174824 3300013306 Bacteria 2272
86 Ga0163162_11002566 3300013306 Bacteria 944
87 Ga0157372_10001531 3300013307 Bacteria 25145
88 Ga0157375_10000095 3300013308 Bacteria 88952
89 Ga0157375_10000647 3300013308 Bacteria 30840
90 Ga0157380_10000161 3300014326 Bacteria 38543
91 Ga0157380_10341306 3300014326 Bacteria 1397
92 Ga0157379_10011842 3300014968 Bacteria 7619
93 Ga0157379_10156002 3300014968 Bacteria 2059
94 Ga0157379_10251035 3300014968 Bacteria 1606
95 Ga0163161_10000192 3300017792 Bacteria 56160
96 Ga0206356_10473460 3300020070 Bacteria 4178
97 Ga0206353_10712664 3300020082 Bacteria 1971
98 Ga0207656_10005504 3300025321 Bacteria 4480
99 Ga0207682_10000580 3300025893 Bacteria 16945
100 Ga0207642_10000001 3300025899 Bacteria 714030
101 Ga0207642_10000003 3300025899 Bacteria 650651
102 Ga0207642_10000004 3300025899 Bacteria 407822
103 Ga0207642_10000051 3300025899 Bacteria 34399
104 Ga0207642_10042170 3300025899 Bacteria 2004
105 Ga0207680_10017848 3300025903 Bacteria 3757
106 Ga0207680_10037863 3300025903 Bacteria 2788
107 Ga0207705_10108082 3300025909 Bacteria 2053
108 Ga0207693_10003252 3300025915 Bacteria 13938
109 Ga0207663_10049587 3300025916 Bacteria 2605
110 Ga0207649_10000024 3300025920 Bacteria 183104
111 Ga0207652_10024559 3300025921 Bacteria 5001
112 Ga0207694_10000008 3300025924 Bacteria 484902
113 Ga0207659_10000062 3300025926 Bacteria 67607
114 Ga0207687_10000011 3300025927 Bacteria 388349
115 Ga0207687_10000012 3300025927 Bacteria 370729
116 Ga0207687_10000284 3300025927 Bacteria 34858
117 Ga0207687_10011995 3300025927 Bacteria 5667
118 Ga0207690_10562616 3300025932 Unclassified 928
119 Ga0207706_10000026 3300025933 Bacteria 149379
120 Ga0207686_10000107 3300025934 Bacteria 67766
121 Ga0207709_10102081 3300025935 Bacteria 1898
122 Ga0207669_10000037 3300025937 Bacteria 77494
123 Ga0207669_10000070 3300025937 Bacteria 51898
124 Ga0207704_10000004 3300025938 Bacteria 239295
125 Ga0207665_10045533 3300025939 Bacteria 2938
126 Ga0207691_10005660 3300025940 Bacteria 12082
127 Ga0207711_10000019 3300025941 Bacteria 412779
128 Ga0207661_10000115 3300025944 Bacteria 51010
129 Ga0207661_10000166 3300025944 Bacteria 42698
130 Ga0207661_10021521 3300025944 Bacteria 4832
131 Ga0207661_10033954 3300025944 Bacteria 3963
132 Ga0207661_10060153 3300025944 Bacteria 3064
133 Ga0207661_10367507 3300025944 Bacteria 1300
134 Ga0207679_10130992 3300025945 Bacteria 2012
135 Ga0207712_10000003 3300025961 Bacteria 615314
136 Ga0207712_10015128 3300025961 Bacteria 4972
137 Ga0207640_10033779 3300025981 Bacteria 3186
138 Ga0207658_10001890 3300025986 Bacteria 15673
139 Ga0207658_10154047 3300025986 Bacteria 1876
140 Ga0207677_10000142 3300026023 Bacteria 58625
141 Ga0207703_10000153 3300026035 Bacteria 79352
142 Ga0207639_10004980 3300026041 Bacteria 8948
143 Ga0207702_10000027 3300026078 Bacteria 183792
144 Ga0207702_10002493 3300026078 Bacteria 17379
145 Ga0207702_10104759 3300026078 Bacteria 2504
146 Ga0207641_10000072 3300026088 Bacteria 151067
147 Ga0207641_10074066 3300026088 Bacteria 2936
148 Ga0207676_10000026 3300026095 Bacteria 248593
149 Ga0207674_10180585 3300026116 Bacteria 2062
150 Ga0207674_10522439 3300026116 Bacteria 1147
151 Ga0207683_10002237 3300026121 Bacteria 17019
152 Ga0207698_10000002 3300026142 Bacteria 404991
153 Ga0207698_10011454 3300026142 Bacteria 5753
154 Ga0268266_10000023 3300028379 Bacteria 501899
155 Ga0268266_10000503 3300028379 Bacteria 55789
156 Ga0268266_10002461 3300028379 Bacteria 19801
157 Ga0268266_10304648 3300028379 Bacteria 1487
158 Ga0268265_10000440 3300028380 Bacteria 43839
159 Ga0268264_10005165 3300028381 Bacteria 11064
160 Ga0265326_10000015 3300028558 Bacteria 159279
161 Ga0265326_10024778 3300028558 Bacteria 1711
162 Ga0265319_1017844 3300028563 Bacteria 2689
163 Ga0265322_10000003 3300028654 Bacteria 468671
164 Ga0265336_10018662 3300028666 Bacteria 2245
165 Ga0265338_10000383 3300028800 Bacteria 79248
166 Ga0265324_10000074 3300029957 Bacteria 78102
167 Ga0265328_10003735 3300031239 Bacteria 6710
168 Ga0265320_10000001 3300031240 Bacteria 847191
169 Ga0265320_10146775 3300031240 Bacteria 1066
170 Ga0265325_10003895 3300031241 Bacteria 9572
171 Ga0265331_10001660 3300031250 Bacteria 16141
172 Ga0265327_10000003 3300031251 Bacteria 852750
173 Ga0265316_10017011 3300031344 Bacteria 6295
174 Ga0265313_10048349 3300031595 Bacteria 2053
175 Ga0265314_10000222 3300031711 Bacteria 84593
176 Ga0373937_0007624 3300036401 Bacteria 9374
177 Ga0451807_0999406 3300041486 Bacteria 1091
178 Ga0466957_0017253 3300044842 Bacteria 4225
179 Ga0466957_0082844 3300044842 Bacteria 2000
180 Ga0466960_0108676 3300044901 Bacteria 1438
181 Ga0466967_0000008 3300045976 Bacteria 127135
182 Ga0495603_0000022 3300046455 Bacteria 64108
183 Ga0495603_0001386 3300046455 Bacteria 14068
184 Ga0495603_0015457 3300046455 Bacteria 4619
