F424257

General Info

Members Datasets Scaffolds Average Seq Length
367 239 734 85

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100421020|Ga0070675_1004210202
Length 84
Sequence MALYQILYWQELPSQLKVWDDADEIKLELSAATEKIDAAAQARGLTSADDYLAQWKWSDEEERDGTAQEVADALKKELENKFLK

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
136 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
139 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
142 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
144 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
145 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
164 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
165 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
166 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
167 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
168 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
169 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
170 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
171 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
172 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
173 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
174 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
188 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
208 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
217 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
218 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
219 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
223 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
224 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 1.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.54
Nodule 0
Rhizoplane 3.54
Rhizosphere 90.74
Stem 0
Stem Tuber 0
Unclassified 7.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100421020 3300005354 Bacteria 1194
2 Ga0065715_10004449 3300005293 Bacteria 7659
3 Ga0065715_10105085 3300005293 Bacteria 2914
4 Ga0065715_10949894 3300005293 Bacteria 559
5 Ga0065707_10085144 3300005295 Bacteria 6413
6 Ga0070676_11303736 3300005328 Bacteria 555
7 Ga0070683_100217595 3300005329 Bacteria 1815
8 Ga0070677_10719143 3300005333 Bacteria 564
9 Ga0070677_10931635 3300005333 Bacteria 504
10 Ga0070666_10377901 3300005335 Bacteria 1017
11 Ga0070660_101714902 3300005339 Unclassified 535
12 Ga0070689_100804141 3300005340 Bacteria 827
13 Ga0070687_100169756 3300005343 Bacteria 1297
14 Ga0070668_100517524 3300005347 Bacteria 1035
15 Ga0070669_100007713 3300005353 Bacteria 7695
16 Ga0070669_101655042 3300005353 Bacteria 557
17 Ga0070675_100063795 3300005354 Bacteria 3046
18 Ga0070675_100283021 3300005354 Bacteria 1457
19 Ga0070671_100140284 3300005355 Bacteria 2039
20 Ga0070674_100089989 3300005356 Bacteria 2213
21 Ga0070674_100252616 3300005356 Bacteria 1385
22 Ga0070674_101303990 3300005356 Bacteria 647
23 Ga0070673_101447681 3300005364 Bacteria 647
24 Ga0070673_101958857 3300005364 Bacteria 556
25 Ga0070688_100847617 3300005365 Bacteria 718
26 Ga0070659_100165974 3300005366 Bacteria 1807
27 Ga0070659_101502960 3300005366 Bacteria 600
28 Ga0070667_102312757 3300005367 Unclassified 506
29 Ga0070709_10556777 3300005434 Bacteria 878
30 Ga0070701_10331492 3300005438 Bacteria 945
31 Ga0070705_101358974 3300005440 Bacteria 591
32 Ga0070700_100106406 3300005441 Bacteria 1857
33 Ga0070700_100376578 3300005441 Bacteria 1060
34 Ga0070700_101313594 3300005441 Bacteria 608
35 Ga0070700_101897178 3300005441 Bacteria 515
36 Ga0070694_100437796 3300005444 Bacteria 1030
37 Ga0070708_100517746 3300005445 Bacteria 1125
38 Ga0070663_100407480 3300005455 Bacteria 1113
39 Ga0070663_100456857 3300005455 Bacteria 1054
40 Ga0070663_101377025 3300005455 Bacteria 624
