F424249

General Info

Members Datasets Scaffolds Average Seq Length
367 211 734 131

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100675804|Ga0068868_1006758042
Length 141
Sequence MATKTLHVDIVSAEQQIYSGEAQRIIAPGEAGELGILPEHIPLLTRVKPGVLRILPAEGGEEEIIYVSGGMMEVQPDRVTVLADTSVRAHDLDEAKAMEAERLAKEAIANRTGSMEIAQAQAELAESVAQLAAIRKLRKTR

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
148 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
161 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
162 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
163 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
172 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
200 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
207 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
208 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.18
Nodule 0
Rhizoplane 0.27
Rhizosphere 93.19
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100675804 3300005338 Bacteria 922
2 Ga0065712_10299087 3300005290 Bacteria 860
3 Ga0070658_10109942 3300005327 Bacteria 2282
4 Ga0070658_10172061 3300005327 Bacteria 1820
5 Ga0070658_10204254 3300005327 Bacteria 1668
6 Ga0070658_10667528 3300005327 Bacteria 902
7 Ga0070658_10882173 3300005327 Bacteria 777
8 Ga0070676_10069796 3300005328 Bacteria 2107
9 Ga0070683_100294158 3300005329 Bacteria 1545
10 Ga0070683_100777248 3300005329 Bacteria 918
11 Ga0070683_101584948 3300005329 Bacteria 630
12 Ga0070690_100098906 3300005330 Bacteria 1931
13 Ga0070690_100237163 3300005330 Bacteria 1285
14 Ga0070670_101091399 3300005331 Bacteria 728
15 Ga0068869_100073461 3300005334 Bacteria 2536
16 Ga0068869_100481447 3300005334 Bacteria 1033
17 Ga0070666_10377036 3300005335 Bacteria 1018
18 Ga0070680_101412530 3300005336 Bacteria 603
19 Ga0070680_101452931 3300005336 Bacteria 594
20 Ga0070682_100639098 3300005337 Bacteria 846
21 Ga0070660_100603590 3300005339 Bacteria 918
22 Ga0070689_100053718 3300005340 Bacteria 3118
23 Ga0070689_100159450 3300005340 Bacteria 1823
24 Ga0070689_100334420 3300005340 Bacteria 1267
25 Ga0070689_100534215 3300005340 Bacteria 1008
26 Ga0070687_100030422 3300005343 Bacteria 2640
27 Ga0070661_101270765 3300005344 Bacteria 617
28 Ga0070675_100134606 3300005354 Bacteria 2108
29 Ga0070674_100015118 3300005356 Bacteria 4811
30 Ga0070674_100178568 3300005356 Bacteria 1624
31 Ga0070674_100943899 3300005356 Bacteria 754
32 Ga0070673_100043619 3300005364 Bacteria 3467
33 Ga0070688_100474290 3300005365 Bacteria 940
34 Ga0070659_100147936 3300005366 Bacteria 1914
35 Ga0070659_100514285 3300005366 Bacteria 1022
36 Ga0070667_100865283 3300005367 Bacteria 841
37 Ga0070709_10811687 3300005434 Bacteria 735
38 Ga0070714_101000058 3300005435 Bacteria 814
39 Ga0070714_101067248 3300005435 Bacteria 787
40 Ga0070713_100024329 3300005436 Bacteria 4715
41 Ga0070710_10178825 3300005437 Bacteria 1327
42 Ga0070710_10327346 3300005437 Bacteria 1008
43 Ga0070701_10430456 3300005438 Bacteria 842