185 Ga0495629_0000028 3300046459 Bacteria 127409
186 Ga0495629_0006302 3300046459 Bacteria 8803
187 Ga0495629_0006845 3300046459 Bacteria 8420
188 Ga0495629_0342268 3300046459 Bacteria 1021
189 Ga0495641_0000012 3300046461 Bacteria 144818
190 Ga0495651_0066183 3300046462 Bacteria 2759
191 Ga0495651_0148828 3300046462 Bacteria 1690
192 Ga0495653_0050485 3300046463 Bacteria 3199
193 Ga0495662_0000006 3300046476 Bacteria 79206
194 Ga0495662_0002044 3300046476 Bacteria 10110
195 Ga0495594_0000021 3300046499 Bacteria 74679
196 Ga0495606_0000219 3300046507 Bacteria 101614
197 Ga0495608_0000001 3300046511 Bacteria 411278
198 Ga0495608_0058253 3300046511 Bacteria 2547
199 Ga0495608_0307246 3300046511 Bacteria 981
200 Ga0495618_0000003 3300046514 Bacteria 256269
201 Ga0495620_0000060 3300046515 Bacteria 95642
202 Ga0495628_0001751 3300046516 Bacteria 19729
203 Ga0495628_0220593 3300046516 Bacteria 1424
204 Ga0495630_0000141 3300046517 Bacteria 55652
205 Ga0495630_0000227 3300046517 Bacteria 44643
206 Ga0495630_0058002 3300046517 Bacteria 2902
207 Ga0495652_0015744 3300046529 Bacteria 6768
208 Ga0495640_0054857 3300046533 Bacteria 2728
209 Ga0495586_0026235 3300046535 Bacteria 3117
210 Ga0495587_0003937 3300046536 Bacteria 9854
211 Ga0495645_0003760 3300046543 Bacteria 10306
212 Ga0495645_0033035 3300046543 Bacteria 3774
213 Ga0495622_0000119 3300046557 Bacteria 68288
214 Ga0495633_0027670 3300046558 Bacteria 2770
215 Ga0495667_0000327 3300046559 Bacteria 30003
216 Ga0495656_0001460 3300046615 Bacteria 7731
217 Ga0495634_0000379 3300046642 Bacteria 43465
218 Ga0495634_0016347 3300046642 Bacteria 5307
219 Ga0495625_0000154 3300046660 Bacteria 105083
220 Ga0495635_0000006 3300046663 Bacteria 301820
221 Ga0495635_0091121 3300046663 Bacteria 2085
222 Ga0495588_0000179 3300046674 Bacteria 77030
223 Ga0495657_0000002 3300046675 Bacteria 411958
224 Ga0495657_0031086 3300046675 Bacteria 3735
225 Ga0495647_0000006 3300046681 Bacteria 105867
226 Ga0495647_0000053 3300046681 Bacteria 31238
227 Ga0495613_0000003 3300046689 Bacteria 248826
228 Ga0495624_0016457 3300046690 Bacteria 4977
229 Ga0495649_0013033 3300046694 Bacteria 4808
230 Ga0495600_0003917 3300046809 Bacteria 8842
231 Ga0495600_0004183 3300046809 Bacteria 8609
232 Ga0495600_0043419 3300046809 Bacteria 2932
233 Ga0495604_0000056 3300047317 Bacteria 100110
234 Ga0495604_0001659 3300047317 Bacteria 18309
235 Ga0495604_0002422 3300047317 Bacteria 14929
236 Ga0495604_0029870 3300047317 Bacteria 4335
237 Ga0495604_0146239 3300047317 Bacteria 1684
238 Ga0495676_0001462 3300047321 Bacteria 20386
239 Ga0495676_0194258 3300047321 Bacteria 1414
240 Ga0495680_0003562 3300047322 Bacteria 15255
241 Ga0495680_0048086 3300047322 Bacteria 3352
242 Ga0495675_0000162 3300047444 Bacteria 47605
243 Ga0495686_0048176 3300047472 Bacteria 2688
244 Ga0495593_0012845 3300047673 Bacteria 4784
245 Ga0495593_0052528 3300047673 Bacteria 2154
246 Ga0495602_0000063 3300048088 Bacteria 104915
247 Ga0495614_0181185 3300048089 Bacteria 948
248 Ga0496100_0000004 3300048903 Bacteria 321778
249 Ga0496100_0000027 3300048903 Bacteria 115829
250 Ga0496101_0000007 3300048904 Bacteria 321778
251 Ga0496101_0000012 3300048904 Bacteria 268127
252 Ga0496102_0000404 3300048905 Bacteria 50274
253 Ga0496102_0020061 3300048905 Bacteria 5900
254 Ga0496103_0000001 3300048906 Bacteria 643471
255 Ga0496103_0100125 3300048906 Bacteria 1834
256 Ga0496104_0000002 3300048907 Bacteria 686017
257 Ga0496104_0000003 3300048907 Bacteria 669219
258 Ga0496104_0001414 3300048907 Bacteria 20795
259 Ga0496104_0010573 3300048907 Bacteria 8243
260 Ga0496105_0000001 3300048908 Bacteria 1328178
261 Ga0496105_0000008 3300048908 Bacteria 335652
262 Ga0496105_0000054 3300048908 Bacteria 89081
263 Ga0496105_0007162 3300048908 Bacteria 8607
264 Ga0496106_0000004 3300048909 Bacteria 279896
265 Ga0496106_0000020 3300048909 Bacteria 169168
266 Ga0496106_0000239 3300048909 Bacteria 38253
267 Ga0496106_0191149 3300048909 Bacteria 1628
268 Ga0496107_0000001 3300048910 Bacteria 321778
269 Ga0496107_0000014 3300048910 Bacteria 176738
270 Ga0496107_0014160 3300048910 Bacteria 5584
271 Ga0496108_0000002 3300048911 Bacteria 700890
272 Ga0496108_0000012 3300048911 Bacteria 258433
273 Ga0496108_0004271 3300048911 Bacteria 11501
274 Ga0496108_0019985 3300048911 Bacteria 5503
275 Ga0496108_0060831 3300048911 Bacteria 3178
276 Ga0496109_0000001 3300048912 Bacteria 700852
277 Ga0496109_0000035 3300048912 Bacteria 159744
278 Ga0496109_0000057 3300048912 Bacteria 120274
279 Ga0496109_0000058 3300048912 Bacteria 118556
280 Ga0496109_0218316 3300048912 Bacteria 1793
281 Ga0496109_0225211 3300048912 Bacteria 1764
282 Ga0496109_0436920 3300048912 Bacteria 1236
283 Ga0496110_0000208 3300048913 Bacteria 37522
284 Ga0496110_0013365 3300048913 Bacteria 6784