41 Ga0070678_100069227 3300005456 Bacteria 2634
42 Ga0070678_100454354 3300005456 Bacteria 1122
43 Ga0070681_10301807 3300005458 Unclassified 1511
44 Ga0068867_101273962 3300005459 Bacteria 678
45 Ga0070685_11605252 3300005466 Unclassified 503
46 Ga0070698_100169021 3300005471 Bacteria 2128
47 Ga0070679_100000725 3300005530 Bacteria 28466
48 Ga0070684_100014207 3300005535 Bacteria 6442
49 Ga0070684_100892487 3300005535 Bacteria 833
50 Ga0068853_101491661 3300005539 Bacteria 655
51 Ga0070672_100139834 3300005543 Bacteria 1996
52 Ga0070672_100140344 3300005543 Bacteria 1992
53 Ga0070672_100298745 3300005543 Bacteria 1364
54 Ga0070664_100395967 3300005564 Bacteria 1262
55 Ga0070664_100564804 3300005564 Bacteria 1053
56 Ga0070664_100770290 3300005564 Bacteria 899
57 Ga0068857_100462214 3300005577 Bacteria 1188
58 Ga0068854_101603772 3300005578 Bacteria 593
59 Ga0068856_100361077 3300005614 Bacteria 1471
60 Ga0070702_100227243 3300005615 Bacteria 1251
61 Ga0070702_101662831 3300005615 Bacteria 530
62 Ga0068859_102305881 3300005617 Bacteria 594
63 Ga0068866_10784545 3300005718 Bacteria 661
64 Ga0068861_100661652 3300005719 Bacteria 966
65 Ga0068870_10372857 3300005840 Unclassified 922
66 Ga0068870_11116304 3300005840 Bacteria 568
67 Ga0068863_100193741 3300005841 Bacteria 1954
68 Ga0068863_100639416 3300005841 Bacteria 1055
69 Ga0068860_100494962 3300005843 Unclassified 1220
70 Ga0068862_100062662 3300005844 Bacteria 3198
71 Ga0075368_10576310 3300006042 Bacteria 508
72 Ga0070712_101250731 3300006175 Unclassified 646
73 Ga0075367_10167707 3300006178 Bacteria 1367
74 Ga0075367_10908375 3300006178 Bacteria 561
75 Ga0075366_10008028 3300006195 Bacteria 5848
76 Ga0075366_10053324 3300006195 Bacteria 2402
77 Ga0075366_10240726 3300006195 Bacteria 1103
78 Ga0097621_100212730 3300006237 Bacteria 1682
79 Ga0097621_100699818 3300006237 Bacteria 933
80 Ga0068871_100997475 3300006358 Bacteria 780
81 Ga0068871_102316577 3300006358 Bacteria 512
82 Ga0075428_100043440 3300006844 Bacteria 4940
83 Ga0075428_100111787 3300006844 Bacteria 2976
84 Ga0075428_100320083 3300006844 Bacteria 1667
85 Ga0075428_101654697 3300006844 Bacteria 668
86 Ga0075430_100030750 3300006846 Bacteria 4560
87 Ga0075430_100094531 3300006846 Bacteria 2499
88 Ga0075430_100187356 3300006846 Bacteria 1720
89 Ga0075431_100037612 3300006847 Bacteria 4984
90 Ga0075431_100076356 3300006847 Bacteria 3457
91 Ga0075431_100171178 3300006847 Bacteria 2231
92 Ga0075433_10150379 3300006852 Bacteria 2071
93 Ga0075434_100231791 3300006871 Bacteria 1866
94 Ga0075434_100291120 3300006871 Bacteria 1653
95 Ga0075429_100190324 3300006880 Unclassified 1798
96 Ga0075429_100249975 3300006880 Bacteria 1553
97 Ga0075429_100592963 3300006880 Bacteria 971
98 Ga0068865_100353195 3300006881 Bacteria 1191
99 Ga0075436_100188951 3300006914 Bacteria 1457
100 Ga0075436_100849556 3300006914 Unclassified 681
101 Ga0097620_102305899 3300006931 Bacteria 594
102 Ga0075435_100025360 3300007076 Bacteria 4615
103 Ga0111539_10000982 3300009094 Bacteria 37391
104 Ga0111539_10002888 3300009094 Bacteria 22812
105 Ga0111539_10046037 3300009094 Bacteria 5220
106 Ga0111539_10059246 3300009094 Bacteria 4541
107 Ga0114129_10001828 3300009147 Bacteria 28970
108 Ga0114129_10028915 3300009147 Bacteria 7852
109 Ga0114129_10088209 3300009147 Bacteria 4301
110 Ga0105243_10290832 3300009148 Bacteria 1476
111 Ga0105243_10735605 3300009148 Bacteria 965
112 Ga0105248_12867113 3300009177 Bacteria 550
113 Ga0105238_10676917 3300009551 Bacteria 1043
114 Ga0105249_10001093 3300009553 Bacteria 24114
115 Ga0105246_10092276 3300011119 Bacteria 2185
116 Ga0157325_1011970 3300012485 Bacteria 662
117 Ga0157370_10005724 3300013104 Bacteria 13896