44 Ga0070705_100108126 3300005440 Bacteria 1771
45 Ga0070708_100000702 3300005445 Bacteria 25520
46 Ga0070678_100677981 3300005456 Bacteria 927
47 Ga0070681_10066736 3300005458 Bacteria 3567
48 Ga0070681_10150982 3300005458 Bacteria 2249
49 Ga0068867_100059113 3300005459 Bacteria 2842
50 Ga0068867_101257924 3300005459 Bacteria 682
51 Ga0068867_101326049 3300005459 Bacteria 665
52 Ga0070685_10163751 3300005466 Bacteria 1420
53 Ga0070685_10467539 3300005466 Bacteria 887
54 Ga0070685_10721290 3300005466 Bacteria 729
55 Ga0070707_101018007 3300005468 Bacteria 794
56 Ga0070698_101104588 3300005471 Bacteria 741
57 Ga0070699_100113353 3300005518 Bacteria 2382
58 Ga0070679_100045414 3300005530 Bacteria 4378
59 Ga0070679_100172032 3300005530 Bacteria 2138
60 Ga0070679_100639333 3300005530 Bacteria 1007
61 Ga0070679_100996990 3300005530 Bacteria 782
62 Ga0070679_101973497 3300005530 Bacteria 533
63 Ga0070684_100118739 3300005535 Bacteria 2377
64 Ga0070684_100523570 3300005535 Bacteria 1099
65 Ga0070684_100681554 3300005535 Bacteria 958
66 Ga0070686_100119885 3300005544 Bacteria 1805
67 Ga0070686_100747513 3300005544 Bacteria 784
68 Ga0070696_100184182 3300005546 Bacteria 1550
69 Ga0070693_100003814 3300005547 Bacteria 7060
70 Ga0070693_100004839 3300005547 Bacteria 6422
71 Ga0070693_100256834 3300005547 Bacteria 1160
72 Ga0070693_100653590 3300005547 Bacteria 765
73 Ga0070665_100033933 3300005548 Bacteria 5133
74 Ga0070704_101189760 3300005549 Bacteria 695
75 Ga0068855_100001722 3300005563 Bacteria 27344
76 Ga0068855_100019301 3300005563 Bacteria 8192
77 Ga0068855_100023686 3300005563 Bacteria 7352
78 Ga0070664_100767353 3300005564 Bacteria 901
79 Ga0068854_100775788 3300005578 Bacteria 833
80 Ga0068856_100078889 3300005614 Bacteria 3264
81 Ga0068856_100374282 3300005614 Bacteria 1443
82 Ga0068856_101903645 3300005614 Bacteria 606
83 Ga0070702_100458040 3300005615 Bacteria 927
84 Ga0068852_100012660 3300005616 Bacteria 6415
85 Ga0068852_100019902 3300005616 Bacteria 5325
86 Ga0068852_100029932 3300005616 Bacteria 4476
87 Ga0068859_100290685 3300005617 Bacteria 1727
88 Ga0068859_101133022 3300005617 Bacteria 861
89 Ga0068866_10281909 3300005718 Bacteria 1030
90 Ga0068866_10599372 3300005718 Bacteria 743
91 Ga0068861_100080454 3300005719 Bacteria 2549
92 Ga0068851_10413687 3300005834 Bacteria 795
93 Ga0068863_100235732 3300005841 Bacteria 1766
94 Ga0068858_100080789 3300005842 Bacteria 3021
95 Ga0068858_100907672 3300005842 Bacteria 861
96 Ga0068860_100118988 3300005843 Bacteria 2529
97 Ga0068862_101441288 3300005844 Bacteria 693
98 Ga0068862_101746537 3300005844 Bacteria 631
99 Ga0070717_10924655 3300006028 Bacteria 794
100 Ga0075363_100427073 3300006048 Bacteria 781
101 Ga0075364_10371427 3300006051 Bacteria 975
102 Ga0075364_10378316 3300006051 Bacteria 966
103 Ga0075364_10683126 3300006051 Bacteria 701
104 Ga0075432_10177451 3300006058 Bacteria 832
105 Ga0070712_101783851 3300006175 Bacteria 539