285 Ga0496111_0039212 3300048914 Bacteria 3395
286 Ga0496113_0000010 3300048916 Bacteria 86561
287 Ga0496113_0021143 3300048916 Bacteria 4587
288 Ga0496113_0023480 3300048916 Bacteria 4373
289 Ga0496113_0134433 3300048916 Bacteria 1942
290 Ga0496114_0000043 3300048917 Bacteria 131720
291 Ga0496115_0000004 3300048918 Bacteria 319734
292 Ga0496115_0000380 3300048918 Bacteria 36672
293 Ga0496116_0000229 3300048919 Bacteria 104677
294 Ga0496117_0001026 3300048920 Bacteria 42648
295 Ga0496118_0007810 3300048921 Bacteria 11223
296 Ga0496119_0007214 3300048922 Bacteria 10064
297 Ga0496119_0015467 3300048922 Bacteria 5871
298 Ga0496119_0086774 3300048922 Bacteria 1787
299 Ga0496119_0120195 3300048922 Unclassified 1445
300 Ga0496120_0002632 3300048923 Bacteria 17780
301 Ga0496121_0072536 3300048924 Bacteria 2763
302 Ga0496121_0104302 3300048924 Unclassified 2179
303 Ga0496121_0217548 3300048924 Bacteria 1348
304 Ga0496124_0113807 3300048927 Bacteria 2173
305 Ga0496125_0037302 3300048928 Bacteria 4227
306 Ga0496125_0050452 3300048928 Bacteria 3445
307 Ga0496125_0095618 3300048928 Bacteria 2209
308 Ga0496126_0117015 3300048929 Bacteria 2316
309 Ga0501032_0000410 3300049569 Bacteria 35353
310 Ga0501033_0000316 3300049570 Bacteria 45876
311 Ga0501034_0000725 3300049571 Bacteria 49918
312 Ga0501034_0316762 3300049571 Bacteria 1493
313 Ga0501036_0000542 3300049572 Bacteria 27052
314 Ga0501037_0000727 3300049573 Bacteria 24965
315 Ga0501038_0000228 3300049574 Bacteria 47686
316 Ga0501039_0019096 3300049575 Bacteria 5259
317 Ga0501040_0015590 3300049576 Bacteria 5023
318 Ga0501042_0039217 3300049578 Bacteria 3365
319 Ga0501042_0047069 3300049578 Bacteria 3075
320 Ga0501043_0000862 3300049579 Bacteria 26897
321 Ga0501043_0221328 3300049579 Bacteria 1464
322 Ga0501046_0000598 3300049580 Bacteria 35410
323 Ga0501047_0000413 3300049581 Bacteria 47712
324 Ga0501047_0180227 3300049581 Bacteria 1979
325 Ga0501048_0000260 3300049582 Bacteria 35301
326 Ga0501067_0107148 3300049583 Bacteria 1553
327 Ga0501068_0069749 3300049584 Bacteria 2143
328 Ga0501069_0010169 3300049585 Bacteria 4977
329 Ga0501070_0000502 3300049586 Bacteria 35638
330 Ga0501070_0050382 3300049586 Bacteria 3457
331 Ga0501070_0254585 3300049586 Bacteria 1436
332 Ga0501072_0064432 3300049588 Bacteria 2890
333 Ga0501073_0000511 3300049589 Bacteria 27193
334 Ga0501074_0040353 3300049590 Bacteria 3381
335 Ga0501075_0001174 3300049591 Bacteria 16946
336 Ga0501079_0019979 3300049741 Bacteria 5118
337 Ga0501080_0029373 3300049742 Bacteria 5118
338 Ga0501081_0113885 3300049743 Bacteria 1921
339 Ga0501083_0001096 3300049744 Bacteria 18105
340 Ga0501083_0041494 3300049744 Bacteria 3120
341 Ga0501083_0134473 3300049744 Bacteria 1620
342 Ga0501035_0000421 3300049822 Bacteria 47742
343 Ga0501044_0000270 3300049823 Bacteria 65798
344 Ga0501044_0112542 3300049823 Bacteria 2729
345 nmdc:mga06r32_133722_c1 3300050510 Bacteria 2454
346 nmdc:mga08x19_292374_c1 3300050514 Bacteria 1130
347 nmdc:mga0a205_1968_c1 3300050515 Bacteria 17890
348 nmdc:mga0a205_1_c1 3300050515 Bacteria 62269
349 Ga0495601_0000281 3300053077 Bacteria 27326
350 Ga0495601_0013929 3300053077 Bacteria 4842
351 Ga0495601_0018366 3300053077 Bacteria 4255
352 Ga0495601_0181668 3300053077 Bacteria 1375
353 Ga0495612_0000168 3300053078 Bacteria 27483
354 Ga0495612_0003869 3300053078 Bacteria 6209
355 Ga0495595_0000001 3300053084 Bacteria 495226
356 Ga0495595_0000084 3300053084 Bacteria 45392
357 Ga0495595_0011708 3300053084 Bacteria 3672
358 Ga0495619_0000018 3300053085 Bacteria 209943
359 Ga0495619_0000708 3300053085 Bacteria 21719
360 Ga0495619_0001128 3300053085 Bacteria 17562
361 Ga0495619_0003021 3300053085 Bacteria 10928
362 Ga0495619_0027985 3300053085 Bacteria 3634
363 Ga0500566_0004335 3300053094 Bacteria 8465
364 Ga0500566_0109180 3300053094 Bacteria 1506
365 Ga0500614_000999 3300053123 Bacteria 7020
366 Ga0500628_000027 3300053129 Bacteria 60626
367 Ga0501082_0018327 3300060353 Bacteria 6028

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010375 Ga0105239_10207445 Ga0105239_102074452 247
2 3300048918 Ga0496115_0000004 Ga0496115_0000004_158507_159442 247
3 3300013306 Ga0163162_11002566 Ga0163162_110025662 248
4 3300014968 Ga0157379_10011842 Ga0157379_100118422 248
5 3300046642 Ga0495634_0016347 Ga0495634_0016347_2099_3031 248
6 3300005436 Ga0070713_100000055 Ga0070713_10000005552 249
7 3300005356 Ga0070674_100000426 Ga0070674_1000004268 251
8 3300005718 Ga0068866_10000002 Ga0068866_10000002417 251
9 3300025899 Ga0207642_10000001 Ga0207642_10000001201 251
10 3300025899 Ga0207642_10000003 Ga0207642_10000003201 251
11 3300025899 Ga0207642_10000004 Ga0207642_10000004201 251
12 3300025937 Ga0207669_10000070 Ga0207669_100000705 251
13 3300047317 Ga0495604_0000056 Ga0495604_0000056_32547_33446 251
14 3300014326 Ga0157380_10000161 Ga0157380_1000016120 253