118 Ga0157370_11136630 3300013104 Bacteria 705
119 Ga0157369_10017268 3300013105 Bacteria 8111
120 Ga0157369_11087586 3300013105 Bacteria 817
121 Ga0157372_10184147 3300013307 Bacteria 2418
122 Ga0157372_12359942 3300013307 Bacteria 611
123 Ga0157375_11100986 3300013308 Bacteria 930
124 Ga0157375_11700698 3300013308 Bacteria 747
125 Ga0163163_10463085 3300014325 Bacteria 1328
126 Ga0157380_10663964 3300014326 Bacteria 1042
127 Ga0157380_10734219 3300014326 Bacteria 997
128 Ga0157377_10027435 3300014745 Bacteria 3057
129 Ga0157377_10047814 3300014745 Bacteria 2398
130 Ga0157379_10187982 3300014968 Bacteria 1867
131 Ga0157379_11180623 3300014968 Unclassified 735
132 Ga0157379_12237734 3300014968 Bacteria 544
133 Ga0157376_10752002 3300014969 Bacteria 984
134 Ga0163161_10320556 3300017792 Bacteria 1225
135 Ga0197907_10669767 3300020069 Bacteria 1147
136 Ga0206352_10633843 3300020078 Bacteria 1164
137 Ga0213875_10045027 3300021388 Bacteria 2071
138 Ga0209233_1043616 3300025261 Bacteria 955
139 Ga0207666_1016952 3300025271 Bacteria 1048
140 Ga0207697_10114003 3300025315 Bacteria 1159
141 Ga0207656_10203292 3300025321 Bacteria 957
142 Ga0207682_10015888 3300025893 Bacteria 2934
143 Ga0207682_10143249 3300025893 Bacteria 1074
144 Ga0207688_10101022 3300025901 Bacteria 1666
145 Ga0207688_10478637 3300025901 Bacteria 778
146 Ga0207699_11353814 3300025906 Bacteria 527
147 Ga0207645_10101519 3300025907 Bacteria 1856
148 Ga0207643_10177661 3300025908 Bacteria 1287
149 Ga0207643_10652725 3300025908 Bacteria 679
150 Ga0207707_10322398 3300025912 Bacteria 1334
151 Ga0207695_10006829 3300025913 Bacteria 14696
152 Ga0207671_10978671 3300025914 Bacteria 667
153 Ga0207657_11092562 3300025919 Unclassified 610
154 Ga0207649_10178295 3300025920 Bacteria 1485
155 Ga0207652_10002846 3300025921 Bacteria 14495
156 Ga0207681_10031346 3300025923 Bacteria 3471
157 Ga0207694_10024523 3300025924 Bacteria 4582
158 Ga0207694_10473510 3300025924 Bacteria 1047
159 Ga0207694_11344528 3300025924 Unclassified 604
160 Ga0207650_10329321 3300025925 Bacteria 1252
161 Ga0207659_10029883 3300025926 Bacteria 3718
162 Ga0207659_10272539 3300025926 Bacteria 1381
163 Ga0207659_10326011 3300025926 Bacteria 1268
164 Ga0207644_10556764 3300025931 Bacteria 949
165 Ga0207690_10890438 3300025932 Bacteria 738
166 Ga0207706_10574826 3300025933 Bacteria 969
167 Ga0207709_10407607 3300025935 Bacteria 1041
168 Ga0207709_10608466 3300025935 Bacteria 866
169 Ga0207670_10485946 3300025936 Bacteria 1001
170 Ga0207669_10158280 3300025937 Bacteria 1596
171 Ga0207669_10652868 3300025937 Bacteria 860
172 Ga0207669_11108325 3300025937 Unclassified 668
173 Ga0207704_10035982 3300025938 Bacteria 2844
174 Ga0207704_11028407 3300025938 Bacteria 698
175 Ga0207691_10040864 3300025940 Bacteria 4284
176 Ga0207691_10319612 3300025940 Bacteria 1331
177 Ga0207711_10435898 3300025941 Bacteria 1219
178 Ga0207689_10539532 3300025942 Bacteria 979
179 Ga0207661_10304269 3300025944 Bacteria 1430
180 Ga0207679_10482225 3300025945 Bacteria 1104
181 Ga0207679_11235493 3300025945 Bacteria 686
182 Ga0207679_11464680 3300025945 Bacteria 626
183 Ga0207667_11131733 3300025949 Bacteria 765
184 Ga0207651_10195324 3300025960 Bacteria 1617
185 Ga0207651_11690073 3300025960 Bacteria 570
186 Ga0207712_10012177 3300025961 Bacteria 5494
187 Ga0207712_10490952 3300025961 Bacteria 1048
188 Ga0207668_10505352 3300025972 Bacteria 1040
189 Ga0207640_10942945 3300025981 Bacteria 756
190 Ga0207640_11025561 3300025981 Bacteria 727
191 Ga0207677_10501050 3300026023 Bacteria 1050
192 Ga0207678_10067101 3300026067 Bacteria 3079
193 Ga0207678_10495740 3300026067 Bacteria 1064
194 Ga0207708_10032850 3300026075 Bacteria 3940
195 Ga0207708_11002644 3300026075 Bacteria 726