106 Ga0075367_10122229 3300006178 Bacteria 1605
107 Ga0075369_10003572 3300006186 Bacteria 5665
108 Ga0075366_10044641 3300006195 Bacteria 2627
109 Ga0075366_10072921 3300006195 Bacteria 2046
110 Ga0075366_10400625 3300006195 Bacteria 844
111 Ga0097621_100009656 3300006237 Bacteria 7016
112 Ga0097621_100256827 3300006237 Bacteria 1532
113 Ga0097621_100339034 3300006237 Bacteria 1335
114 Ga0097621_100464939 3300006237 Bacteria 1141
115 Ga0097621_100735259 3300006237 Bacteria 910
116 Ga0075370_10046715 3300006353 Bacteria 2451
117 Ga0068871_100008012 3300006358 Bacteria 7585
118 Ga0068871_100100118 3300006358 Bacteria 2427
119 Ga0068871_100178794 3300006358 Bacteria 1822
120 Ga0068871_100799834 3300006358 Bacteria 869
121 Ga0075428_100005876 3300006844 Bacteria 13635
122 Ga0075429_100247253 3300006880 Bacteria 1562
123 Ga0075436_100780463 3300006914 Bacteria 711
124 Ga0097620_100290695 3300006931 Bacteria 1727
125 Ga0097620_101132757 3300006931 Bacteria 861
126 Ga0105240_10004111 3300009093 Bacteria 22333
127 Ga0105240_10075027 3300009093 Bacteria 4173
128 Ga0105240_10611117 3300009093 Bacteria 1199
129 Ga0105240_10714490 3300009093 Bacteria 1093
130 Ga0105240_11334173 3300009093 Bacteria 756
131 Ga0105240_12056102 3300009093 Bacteria 593
132 Ga0111539_10018454 3300009094 Bacteria 8643
133 Ga0105245_10534239 3300009098 Bacteria 1193
134 Ga0105243_10303876 3300009148 Bacteria 1447
135 Ga0105243_10493982 3300009148 Bacteria 1158
136 Ga0105243_11040806 3300009148 Bacteria 823
137 Ga0105241_10059109 3300009174 Bacteria 2946
138 Ga0105242_10010094 3300009176 Bacteria 7231
139 Ga0105242_10015614 3300009176 Bacteria 5899
140 Ga0105242_10040809 3300009176 Bacteria 3740
141 Ga0105242_10097866 3300009176 Bacteria 2481
142 Ga0105242_11645882 3300009176 Bacteria 677
143 Ga0105248_10253690 3300009177 Bacteria 1980
144 Ga0105248_10261637 3300009177 Bacteria 1947
145 Ga0105248_10690633 3300009177 Bacteria 1151
146 Ga0105248_11150655 3300009177 Bacteria 877
147 Ga0105248_12208835 3300009177 Bacteria 626
148 Ga0105238_10037659 3300009551 Bacteria 4916
149 Ga0105238_10094524 3300009551 Bacteria 2977
150 Ga0105238_10521340 3300009551 Bacteria 1191
151 Ga0105238_10562616 3300009551 Bacteria 1145
152 Ga0105238_10956171 3300009551 Bacteria 876
153 Ga0105238_11253369 3300009551 Bacteria 767
154 Ga0105249_10388293 3300009553 Bacteria 1423
155 Ga0105239_10190540 3300010375 Bacteria 2295
156 Ga0105239_10715184 3300010375 Bacteria 1145
157 Ga0105239_12578117 3300010375 Bacteria 593
158 Ga0105246_10796320 3300011119 Bacteria 838
159 Ga0157371_10326637 3300013102 Bacteria 1114
160 Ga0157370_10005575 3300013104 Bacteria 14107
161 Ga0157370_10188912 3300013104 Bacteria 1912
162 Ga0157370_10248223 3300013104 Bacteria 1646
163 Ga0157370_10716131 3300013104 Bacteria 913
164 Ga0157370_11533652 3300013104 Bacteria 599
165 Ga0157369_10025192 3300013105 Bacteria 6605
166 Ga0157369_10364611 3300013105 Bacteria 1500
167 Ga0157369_10693816 3300013105 Bacteria 1049