15 3300025986 Ga0207658_10154047 Ga0207658_101540472 255
16 3300005564 Ga0070664_100054689 Ga0070664_1000546892 256
17 3300006847 Ga0075431_100037377 Ga0075431_1000373773 257
18 3300013104 Ga0157370_10005115 Ga0157370_1000511514 257
19 3300048909 Ga0496106_0191149 Ga0496106_0191149_274_1131 257
20 3300050510 nmdc:mga06r32_133722_c1 nmdc:mga06r32_133722_c1_1440_2297 257
21 3300005367 Ga0070667_100308301 Ga0070667_1003083012 258
22 3300048911 Ga0496108_0004271 Ga0496108_0004271_9186_10061 258
23 3300048912 Ga0496109_0000058 Ga0496109_0000058_97967_98842 258
24 3300048912 Ga0496109_0225211 Ga0496109_0225211_500_1477 258
25 3300005356 Ga0070674_100000016 Ga0070674_10000001623 259
26 3300005718 Ga0068866_10037705 Ga0068866_100377053 259
27 3300009176 Ga0105242_10031906 Ga0105242_100319065 259
28 3300025899 Ga0207642_10000051 Ga0207642_100000512 259
29 3300025937 Ga0207669_10000037 Ga0207669_1000003767 259
30 3300036401 Ga0373937_0007624 Ga0373937_0007624_6055_6912 259
31 3300046809 Ga0495600_0043419 Ga0495600_0043419_835_1692 259
32 3300047317 Ga0495604_0146239 Ga0495604_0146239_273_1130 259
33 3300009098 Ga0105245_10021461 Ga0105245_100214612 260
34 3300025927 Ga0207687_10011995 Ga0207687_100119954 260
35 3300046476 Ga0495662_0002044 Ga0495662_0002044_1598_2632 260
36 3300049741 Ga0501079_0019979 Ga0501079_0019979_4276_5100 262
37 3300053077 Ga0495601_0181668 Ga0495601_0181668_264_1106 263
38 3300053078 Ga0495612_0000168 Ga0495612_0000168_9905_10747 263
39 3300046455 Ga0495603_0015457 Ga0495603_0015457_3726_4574 264
40 3300046462 Ga0495651_0148828 Ga0495651_0148828_137_964 264
41 3300046543 Ga0495645_0003760 Ga0495645_0003760_7771_8598 264
42 3300048912 Ga0496109_0436920 Ga0496109_0436920_39_899 264
43 3300044842 Ga0466957_0082844 Ga0466957_0082844_1045_1953 265
44 3300047317 Ga0495604_0002422 Ga0495604_0002422_2534_3457 265
45 3300048913 Ga0496110_0000208 Ga0496110_0000208_16372_17343 265
46 3300047321 Ga0495676_0001462 Ga0495676_0001462_10931_11869 266
47 3300020070 Ga0206356_10473460 Ga0206356_104734601 267
48 3300046476 Ga0495662_0000006 Ga0495662_0000006_15184_16053 267
49 3300047673 Ga0495593_0052528 Ga0495593_0052528_756_1652 267
50 3300048089 Ga0495614_0181185 Ga0495614_0181185_58_897 267
51 3300053085 Ga0495619_0027985 Ga0495619_0027985_2453_3292 267
52 3300046517 Ga0495630_0000141 Ga0495630_0000141_10546_11424 268
53 3300046675 Ga0495657_0031086 Ga0495657_0031086_1501_2379 268
54 3300053077 Ga0495601_0013929 Ga0495601_0013929_498_1376 268
55 3300046511 Ga0495608_0307246 Ga0495608_0307246_22_867 269
56 3300005335 Ga0070666_10026254 Ga0070666_100262544 270
57 3300005367 Ga0070667_100004010 Ga0070667_1000040103 270
58 3300048927 Ga0496124_0113807 Ga0496124_0113807_143_1006 270
59 3300048929 Ga0496126_0117015 Ga0496126_0117015_1171_2034 270
60 3300009098 Ga0105245_10000012 Ga0105245_10000012246 271
61 3300025927 Ga0207687_10000011 Ga0207687_10000011300 271
62 3300048922 Ga0496119_0086774 Ga0496119_0086774_20_967 271
63 3300048923 Ga0496120_0002632 Ga0496120_0002632_12505_13452 271
64 3300053077 Ga0495601_0018366 Ga0495601_0018366_1907_2797 271
65 3300005338 Ga0068868_100000008 Ga0068868_10000000839 272
66 3300005354 Ga0070675_100000008 Ga0070675_10000000817 272
67 3300005457 Ga0070662_100000039 Ga0070662_10000003919 272
68 3300005547 Ga0070693_100000471 Ga0070693_10000047116 272
69 3300025926 Ga0207659_10000062 Ga0207659_1000006228 272
70 3300025933 Ga0207706_10000026 Ga0207706_1000002661 272
71 3300026023 Ga0207677_10000142 Ga0207677_1000014238 272
72 3300046455 Ga0495603_0000022 Ga0495603_0000022_61377_62213 272
73 3300050515 nmdc:mga0a205_1968_c1 nmdc:mga0a205_1968_c1_16442_17365 272
74 3300053077 Ga0495601_0000281 Ga0495601_0000281_10439_11479 272
75 3300025935 Ga0207709_10102081 Ga0207709_101020812 273
76 3300005616 Ga0068852_100000007 Ga0068852_100000007123 274
77 3300006852 Ga0075433_10002637 Ga0075433_100026379 274
78 3300013102 Ga0157371_10006824 Ga0157371_1000682410 274
79 3300025938 Ga0207704_10000004 Ga0207704_10000004221 274
80 3300026142 Ga0207698_10000002 Ga0207698_10000002121 274
81 3300028558 Ga0265326_10024778 Ga0265326_100247782 274
82 3300028563 Ga0265319_1017844 Ga0265319_10178442 274
83 3300028800 Ga0265338_10000383 Ga0265338_1000038373 274
84 3300031240 Ga0265320_10146775 Ga0265320_101467752 274
85 3300031241 Ga0265325_10003895 Ga0265325_100038958 274
86 3300048911 Ga0496108_0000012 Ga0496108_0000012_219007_219900 274
87 3300048912 Ga0496109_0000057 Ga0496109_0000057_5412_6305 274
88 3300005329 Ga0070683_100082460 Ga0070683_1000824602 275
89 3300005337 Ga0070682_100214198 Ga0070682_1002141982 275
90 3300005365 Ga0070688_100000423 Ga0070688_10000042311 275
91 3300005466 Ga0070685_10000351 Ga0070685_1000035112 275
92 3300005578 Ga0068854_100048444 Ga0068854_1000484443 275