196 Ga0207708_11310797 3300026075 Bacteria 634
197 Ga0207702_10111757 3300026078 Bacteria 2430
198 Ga0207641_10270523 3300026088 Bacteria 1594
199 Ga0207648_10419180 3300026089 Bacteria 1215
200 Ga0207676_10065241 3300026095 Bacteria 2899
201 Ga0207676_11531543 3300026095 Bacteria 664
202 Ga0207674_10337976 3300026116 Bacteria 1456
203 Ga0207675_100164317 3300026118 Bacteria 2119
204 Ga0207675_102322890 3300026118 Bacteria 550
205 Ga0207683_10155807 3300026121 Bacteria 2063
206 Ga0207698_10386144 3300026142 Bacteria 1334
207 Ga0207698_10681994 3300026142 Bacteria 1021
208 Ga0207428_10008483 3300027907 Bacteria 9279
209 Ga0207428_10238875 3300027907 Bacteria 1358
210 Ga0268266_11577760 3300028379 Bacteria 632
211 Ga0268265_10058915 3300028380 Bacteria 2935
212 Ga0268264_11504996 3300028381 Unclassified 684
213 Ga0265337_1161083 3300028556 Bacteria 608
214 Ga0265318_10380956 3300028577 Unclassified 515
215 Ga0265338_10010002 3300028800 Bacteria 11214
216 Ga0265338_10020498 3300028800 Bacteria 6951
217 Ga0265338_10146915 3300028800 Bacteria 1838
218 Ga0265338_10305747 3300028800 Bacteria 1155
219 Ga0265338_10998512 3300028800 Unclassified 567
220 Ga0265324_10034466 3300029957 Bacteria 1763
221 Ga0265762_1067998 3300030760 Bacteria 743
222 Ga0265770_1103741 3300030878 Bacteria 581
223 Ga0265330_10000643 3300031235 Bacteria 22456
224 Ga0265330_10499842 3300031235 Unclassified 517
225 Ga0265320_10168921 3300031240 Bacteria 983
226 Ga0265325_10000415 3300031241 Bacteria 30438
227 Ga0265325_10205475 3300031241 Bacteria 906
228 Ga0265340_10050669 3300031247 Bacteria 2013
229 Ga0265339_10009576 3300031249 Bacteria 6072
230 Ga0265339_10020389 3300031249 Bacteria 3874
231 Ga0265339_10024014 3300031249 Bacteria 3518
232 Ga0265339_10132379 3300031249 Bacteria 1274
233 Ga0265339_10280191 3300031249 Unclassified 799
234 Ga0265339_10393054 3300031249 Bacteria 649
235 Ga0265316_10003308 3300031344 Bacteria 16346
236 Ga0265316_10055215 3300031344 Bacteria 3107
237 Ga0265316_11084930 3300031344 Unclassified 556
238 Ga0307408_100022013 3300031548 Bacteria 4324
239 Ga0265313_10001128 3300031595 Bacteria 25524
240 Ga0265313_10203787 3300031595 Unclassified 822
241 Ga0265314_10019497 3300031711 Bacteria 5255
242 Ga0265342_10000156 3300031712 Bacteria 77615
243 Ga0265342_10008929 3300031712 Bacteria 7121
244 Ga0265342_10284687 3300031712 Bacteria 874
245 Ga0307405_10161894 3300031731 Bacteria 1586
246 Ga0307413_10451892 3300031824 Bacteria 1020
247 Ga0307413_11109180 3300031824 Bacteria 684
248 Ga0307406_10262711 3300031901 Bacteria 1307
249 Ga0307407_10560015 3300031903 Bacteria 846
250 Ga0307412_10128301 3300031911 Bacteria 1838
251 Ga0307412_10310341 3300031911 Bacteria 1250
252 Ga0307409_100589413 3300031995 Bacteria 1097
253 Ga0307409_101081397 3300031995 Bacteria 823
254 Ga0307409_102054702 3300031995 Bacteria 601
255 Ga0307411_10083461 3300032005 Bacteria 2207
256 Ga0307415_101919360 3300032126 Bacteria 575
257 Ga0373941_0465218 3300035115 Bacteria 533
258 Ga0373931_1146967 3300035691 Bacteria 530
259 Ga0436364_0586981 3300037853 Bacteria 1058
260 Ga0436364_1284239 3300037853 Bacteria 2888
261 Ga0436365_0046540 3300039437 Unclassified 670
262 Ga0436362_0201669 3300039453 Unclassified 1004
263 Ga0451839_1148064 3300041496 Unclassified 608
264 Ga0451851_0959297 3300041507 Bacteria 638
265 Ga0451843_0204304 3300041509 Bacteria 840
266 Ga0451853_0918398 3300041512 Bacteria 554
267 Ga0439441_014947 3300042001 Bacteria 1367
268 Ga0439450_060214 3300042008 Bacteria 916
269 Ga0450895_019714 3300042132 Bacteria 621
270 Ga0450908_003803 3300042184 Bacteria 2921
271 Ga0439435_0028018 3300042436 Bacteria 1511
272 Ga0439464_0006881 3300042439 Bacteria 2967
273 Ga0450918_083064 3300042531 Bacteria 613