168 Ga0157374_10592893 3300013296 Bacteria 1118
169 Ga0157378_10025016 3300013297 Bacteria 5258
170 Ga0157378_10037847 3300013297 Bacteria 4275
171 Ga0163162_10191989 3300013306 Bacteria 2170
172 Ga0163162_10360787 3300013306 Bacteria 1586
173 Ga0163162_10591715 3300013306 Bacteria 1236
174 Ga0157372_10000824 3300013307 Bacteria 33574
175 Ga0157372_10109349 3300013307 Bacteria 3165
176 Ga0157372_10195344 3300013307 Bacteria 2344
177 Ga0157372_11279293 3300013307 Bacteria 847
178 Ga0157372_12046762 3300013307 Bacteria 658
179 Ga0157375_10156935 3300013308 Bacteria 2415
180 Ga0163163_13112829 3300014325 Bacteria 517
181 Ga0157380_10163226 3300014326 Bacteria 1939
182 Ga0157380_10813685 3300014326 Bacteria 952
183 Ga0157380_11194957 3300014326 Bacteria 804
184 Ga0157380_11567710 3300014326 Bacteria 713
185 Ga0157380_12582440 3300014326 Bacteria 574
186 Ga0157380_13039507 3300014326 Bacteria 535
187 Ga0157379_10166081 3300014968 Bacteria 1992
188 Ga0157379_12463262 3300014968 Bacteria 520
189 Ga0157376_10143970 3300014969 Bacteria 2142
190 Ga0157376_10547245 3300014969 Bacteria 1145
191 Ga0157376_11156725 3300014969 Bacteria 801
192 Ga0163161_10209031 3300017792 Bacteria 1507
193 Ga0163161_10606150 3300017792 Bacteria 903
194 Ga0213876_10141767 3300021384 Bacteria 1278
195 Ga0207656_10293603 3300025321 Bacteria 804
196 Ga0207682_10110036 3300025893 Bacteria 1212
197 Ga0207692_10147551 3300025898 Bacteria 1344
198 Ga0207642_10229177 3300025899 Bacteria 1043
199 Ga0207685_10057298 3300025905 Bacteria 1528
200 Ga0207699_10198523 3300025906 Bacteria 1358
201 Ga0207645_10542409 3300025907 Bacteria 789
202 Ga0207705_10036352 3300025909 Bacteria 3525
203 Ga0207705_10307389 3300025909 Bacteria 1217
204 Ga0207705_10467731 3300025909 Bacteria 978
205 Ga0207705_10724517 3300025909 Bacteria 773
206 Ga0207654_10230556 3300025911 Bacteria 1233
207 Ga0207695_10020088 3300025913 Bacteria 7663
208 Ga0207695_10305620 3300025913 Bacteria 1481
209 Ga0207695_10508186 3300025913 Bacteria 1087
210 Ga0207695_10558225 3300025913 Bacteria 1027
211 Ga0207695_11550294 3300025913 Bacteria 543
212 Ga0207693_10295794 3300025915 Bacteria 1268
213 Ga0207660_10749830 3300025917 Bacteria 797
214 Ga0207660_11628257 3300025917 Bacteria 520
215 Ga0207662_10092391 3300025918 Bacteria 1863
216 Ga0207662_10177217 3300025918 Bacteria 1370
217 Ga0207657_10329932 3300025919 Bacteria 1205
218 Ga0207649_11092201 3300025920 Bacteria 629
219 Ga0207652_10033396 3300025921 Bacteria 4333
220 Ga0207646_10281562 3300025922 Bacteria 1503
221 Ga0207694_10021420 3300025924 Bacteria 4898
222 Ga0207694_10041235 3300025924 Bacteria 3556
223 Ga0207694_10270676 3300025924 Bacteria 1393
224 Ga0207687_10041223 3300025927 Bacteria 3169
225 Ga0207687_10057364 3300025927 Bacteria 2736
226 Ga0207687_10300679 3300025927 Bacteria 1292
227 Ga0207700_10064172 3300025928 Bacteria 2796
228 Ga0207664_10221894 3300025929 Bacteria 1640
229 Ga0207664_10472010 3300025929 Bacteria 1122