93 3300005618 Ga0068864_100000035 Ga0068864_10000003587 275
94 3300006358 Ga0068871_100192591 Ga0068871_1001925912 275
95 3300025924 Ga0207694_10000008 Ga0207694_10000008261 275
96 3300025944 Ga0207661_10060153 Ga0207661_100601532 275
97 3300025981 Ga0207640_10033779 Ga0207640_100337792 275
98 3300026095 Ga0207676_10000026 Ga0207676_1000002693 275
99 3300026116 Ga0207674_10522439 Ga0207674_105224392 275
100 3300028558 Ga0265326_10000015 Ga0265326_1000001535 275
101 3300028654 Ga0265322_10000003 Ga0265322_10000003143 275
102 3300028666 Ga0265336_10018662 Ga0265336_100186622 275
103 3300029957 Ga0265324_10000074 Ga0265324_100000749 275
104 3300031239 Ga0265328_10003735 Ga0265328_100037356 275
105 3300031240 Ga0265320_10000001 Ga0265320_10000001143 275
106 3300031250 Ga0265331_10001660 Ga0265331_100016607 275
107 3300031251 Ga0265327_10000003 Ga0265327_10000003143 275
108 3300031344 Ga0265316_10017011 Ga0265316_100170115 275
109 3300031595 Ga0265313_10048349 Ga0265313_100483492 275
110 3300031711 Ga0265314_10000222 Ga0265314_1000022285 275
111 3300046455 Ga0495603_0001386 Ga0495603_0001386_11087_11983 275
112 3300046459 Ga0495629_0342268 Ga0495629_0342268_106_939 275
113 3300046511 Ga0495608_0000001 Ga0495608_0000001_286993_287892 275
114 3300046516 Ga0495628_0220593 Ga0495628_0220593_432_1325 275
115 3300046529 Ga0495652_0015744 Ga0495652_0015744_1049_1882 275
116 3300046543 Ga0495645_0033035 Ga0495645_0033035_1201_2034 275
117 3300046559 Ga0495667_0000327 Ga0495667_0000327_21072_21944 275
118 3300046642 Ga0495634_0000379 Ga0495634_0000379_15482_16318 275
119 3300046663 Ga0495635_0091121 Ga0495635_0091121_374_1330 275
120 3300046675 Ga0495657_0000002 Ga0495657_0000002_287673_288572 275
121 3300046694 Ga0495649_0013033 Ga0495649_0013033_2055_2882 275
122 3300047321 Ga0495676_0194258 Ga0495676_0194258_486_1340 275
123 3300047322 Ga0495680_0003562 Ga0495680_0003562_6352_7224 275
124 3300047444 Ga0495675_0000162 Ga0495675_0000162_44371_45270 275
125 3300047673 Ga0495593_0012845 Ga0495593_0012845_2414_3310 275
126 3300048911 Ga0496108_0060831 Ga0496108_0060831_904_1794 275
127 3300048912 Ga0496109_0218316 Ga0496109_0218316_39_929 275
128 3300048913 Ga0496110_0013365 Ga0496110_0013365_1773_2615 275
129 3300048914 Ga0496111_0039212 Ga0496111_0039212_2126_2968 275
130 3300048916 Ga0496113_0021143 Ga0496113_0021143_2051_2887 275
131 3300048916 Ga0496113_0023480 Ga0496113_0023480_714_1604 275
132 3300048916 Ga0496113_0134433 Ga0496113_0134433_456_1349 275
133 3300048924 Ga0496121_0217548 Ga0496121_0217548_367_1224 275
134 3300049586 Ga0501070_0254585 Ga0501070_0254585_365_1249 275
135 3300049588 Ga0501072_0064432 Ga0501072_0064432_916_1875 275
136 3300049743 Ga0501081_0113885 Ga0501081_0113885_436_1329 275
137 3300053084 Ga0495595_0000001 Ga0495595_0000001_123387_124286 275
138 3300053085 Ga0495619_0000708 Ga0495619_0000708_2330_3229 275
139 3300005329 Ga0070683_100051305 Ga0070683_1000513052 276
140 3300005329 Ga0070683_100195984 Ga0070683_1001959842 276
141 3300005333 Ga0070677_10000247 Ga0070677_100002477 276
142 3300005335 Ga0070666_10048391 Ga0070666_100483912 276
143 3300005337 Ga0070682_100000040 Ga0070682_10000004015 276
144 3300005338 Ga0068868_100000452 Ga0068868_10000045210 276
145 3300005341 Ga0070691_10000010 Ga0070691_1000001024 276
146 3300005341 Ga0070691_10011303 Ga0070691_100113032 276
147 3300005344 Ga0070661_100000052 Ga0070661_10000005215 276
148 3300005347 Ga0070668_100028861 Ga0070668_1000288612 276
149 3300005365 Ga0070688_100000357 Ga0070688_10000035712 276
150 3300005367 Ga0070667_100003090 Ga0070667_1000030907 276
151 3300005439 Ga0070711_100023624 Ga0070711_1000236242 276
152 3300005441 Ga0070700_100250145 Ga0070700_1002501452 276
153 3300005456 Ga0070678_100023929 Ga0070678_1000239293 276
154 3300005466 Ga0070685_10000483 Ga0070685_1000048314 276
155 3300005535 Ga0070684_100026596 Ga0070684_1000265962 276
156 3300005535 Ga0070684_100033232 Ga0070684_1000332323 276
157 3300005539 Ga0068853_100014306 Ga0068853_1000143062 276
158 3300005543 Ga0070672_100000036 Ga0070672_10000003656 276
159 3300005548 Ga0070665_100093214 Ga0070665_1000932143 276
160 3300005548 Ga0070665_100364834 Ga0070665_1003648342 276
161 3300005564 Ga0070664_100031171 Ga0070664_1000311714 276
162 3300005577 Ga0068857_100174700 Ga0068857_1001747002 276
163 3300005614 Ga0068856_100158657 Ga0068856_1001586572 276
164 3300005616 Ga0068852_100042150 Ga0068852_1000421504 276
165 3300005718 Ga0068866_10067803 Ga0068866_100678032 276
166 3300005834 Ga0068851_10000296 Ga0068851_1000029615 276
167 3300005834 Ga0068851_10034393 Ga0068851_100343932 276
168 3300005842 Ga0068858_100001041 Ga0068858_10000104116 276
169 3300005842 Ga0068858_100153932 Ga0068858_1001539323 276
170 3300005843 Ga0068860_100034681 Ga0068860_1000346813 276