274 Ga0451576_0068563 3300045051 Bacteria 3691
275 Ga0495629_0103045 3300046459 Bacteria 1991
276 Ga0495641_0040406 3300046461 Bacteria 2169
277 Ga0495639_0123244 3300046475 Bacteria 1237
278 Ga0495662_0276083 3300046476 Bacteria 827
279 Ga0495664_0107400 3300046477 Bacteria 1684
280 Ga0495664_0605005 3300046477 Unclassified 651
281 Ga0495628_0101598 3300046516 Bacteria 2219
282 Ga0495628_1006016 3300046516 Bacteria 573
283 Ga0495665_0580182 3300046531 Unclassified 561
284 Ga0495586_0005779 3300046535 Bacteria 6615
285 Ga0495645_0003203 3300046543 Bacteria 11097
286 Ga0495645_0431428 3300046543 Bacteria 834
287 Ga0495667_0052805 3300046559 Bacteria 2677
288 Ga0495634_0152803 3300046642 Bacteria 1459
289 Ga0495599_0371336 3300046678 Bacteria 855
290 Ga0495599_0666121 3300046678 Bacteria 602
291 Ga0495623_0182908 3300046679 Bacteria 1216
292 Ga0495658_0012456 3300046683 Bacteria 4307
293 Ga0495613_0097814 3300046689 Bacteria 2121
294 Ga0495624_0487317 3300046690 Bacteria 738
295 Ga0495604_0182861 3300047317 Bacteria 1465
296 Ga0495674_0006811 3300047319 Bacteria 10942
297 Ga0495674_0913512 3300047319 Bacteria 677
298 Ga0495676_0380617 3300047321 Bacteria 939
299 Ga0495675_0064254 3300047444 Bacteria 2321
300 Ga0495675_0151669 3300047444 Bacteria 1432
301 Ga0495684_0051989 3300047471 Bacteria 3126
302 Ga0496102_0316870 3300048905 Bacteria 1469
303 Ga0496103_0274668 3300048906 Bacteria 1084
304 Ga0496104_0273742 3300048907 Bacteria 1601
305 Ga0496104_0637422 3300048907 Unclassified 975
306 Ga0496105_1170964 3300048908 Bacteria 567
307 Ga0496106_0719193 3300048909 Bacteria 795
308 Ga0496108_0622209 3300048911 Bacteria 940
309 Ga0496108_0855454 3300048911 Bacteria 782
310 Ga0496109_0183891 3300048912 Bacteria 1964
311 Ga0496110_0141614 3300048913 Bacteria 2174
312 Ga0496110_0226518 3300048913 Bacteria 1700
313 Ga0496111_0438821 3300048914 Bacteria 964
314 Ga0496112_0076558 3300048915 Bacteria 3309
315 Ga0501298_006837 3300049521 Bacteria 1878
316 Ga0501299_004529 3300049522 Bacteria 2083
317 Ga0501040_0180037 3300049576 Bacteria 1498
318 Ga0501042_0380085 3300049578 Bacteria 1022
319 Ga0501042_0515091 3300049578 Bacteria 869
320 Ga0501048_0327562 3300049582 Bacteria 1091
321 Ga0501068_0393441 3300049584 Bacteria 893
322 Ga0501071_0052841 3300049587 Bacteria 2930
323 Ga0501075_0011737 3300049591 Bacteria 6210
324 Ga0501075_0174644 3300049591 Bacteria 1640
325 Ga0501076_0143944 3300049592 Bacteria 1937
326 Ga0501076_1077407 3300049592 Bacteria 662
327 Ga0501216_153633 3300049660 Bacteria 548
328 Ga0501233_060957 3300049668 Bacteria 936
329 Ga0501257_257705 3300049686 Bacteria 519
330 Ga0501221_027214 3300049704 Bacteria 1167
331 Ga0501079_0415708 3300049741 Bacteria 1055
332 Ga0501081_1135614 3300049743 Bacteria 591
333 Ga0501268_030932 3300049765 Bacteria 968
334 Ga0501271_042991 3300049768 Bacteria 594
335 nmdc:mga0yw44_1045690_c1 3300050492 Bacteria 552
336 nmdc:mga0k408_165790_c1 3300050493 Bacteria 1316
337 nmdc:mga0k408_166175_c1 3300050493 Bacteria 1315
338 nmdc:mga0k408_18357_c1 3300050493 Bacteria 3904
339 nmdc:mga0k408_478775_c1 3300050493 Bacteria 738
340 nmdc:mga06z11_411122_c1 3300050494 Bacteria 815
341 nmdc:mga05p37_426_c1 3300050507 Bacteria 45626
342 nmdc:mga05p37_5661_c1 3300050507 Bacteria 14692
343 nmdc:mga05p37_6042_c1 3300050507 Bacteria 14252
344 nmdc:mga09592_1148791_c1 3300050508 Bacteria 644
345 nmdc:mga09592_138118_c1 3300050508 Bacteria 2100
346 nmdc:mga09592_23119_c1 3300050508 Bacteria 5132
347 nmdc:mga0qj67_124257_c1 3300050509 Bacteria 2088
348 nmdc:mga0qj67_3700_c1 3300050509 Bacteria 11041
349 nmdc:mga0qj67_9883_c1 3300050509 Bacteria 7113
350 nmdc:mga06r32_33342_c1 3300050510 Bacteria 4850