230 Ga0207644_10426802 3300025931 Bacteria 1087
231 Ga0207690_10056496 3300025932 Bacteria 2648
232 Ga0207686_10023488 3300025934 Bacteria 3563
233 Ga0207686_10049594 3300025934 Bacteria 2606
234 Ga0207686_10166056 3300025934 Bacteria 1552
235 Ga0207709_10251609 3300025935 Bacteria 1291
236 Ga0207709_10617533 3300025935 Bacteria 860
237 Ga0207709_11026129 3300025935 Bacteria 675
238 Ga0207670_10096022 3300025936 Bacteria 2107
239 Ga0207670_10286190 3300025936 Bacteria 1286
240 Ga0207669_10198250 3300025937 Bacteria 1455
241 Ga0207669_10201417 3300025937 Bacteria 1445
242 Ga0207669_11192828 3300025937 Bacteria 645
243 Ga0207704_10260148 3300025938 Bacteria 1308
244 Ga0207711_10058217 3300025941 Bacteria 3324
245 Ga0207711_10100457 3300025941 Bacteria 2559
246 Ga0207711_11272095 3300025941 Bacteria 678
247 Ga0207689_10338461 3300025942 Bacteria 1250
248 Ga0207661_10262403 3300025944 Bacteria 1539
249 Ga0207661_10618913 3300025944 Bacteria 994
250 Ga0207661_11446925 3300025944 Bacteria 630
251 Ga0207667_10001224 3300025949 Bacteria 32187
252 Ga0207667_10093960 3300025949 Bacteria 3097
253 Ga0207667_10159876 3300025949 Bacteria 2317
254 Ga0207667_10395233 3300025949 Bacteria 1408
255 Ga0207667_11666697 3300025949 Bacteria 605
256 Ga0207640_11153712 3300025981 Bacteria 687
257 Ga0207640_11537964 3300025981 Bacteria 598
258 Ga0207658_11744254 3300025986 Bacteria 568
259 Ga0207677_11135016 3300026023 Bacteria 714
260 Ga0207703_10185224 3300026035 Bacteria 1840
261 Ga0207703_10309502 3300026035 Bacteria 1443
262 Ga0207703_11683993 3300026035 Bacteria 610
263 Ga0207639_10071827 3300026041 Bacteria 2709
264 Ga0207708_10228298 3300026075 Bacteria 1494
265 Ga0207702_10073750 3300026078 Bacteria 2943
266 Ga0207702_10129823 3300026078 Bacteria 2266
267 Ga0207702_11362363 3300026078 Bacteria 703
268 Ga0207641_10324826 3300026088 Bacteria 1460
269 Ga0207648_10116024 3300026089 Bacteria 2353
270 Ga0207648_10531910 3300026089 Bacteria 1078
271 Ga0207648_10742103 3300026089 Bacteria 912
272 Ga0207676_10430326 3300026095 Bacteria 1240
273 Ga0207674_10203618 3300026116 Bacteria 1929
274 Ga0207675_100338894 3300026118 Bacteria 1471
275 Ga0207675_100677981 3300026118 Bacteria 1038
276 Ga0207683_10137744 3300026121 Bacteria 2198
277 Ga0207683_10711070 3300026121 Bacteria 932
278 Ga0207698_10057656 3300026142 Bacteria 3006
279 Ga0207698_10116403 3300026142 Bacteria 2253
280 Ga0207698_10340058 3300026142 Bacteria 1413
281 Ga0207698_10877707 3300026142 Bacteria 903
282 Ga0209971_1100621 3300027682 Bacteria 708
283 Ga0207428_10001106 3300027907 Bacteria 29339
284 Ga0268266_11273473 3300028379 Bacteria 710
285 Ga0268264_10298138 3300028381 Bacteria 1516
286 Ga0265323_10040004 3300028653 Bacteria 1707
287 Ga0265339_10401256 3300031249 Bacteria 641
288 Ga0265316_10005578 3300031344 Bacteria 12197
289 Ga0307509_10285935 3300031507 Bacteria 1407
290 Ga0307408_100235450 3300031548 Bacteria 1502