171 3300005844 Ga0068862_100000391 Ga0068862_10000039144 276
172 3300005937 Ga0081455_10026867 Ga0081455_100268676 276
173 3300005937 Ga0081455_10240243 Ga0081455_102402432 276
174 3300006173 Ga0070716_100111201 Ga0070716_1001112012 276
175 3300009098 Ga0105245_10000077 Ga0105245_1000007765 276
176 3300009098 Ga0105245_10000308 Ga0105245_1000030811 276
177 3300009176 Ga0105242_10000010 Ga0105242_1000001018 276
178 3300009177 Ga0105248_10000022 Ga0105248_10000022201 276
179 3300009553 Ga0105249_10000159 Ga0105249_1000015915 276
180 3300009553 Ga0105249_10006112 Ga0105249_100061125 276
181 3300013100 Ga0157373_10200987 Ga0157373_102009872 276
182 3300013297 Ga0157378_10003113 Ga0157378_1000311311 276
183 3300013306 Ga0163162_10174824 Ga0163162_101748242 276
184 3300013307 Ga0157372_10001531 Ga0157372_1000153119 276
185 3300013308 Ga0157375_10000647 Ga0157375_1000064712 276
186 3300014326 Ga0157380_10341306 Ga0157380_103413062 276
187 3300014968 Ga0157379_10156002 Ga0157379_101560023 276
188 3300017792 Ga0163161_10000192 Ga0163161_1000019214 276
189 3300020082 Ga0206353_10712664 Ga0206353_107126642 276
190 3300025321 Ga0207656_10005504 Ga0207656_100055045 276
191 3300025893 Ga0207682_10000580 Ga0207682_1000058020 276
192 3300025899 Ga0207642_10042170 Ga0207642_100421703 276
193 3300025916 Ga0207663_10049587 Ga0207663_100495873 276
194 3300025920 Ga0207649_10000024 Ga0207649_10000024111 276
195 3300025927 Ga0207687_10000012 Ga0207687_10000012199 276
196 3300025932 Ga0207690_10562616 Ga0207690_105626161 276
197 3300025934 Ga0207686_10000107 Ga0207686_1000010715 276
198 3300025939 Ga0207665_10045533 Ga0207665_100455333 276
199 3300025940 Ga0207691_10005660 Ga0207691_100056605 276
200 3300025941 Ga0207711_10000019 Ga0207711_10000019138 276
201 3300025944 Ga0207661_10000166 Ga0207661_1000016639 276
202 3300025944 Ga0207661_10033954 Ga0207661_100339544 276
203 3300025944 Ga0207661_10367507 Ga0207661_103675072 276
204 3300025945 Ga0207679_10130992 Ga0207679_101309922 276
205 3300025961 Ga0207712_10000003 Ga0207712_10000003267 276
206 3300025961 Ga0207712_10015128 Ga0207712_100151286 276
207 3300025986 Ga0207658_10001890 Ga0207658_1000189013 276
208 3300026035 Ga0207703_10000153 Ga0207703_1000015316 276
209 3300026041 Ga0207639_10004980 Ga0207639_100049806 276
210 3300026078 Ga0207702_10104759 Ga0207702_101047592 276
211 3300026116 Ga0207674_10180585 Ga0207674_101805852 276
212 3300026121 Ga0207683_10002237 Ga0207683_1000223712 276
213 3300026142 Ga0207698_10011454 Ga0207698_100114544 276
214 3300028379 Ga0268266_10000023 Ga0268266_10000023156 276
215 3300028379 Ga0268266_10002461 Ga0268266_100024612 276
216 3300028379 Ga0268266_10304648 Ga0268266_103046482 276
217 3300028380 Ga0268265_10000440 Ga0268265_100004403 276
218 3300028381 Ga0268264_10005165 Ga0268264_100051658 276
219 3300044842 Ga0466957_0017253 Ga0466957_0017253_939_1880 276
220 3300044901 Ga0466960_0108676 Ga0466960_0108676_350_1198 276
221 3300046459 Ga0495629_0000028 Ga0495629_0000028_15601_16500 276
222 3300046459 Ga0495629_0006302 Ga0495629_0006302_3966_4880 276
223 3300046459 Ga0495629_0006845 Ga0495629_0006845_2636_3469 276
224 3300046461 Ga0495641_0000012 Ga0495641_0000012_38928_39776 276
225 3300046462 Ga0495651_0066183 Ga0495651_0066183_914_1762 276
226 3300046463 Ga0495653_0050485 Ga0495653_0050485_1178_2026 276
227 3300046499 Ga0495594_0000021 Ga0495594_0000021_56339_57241 276
228 3300046507 Ga0495606_0000219 Ga0495606_0000219_76527_77426 276
229 3300046511 Ga0495608_0058253 Ga0495608_0058253_1563_2411 276
230 3300046514 Ga0495618_0000003 Ga0495618_0000003_148145_148987 276
231 3300046515 Ga0495620_0000060 Ga0495620_0000060_67922_68788 276
232 3300046516 Ga0495628_0001751 Ga0495628_0001751_18189_19043 276
233 3300046533 Ga0495640_0054857 Ga0495640_0054857_482_1321 276
234 3300046535 Ga0495586_0026235 Ga0495586_0026235_893_1741 276
235 3300046536 Ga0495587_0003937 Ga0495587_0003937_7892_8779 276
236 3300046557 Ga0495622_0000119 Ga0495622_0000119_12101_13003 276
237 3300046558 Ga0495633_0027670 Ga0495633_0027670_1885_2736 276
238 3300046660 Ga0495625_0000154 Ga0495625_0000154_12426_13310 276
239 3300046663 Ga0495635_0000006 Ga0495635_0000006_300825_301742 276
240 3300046674 Ga0495588_0000179 Ga0495588_0000179_46413_47372 276
241 3300046681 Ga0495647_0000006 Ga0495647_0000006_71679_72533 276
242 3300046681 Ga0495647_0000053 Ga0495647_0000053_22401_23330 276
243 3300046689 Ga0495613_0000003 Ga0495613_0000003_144247_145143 276
244 3300046690 Ga0495624_0016457 Ga0495624_0016457_3034_3876 276
245 3300046809 Ga0495600_0003917 Ga0495600_0003917_3311_4153 276
246 3300046809 Ga0495600_0004183 Ga0495600_0004183_708_1712 276
247 3300047317 Ga0495604_0001659 Ga0495604_0001659_15059_16063 276
248 3300047317 Ga0495604_0029870 Ga0495604_0029870_444_1292 276
249 3300047472 Ga0495686_0048176 Ga0495686_0048176_1223_2077 276