351 nmdc:mga06r32_6023_c1 3300050510 Bacteria 10911
352 nmdc:mga06r32_68964_c1 3300050510 Bacteria 3417
353 nmdc:mga08y16_1256889_c1 3300050511 Unclassified 709
354 nmdc:mga08y16_12962_c1 3300050511 Bacteria 8773
355 nmdc:mga08y16_1391399_c1 3300050511 Bacteria 665
356 nmdc:mga08y16_161951_c1 3300050511 Bacteria 2325
357 nmdc:mga08y16_32351_c1 3300050511 Bacteria 5499
358 nmdc:mga08y16_65382_c1 3300050511 Bacteria 3797
359 nmdc:mga0n895_173595_c1 3300050512 Bacteria 2187
360 nmdc:mga0rr50_33300_c1 3300050513 Bacteria 3680
361 nmdc:mga08x19_691357_c1 3300050514 Unclassified 724
362 nmdc:mga0a205_144716_c1 3300050515 Bacteria 2277
363 Ga0501084_0124681 3300054114 Bacteria 2167
364 Ga0590075_164218 3300059424 Bacteria 586
365 Ga0501082_0587573 3300060353 Bacteria 974
366 Ga0530510_0468422 3300061734 Bacteria 953
367 Ga0530510_0755125 3300061734 Unclassified 742
368 Ga0070675_100421020
369 Ga0065715_10004449
370 Ga0065715_10105085
371 Ga0065715_10949894
372 Ga0065707_10085144
373 Ga0070676_11303736
374 Ga0070683_100217595
375 Ga0070677_10719143
376 Ga0070677_10931635
377 Ga0070666_10377901
378 Ga0070660_101714902
379 Ga0070689_100804141
380 Ga0070687_100169756
381 Ga0070668_100517524
382 Ga0070669_100007713
383 Ga0070669_101655042
384 Ga0070675_100063795
385 Ga0070675_100283021
386 Ga0070671_100140284
387 Ga0070674_100089989
388 Ga0070674_100252616
389 Ga0070674_101303990
390 Ga0070673_101447681
391 Ga0070673_101958857
392 Ga0070688_100847617
393 Ga0070659_100165974
394 Ga0070659_101502960
395 Ga0070667_102312757
396 Ga0070709_10556777
397 Ga0070701_10331492
398 Ga0070705_101358974
399 Ga0070700_100106406
400 Ga0070700_100376578
401 Ga0070700_101313594
402 Ga0070700_101897178
403 Ga0070694_100437796
404 Ga0070708_100517746
405 Ga0070663_100407480
406 Ga0070663_100456857
407 Ga0070663_101377025
408 Ga0070678_100069227
409 Ga0070678_100454354
410 Ga0070681_10301807
411 Ga0068867_101273962
412 Ga0070685_11605252
413 Ga0070698_100169021
414 Ga0070679_100000725
415 Ga0070684_100014207
416 Ga0070684_100892487
417 Ga0068853_101491661
418 Ga0070672_100139834
419 Ga0070672_100140344
420 Ga0070672_100298745
421 Ga0070664_100395967
422 Ga0070664_100564804
423 Ga0070664_100770290
424 Ga0068857_100462214
425 Ga0068854_101603772
426 Ga0068856_100361077
427 Ga0070702_100227243
428 Ga0070702_101662831
429 Ga0068859_102305881
430 Ga0068866_10784545
431 Ga0068861_100661652
432 Ga0068870_10372857
433 Ga0068870_11116304
434 Ga0068863_100193741
435 Ga0068863_100639416
436 Ga0068860_100494962
437 Ga0068862_100062662
438 Ga0075368_10576310
439 Ga0070712_101250731
440 Ga0075367_10167707
441 Ga0075367_10908375
442 Ga0075366_10008028
443 Ga0075366_10053324
444 Ga0075366_10240726
445 Ga0097621_100212730
446 Ga0097621_100699818
447 Ga0068871_100997475
448 Ga0068871_102316577
449 Ga0075428_100043440
450 Ga0075428_100111787
451 Ga0075428_100320083
452 Ga0075428_101654697
453 Ga0075430_100030750
454 Ga0075430_100094531
455 Ga0075430_100187356
456 Ga0075431_100037612
457 Ga0075431_100076356
458 Ga0075431_100171178
459 Ga0075433_10150379
460 Ga0075434_100231791
461 Ga0075434_100291120
462 Ga0075429_100190324
463 Ga0075429_100249975
464 Ga0075429_100592963
465 Ga0068865_100353195
466 Ga0075436_100188951
467 Ga0075436_100849556
468 Ga0097620_102305899
469 Ga0075435_100025360
470 Ga0111539_10000982
471 Ga0111539_10002888
472 Ga0111539_10046037
473 Ga0111539_10059246
474 Ga0114129_10001828
475 Ga0114129_10028915
476 Ga0114129_10088209
477 Ga0105243_10290832
478 Ga0105243_10735605
479 Ga0105248_12867113
480 Ga0105238_10676917
481 Ga0105249_10001093
482 Ga0105246_10092276
483 Ga0157325_1011970
484 Ga0157370_10005724
485 Ga0157370_11136630
486 Ga0157369_10017268
487 Ga0157369_11087586
488 Ga0157372_10184147