250 3300048088 Ga0495602_0000063 Ga0495602_0000063_23060_24064 276
251 3300048903 Ga0496100_0000004 Ga0496100_0000004_57648_58544 276
252 3300048903 Ga0496100_0000027 Ga0496100_0000027_39702_40640 276
253 3300048904 Ga0496101_0000007 Ga0496101_0000007_57648_58544 276
254 3300048904 Ga0496101_0000012 Ga0496101_0000012_175714_176652 276
255 3300048905 Ga0496102_0000404 Ga0496102_0000404_14639_15505 276
256 3300048905 Ga0496102_0020061 Ga0496102_0020061_3536_4423 276
257 3300048906 Ga0496103_0000001 Ga0496103_0000001_259026_259892 276
258 3300048907 Ga0496104_0000002 Ga0496104_0000002_206816_207706 276
259 3300048907 Ga0496104_0000003 Ga0496104_0000003_414071_414964 276
260 3300048907 Ga0496104_0001414 Ga0496104_0001414_15144_16070 276
261 3300048908 Ga0496105_0000001 Ga0496105_0000001_1120473_1121363 276
262 3300048908 Ga0496105_0000008 Ga0496105_0000008_57903_58796 276
263 3300048908 Ga0496105_0000054 Ga0496105_0000054_80473_81399 276
264 3300048909 Ga0496106_0000004 Ga0496106_0000004_19062_19958 276
265 3300048909 Ga0496106_0000020 Ga0496106_0000020_75215_76153 276
266 3300048909 Ga0496106_0000239 Ga0496106_0000239_22740_23588 276
267 3300048910 Ga0496107_0000001 Ga0496107_0000001_57648_58544 276
268 3300048910 Ga0496107_0000014 Ga0496107_0000014_75204_76142 276
269 3300048910 Ga0496107_0014160 Ga0496107_0014160_1023_1871 276
270 3300048911 Ga0496108_0019985 Ga0496108_0019985_1748_2650 276
271 3300048912 Ga0496109_0000035 Ga0496109_0000035_74749_75651 276
272 3300048916 Ga0496113_0000010 Ga0496113_0000010_26458_27408 276
273 3300048917 Ga0496114_0000043 Ga0496114_0000043_64822_65772 276
274 3300048918 Ga0496115_0000380 Ga0496115_0000380_12021_12971 276
275 3300048919 Ga0496116_0000229 Ga0496116_0000229_56765_57628 276
276 3300048920 Ga0496117_0001026 Ga0496117_0001026_4666_5553 276
277 3300048921 Ga0496118_0007810 Ga0496118_0007810_4147_5034 276
278 3300048922 Ga0496119_0015467 Ga0496119_0015467_1173_2036 276
279 3300048922 Ga0496119_0120195 Ga0496119_0120195_203_1093 276
280 3300048924 Ga0496121_0072536 Ga0496121_0072536_242_1153 276
281 3300048924 Ga0496121_0104302 Ga0496121_0104302_954_1856 276
282 3300048928 Ga0496125_0050452 Ga0496125_0050452_643_1548 276
283 3300049578 Ga0501042_0039217 Ga0501042_0039217_1760_2596 276
284 3300049591 Ga0501075_0001174 Ga0501075_0001174_10764_11612 276
285 3300049744 Ga0501083_0041494 Ga0501083_0041494_518_1390 276
286 3300049744 Ga0501083_0134473 Ga0501083_0134473_518_1450 276
287 3300050514 nmdc:mga08x19_292374_c1 nmdc:mga08x19_292374_c1_94_942 276
288 3300050515 nmdc:mga0a205_1_c1 nmdc:mga0a205_1_c1_56248_57168 276
289 3300053078 Ga0495612_0003869 Ga0495612_0003869_3048_3905 276
290 3300053084 Ga0495595_0000084 Ga0495595_0000084_86_982 276
291 3300053084 Ga0495595_0011708 Ga0495595_0011708_2330_3334 276
292 3300053085 Ga0495619_0003021 Ga0495619_0003021_4900_5796 276
293 3300053094 Ga0500566_0004335 Ga0500566_0004335_107_1021 276
294 3300053094 Ga0500566_0109180 Ga0500566_0109180_102_989 276
295 3300053123 Ga0500614_000999 Ga0500614_000999_1550_2398 276
296 3300053129 Ga0500628_000027 Ga0500628_000027_38166_39059 276
297 3300005535 Ga0070684_100041307 Ga0070684_1000413072 277
298 3300005614 Ga0068856_100001384 Ga0068856_1000013843 277
299 3300005841 Ga0068863_100000415 Ga0068863_10000041543 277
300 3300005842 Ga0068858_100286400 Ga0068858_1002864002 277
301 3300006175 Ga0070712_100000834 Ga0070712_10000083414 277
302 3300009174 Ga0105241_10070571 Ga0105241_100705713 277
303 3300013308 Ga0157375_10000095 Ga0157375_1000009585 277
304 3300014968 Ga0157379_10251035 Ga0157379_102510352 277
305 3300025903 Ga0207680_10017848 Ga0207680_100178482 277
306 3300025903 Ga0207680_10037863 Ga0207680_100378632 277
307 3300025909 Ga0207705_10108082 Ga0207705_101080822 277
308 3300025915 Ga0207693_10003252 Ga0207693_100032524 277
309 3300025927 Ga0207687_10000284 Ga0207687_100002849 277
310 3300025944 Ga0207661_10000115 Ga0207661_1000011512 277
311 3300026078 Ga0207702_10000027 Ga0207702_1000002744 277
312 3300026078 Ga0207702_10002493 Ga0207702_1000249315 277
313 3300026088 Ga0207641_10000072 Ga0207641_1000007289 277
314 3300026088 Ga0207641_10074066 Ga0207641_100740662 277
315 3300028379 Ga0268266_10000503 Ga0268266_1000050337 277
316 3300041486 Ga0451807_0999406 Ga0451807_0999406_189_1055 277
317 3300045976 Ga0466967_0000008 Ga0466967_0000008_22301_23212 277
318 3300046517 Ga0495630_0000227 Ga0495630_0000227_2086_3057 277
319 3300046517 Ga0495630_0058002 Ga0495630_0058002_121_957 277
320 3300046615 Ga0495656_0001460 Ga0495656_0001460_4484_5380 277
321 3300047322 Ga0495680_0048086 Ga0495680_0048086_258_1151 277
322 3300048906 Ga0496103_0100125 Ga0496103_0100125_669_1565 277
323 3300048911 Ga0496108_0000002 Ga0496108_0000002_470525_471382 277
324 3300048912 Ga0496109_0000001 Ga0496109_0000001_470487_471344 277
325 3300048928 Ga0496125_0095618 Ga0496125_0095618_156_1013 277
326 3300049571 Ga0501034_0316762 Ga0501034_0316762_174_1007 277
327 3300049581 Ga0501047_0180227 Ga0501047_0180227_473_1306 277
328 3300049583 Ga0501067_0107148 Ga0501067_0107148_620_1453 277
329 3300049586 Ga0501070_0050382 Ga0501070_0050382_2367_3296 277
330 3300049823 Ga0501044_0112542 Ga0501044_0112542_797_1630 277
331 3300053085 Ga0495619_0000018 Ga0495619_0000018_97670_98608 277
332 3300053085 Ga0495619_0001128 Ga0495619_0001128_2918_3811 277
333 3300005329 Ga0070683_100020933 Ga0070683_1000209334 278
334 3300005455 Ga0070663_100000507 Ga0070663_10000050713 278
335 3300005530 Ga0070679_100004329 Ga0070679_1000043292 278
336 3300009551 Ga0105238_10260296 Ga0105238_102602962 278
337 3300010375 Ga0105239_10243990 Ga0105239_102439902 278
338 3300025921 Ga0207652_10024559 Ga0207652_100245592 278
339 3300025944 Ga0207661_10021521 Ga0207661_100215212 278
340 3300048907 Ga0496104_0010573 Ga0496104_0010573_2772_3617 278
341 3300048908 Ga0496105_0007162 Ga0496105_0007162_1451_2296 278
342 3300048922 Ga0496119_0007214 Ga0496119_0007214_3173_4018 278
343 3300048928 Ga0496125_0037302 Ga0496125_0037302_3199_4044 278
344 3300049569 Ga0501032_0000410 Ga0501032_0000410_2885_3757 278
345 3300049570 Ga0501033_0000316 Ga0501033_0000316_41971_42843 278
346 3300049571 Ga0501034_0000725 Ga0501034_0000725_15512_16384 278
347 3300049572 Ga0501036_0000542 Ga0501036_0000542_3028_3900 278
348 3300049573 Ga0501037_0000727 Ga0501037_0000727_999_1871 278
349 3300049574 Ga0501038_0000228 Ga0501038_0000228_15362_16234 278
350 3300049575 Ga0501039_0019096 Ga0501039_0019096_2477_3349 278
351 3300049576 Ga0501040_0015590 Ga0501040_0015590_2787_3659 278
352 3300049578 Ga0501042_0047069 Ga0501042_0047069_537_1409 278
353 3300049579 Ga0501043_0000862 Ga0501043_0000862_2939_3811 278
354 3300049579 Ga0501043_0221328 Ga0501043_0221328_455_1291 278
355 3300049580 Ga0501046_0000598 Ga0501046_0000598_31471_32343 278
356 3300049581 Ga0501047_0000413 Ga0501047_0000413_31472_32344 278
357 3300049582 Ga0501048_0000260 Ga0501048_0000260_31588_32460 278
358 3300049584 Ga0501068_0069749 Ga0501068_0069749_516_1388 278
359 3300049585 Ga0501069_0010169 Ga0501069_0010169_2431_3303 278
360 3300049586 Ga0501070_0000502 Ga0501070_0000502_3150_4022 278
361 3300049589 Ga0501073_0000511 Ga0501073_0000511_23403_24275 278
362 3300049590 Ga0501074_0040353 Ga0501074_0040353_724_1596 278
363 3300049742 Ga0501080_0029373 Ga0501080_0029373_3106_3978 278
364 3300049744 Ga0501083_0001096 Ga0501083_0001096_14450_15322 278
365 3300049822 Ga0501035_0000421 Ga0501035_0000421_31499_32371 278
366 3300049823 Ga0501044_0000270 Ga0501044_0000270_33306_34178 278
367 3300060353 Ga0501082_0018327 Ga0501082_0018327_2060_2932 278

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00809

Pterin_bind

Pterin binding enzyme

19

277

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jq9-assembly1.cif.gz_B yersinia pestis dhps with pterine-sulfa conjugate compound 16 0.9332 1 275
5u0w-assembly1.cif.gz_B e. coli dihydropteroate synthase complexed with 9-methylguanine 0.93 1 275
3tzn-assembly1.cif.gz_B crystal structure of the yersinia pestis dihydropteroate synthase. 0.93 3 275
3tzf-assembly1.cif.gz_B crystal structure of the yersinia pestis dihydropteroate synthase with sulfonamide drug complex. 0.9256 3 275
5v79-assembly1.cif.gz_A e. coli dihydropteroate synthase complexed with an 8-mercaptoguanine derivative: 2-((2-amino-9-methyl-6-oxo-6,9-dihydro-1h-purin-8-yl)thio)-n-phenylacetamide 0.9249 3 275
ID Description Score Start End Superfamily
3tznB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.93 3 275 3.20.20.20
5jq9A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9121 3 275 3.20.20.20
3tznB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9091 3 275 3.20.20.20
6dayA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9086 1 275 3.20.20.20
1eyeA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9076 16 275 3.20.20.20
ID Description Score Start End GO Terms
AF-A0A640XUS5-F1-model_v4 dihydropteroate synthase (EC 2.5.1.15) 0.9719 2 275 GO:0004156
GO:0005829
GO:0046654
GO:0046656
GO:0046872
AF-A0A838V1I5-F1-model_v4 dihydropteroate synthase (EC 2.5.1.15) 0.9635 3 277 GO:0004156
GO:0005829
GO:0046654
GO:0046656
GO:0046872
AF-A0A640XUS5-F1-model_v4 dihydropteroate synthase (EC 2.5.1.15) 0.9548 2 275 GO:0004156
GO:0005829
GO:0046654
GO:0046656
GO:0046872
AF-A0A838V1I5-F1-model_v4 dihydropteroate synthase (EC 2.5.1.15) 0.9499 3 277 GO:0004156
GO:0005829
GO:0046654
GO:0046656
GO:0046872
AF-A0A6H9WQQ5-F1-model_v4 Dihydropteroate synthase (EC 2.5.1.15) 0.9402 17 275 GO:0004156
GO:0005829
GO:0009396

Feature Viewer

pLDDT pTM Quality
90.11 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map