489 Ga0157372_12359942
490 Ga0157375_11100986
491 Ga0157375_11700698
492 Ga0163163_10463085
493 Ga0157380_10663964
494 Ga0157380_10734219
495 Ga0157377_10027435
496 Ga0157377_10047814
497 Ga0157379_10187982
498 Ga0157379_11180623
499 Ga0157379_12237734
500 Ga0157376_10752002
501 Ga0163161_10320556
502 Ga0197907_10669767
503 Ga0206352_10633843
504 Ga0213875_10045027
505 Ga0209233_1043616
506 Ga0207666_1016952
507 Ga0207697_10114003
508 Ga0207656_10203292
509 Ga0207682_10015888
510 Ga0207682_10143249
511 Ga0207688_10101022
512 Ga0207688_10478637
513 Ga0207699_11353814
514 Ga0207645_10101519
515 Ga0207643_10177661
516 Ga0207643_10652725
517 Ga0207707_10322398
518 Ga0207695_10006829
519 Ga0207671_10978671
520 Ga0207657_11092562
521 Ga0207649_10178295
522 Ga0207652_10002846
523 Ga0207681_10031346
524 Ga0207694_10024523
525 Ga0207694_10473510
526 Ga0207694_11344528
527 Ga0207650_10329321
528 Ga0207659_10029883
529 Ga0207659_10272539
530 Ga0207659_10326011
531 Ga0207644_10556764
532 Ga0207690_10890438
533 Ga0207706_10574826
534 Ga0207709_10407607
535 Ga0207709_10608466
536 Ga0207670_10485946
537 Ga0207669_10158280
538 Ga0207669_10652868
539 Ga0207669_11108325
540 Ga0207704_10035982
541 Ga0207704_11028407
542 Ga0207691_10040864
543 Ga0207691_10319612
544 Ga0207711_10435898
545 Ga0207689_10539532
546 Ga0207661_10304269
547 Ga0207679_10482225
548 Ga0207679_11235493
549 Ga0207679_11464680
550 Ga0207667_11131733
551 Ga0207651_10195324
552 Ga0207651_11690073
553 Ga0207712_10012177
554 Ga0207712_10490952
555 Ga0207668_10505352
556 Ga0207640_10942945
557 Ga0207640_11025561
558 Ga0207677_10501050
559 Ga0207678_10067101
560 Ga0207678_10495740
561 Ga0207708_10032850
562 Ga0207708_11002644
563 Ga0207708_11310797
564 Ga0207702_10111757
565 Ga0207641_10270523
566 Ga0207648_10419180
567 Ga0207676_10065241
568 Ga0207676_11531543
569 Ga0207674_10337976
570 Ga0207675_100164317
571 Ga0207675_102322890
572 Ga0207683_10155807
573 Ga0207698_10386144
574 Ga0207698_10681994
575 Ga0207428_10008483
576 Ga0207428_10238875
577 Ga0268266_11577760
578 Ga0268265_10058915
579 Ga0268264_11504996
580 Ga0265337_1161083
581 Ga0265318_10380956
582 Ga0265338_10010002
583 Ga0265338_10020498
584 Ga0265338_10146915
585 Ga0265338_10305747
586 Ga0265338_10998512
587 Ga0265324_10034466
588 Ga0265762_1067998
589 Ga0265770_1103741
590 Ga0265330_10000643
591 Ga0265330_10499842
592 Ga0265320_10168921
593 Ga0265325_10000415
594 Ga0265325_10205475
595 Ga0265340_10050669
596 Ga0265339_10009576
597 Ga0265339_10020389
598 Ga0265339_10024014
599 Ga0265339_10132379
600 Ga0265339_10280191
601 Ga0265339_10393054
602 Ga0265316_10003308
603 Ga0265316_10055215
604 Ga0265316_11084930
605 Ga0307408_100022013
606 Ga0265313_10001128
607 Ga0265313_10203787
608 Ga0265314_10019497
609 Ga0265342_10000156
610 Ga0265342_10008929
611 Ga0265342_10284687
612 Ga0307405_10161894
613 Ga0307413_10451892
614 Ga0307413_11109180
615 Ga0307406_10262711
616 Ga0307407_10560015
617 Ga0307412_10128301
618 Ga0307412_10310341
619 Ga0307409_100589413
620 Ga0307409_101081397
621 Ga0307409_102054702
622 Ga0307411_10083461
623 Ga0307415_101919360
624 Ga0373941_0465218
625 Ga0373931_1146967
626 Ga0436364_0586981
627 Ga0436364_1284239
628 Ga0436365_0046540
629 Ga0436362_0201669
630 Ga0451839_1148064
631 Ga0451851_0959297
632 Ga0451843_0204304
633 Ga0451853_0918398
634 Ga0439441_014947
635 Ga0439450_060214
636 Ga0450895_019714
637 Ga0450908_003803
638 Ga0439435_0028018
639 Ga0439464_0006881
640 Ga0450918_083064
641 Ga0451576_0068563
642 Ga0495629_0103045
643 Ga0495641_0040406
644 Ga0495639_0123244
645 Ga0495662_0276083
646 Ga0495664_0107400
647 Ga0495664_0605005
648 Ga0495628_0101598
649 Ga0495628_1006016
650 Ga0495665_0580182
651 Ga0495586_0005779
652 Ga0495645_0003203
653 Ga0495645_0431428
654 Ga0495667_0052805
655 Ga0495634_0152803
656 Ga0495599_0371336
657 Ga0495599_0666121
658 Ga0495623_0182908
659 Ga0495658_0012456
660 Ga0495613_0097814
661 Ga0495624_0487317
662 Ga0495604_0182861
663 Ga0495674_0006811
664 Ga0495674_0913512
665 Ga0495676_0380617
666 Ga0495675_0064254
667 Ga0495675_0151669
668 Ga0495684_0051989
669 Ga0496102_0316870
670 Ga0496103_0274668
671 Ga0496104_0273742
672 Ga0496104_0637422
673 Ga0496105_1170964
674 Ga0496106_0719193
675 Ga0496108_0622209
676 Ga0496108_0855454
677 Ga0496109_0183891
678 Ga0496110_0141614
679 Ga0496110_0226518
680 Ga0496111_0438821
681 Ga0496112_0076558
682 Ga0501298_006837
683 Ga0501299_004529
684 Ga0501040_0180037
685 Ga0501042_0380085
686 Ga0501042_0515091
687 Ga0501048_0327562
688 Ga0501068_0393441
689 Ga0501071_0052841
690 Ga0501075_0011737
691 Ga0501075_0174644
692 Ga0501076_0143944
693 Ga0501076_1077407
694 Ga0501216_153633
695 Ga0501233_060957
696 Ga0501257_257705
697 Ga0501221_027214
698 Ga0501079_0415708
699 Ga0501081_1135614
700 Ga0501268_030932
701 Ga0501271_042991
702 nmdc:mga0yw44_1045690_c1
703 nmdc:mga0k408_165790_c1
704 nmdc:mga0k408_166175_c1
705 nmdc:mga0k408_18357_c1
706 nmdc:mga0k408_478775_c1
707 nmdc:mga06z11_411122_c1
708 nmdc:mga05p37_426_c1
709 nmdc:mga05p37_5661_c1
710 nmdc:mga05p37_6042_c1
711 nmdc:mga09592_1148791_c1
712 nmdc:mga09592_138118_c1
713 nmdc:mga09592_23119_c1
714 nmdc:mga0qj67_124257_c1
715 nmdc:mga0qj67_3700_c1
716 nmdc:mga0qj67_9883_c1
717 nmdc:mga06r32_33342_c1
718 nmdc:mga06r32_6023_c1
719 nmdc:mga06r32_68964_c1
720 nmdc:mga08y16_1256889_c1
721 nmdc:mga08y16_12962_c1
722 nmdc:mga08y16_1391399_c1
723 nmdc:mga08y16_161951_c1
724 nmdc:mga08y16_32351_c1
725 nmdc:mga08y16_65382_c1
726 nmdc:mga0n895_173595_c1
727 nmdc:mga0rr50_33300_c1
728 nmdc:mga08x19_691357_c1
729 nmdc:mga0a205_144716_c1
730 Ga0501084_0124681
731 Ga0590075_164218
732 Ga0501082_0587573
733 Ga0530510_0468422
734 Ga0530510_0755125

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13769

Virulence_fact

Virulence factor

7

84

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5av7-assembly1.cif.gz_A crystal structure of calsepa lectin in complex with bisected glycan 0.8061 1 28
6aom-assembly2.cif.gz_B structure of molecular chaperone grp94 bound to selective inhibitor methyl 2-[2-(2-benzylphenyl)ethyl]-3-chloro-4,6-dihydroxybenzoate 0.6722 2 32
6cyi-assembly1.cif.gz_A grp94 n-domain bound to neoca 0.6716 2 32
6asq-assembly2.cif.gz_B structure of grp94 bound to methyl 2-[2-(2-benzylpyridin-3-yl)ethyl]-3-chloro-4,6-dihydroxybenzoate, a pan-hsp90 inhibitor 0.6675 2 32
5uls-assembly1.cif.gz_B structure of grp94 in the active conformation 0.6606 2 32
ID Description Score Start End Superfamily
af_X1WD78_707_803_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8666 15 28 2.60.40.10
af_A0A2R8Q5F2_376_474_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8178 15 28 2.60.40.10
af_Q2FYK3_109_189_1.20.5.2050 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.812 9 79 1.20.5.2050
5av7A00 Mainly Beta;Aligned Prism;Vitelline Membrane Outer Layer Protein I, subunit A;Jacalin-like lectin domain 0.8061 1 28 2.100.10.30
af_Q8WZ42_14329_14419_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7988 15 30 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A2V7BGL4-F1-model_v4 Virulence factor domain-containing protein 1 6 81
AF-A0A536F1V6-F1-model_v4 Virulence factor domain-containing protein 0.9971 1 82
AF-A0A3D5H8E6-F1-model_v4 Virulence factor domain-containing protein 0.9939 1 82
AF-A0A7C2J507-F1-model_v4 Virulence factor domain-containing protein 0.9936 1 79
AF-A0A536DV73-F1-model_v4 Virulence factor domain-containing protein 0.992 1 82

Map