291 Ga0307408_101092893 3300031548 Bacteria 739
292 Ga0307408_101434411 3300031548 Bacteria 651
293 Ga0265314_10108640 3300031711 Bacteria 1767
294 Ga0265314_10219721 3300031711 Bacteria 1110
295 Ga0307405_10594267 3300031731 Bacteria 902
296 Ga0307413_11673088 3300031824 Bacteria 567
297 Ga0307410_10525440 3300031852 Bacteria 977
298 Ga0307410_10612712 3300031852 Bacteria 909
299 Ga0307406_10522487 3300031901 Bacteria 966
300 Ga0307412_10871394 3300031911 Bacteria 787
301 Ga0307416_100145516 3300032002 Bacteria 2163
302 Ga0307416_100303135 3300032002 Bacteria 1589
303 Ga0307416_100648409 3300032002 Bacteria 1140
304 Ga0307416_100939586 3300032002 Bacteria 966
305 Ga0307411_10955136 3300032005 Bacteria 765
306 Ga0373929_0003674 3300035085 Bacteria 2755
307 Ga0373934_0143129 3300035086 Bacteria 978
308 Ga0373940_0233699 3300035088 Bacteria 615
309 Ga0373957_0165791 3300035120 Bacteria 911
310 Ga0373924_0036125 3300035410 Bacteria 2006
311 Ga0373931_0155441 3300035691 Bacteria 1336
312 Ga0373931_0404927 3300035691 Bacteria 864
313 Ga0373937_0147567 3300036401 Bacteria 2202
314 Ga0373937_0450897 3300036401 Bacteria 1222
315 Ga0373925_1115281 3300037068 Bacteria 649
316 Ga0395900_0033745 3300037418 Bacteria 5267
317 Ga0395905_0242681 3300037471 Bacteria 1683
318 Ga0436365_1884239 3300039437 Bacteria 1278
319 Ga0436365_1908797 3300039437 Bacteria 2650
320 Ga0451853_3594831 3300041512 Bacteria 571
321 Ga0439441_001013 3300042001 Bacteria 3464
322 Ga0451577_0798894 3300042876 Bacteria 852
323 Ga0466963_0490499 3300044694 Bacteria 867
324 Ga0466963_0739052 3300044694 Bacteria 694
325 Ga0451576_0198517 3300045051 Bacteria 2095
326 Ga0466958_0018845 3300045836 Bacteria 4010
327 Ga0495592_0164584 3300046454 Bacteria 1523
328 Ga0495629_0430409 3300046459 Bacteria 895
329 Ga0495653_0305654 3300046463 Bacteria 1036
330 Ga0495608_0405396 3300046511 Bacteria 833
331 Ga0495598_0136383 3300046537 Bacteria 846
332 Ga0495621_0015530 3300046539 Bacteria 2430
333 Ga0495621_0390745 3300046539 Bacteria 589
334 Ga0495623_0019128 3300046679 Bacteria 4425
335 Ga0495658_0148249 3300046683 Bacteria 1439
336 Ga0495602_0127868 3300048088 Bacteria 2032
337 Ga0496104_0742087 3300048907 Bacteria 889
338 Ga0501034_0962865 3300049571 Bacteria 739
339 Ga0501047_0009138 3300049581 Bacteria 9356
340 Ga0501047_0137906 3300049581 Bacteria 2319
341 Ga0501070_0001954 3300049586 Bacteria 18182
342 Ga0501073_0000982 3300049589 Bacteria 20565
343 Ga0501074_0006721 3300049590 Bacteria 8296
344 Ga0501079_0000287 3300049741 Bacteria 31113
345 Ga0501080_0013892 3300049742 Bacteria 7412
346 Ga0501083_0002527 3300049744 Bacteria 12552
347 Ga0501035_0073713 3300049822 Bacteria 3021
348 Ga0501044_0254693 3300049823 Bacteria 1695
349 nmdc:mga00v17_29228_c1 3300050491 Bacteria 3234
350 nmdc:mga00v17_890597_c1 3300050491 Bacteria 564
351 nmdc:mga0k408_234854_c1 3300050493 Bacteria 1095
352 nmdc:mga0k408_31295_c1 3300050493 Bacteria 3038
353 nmdc:mga0k408_622707_c1 3300050493 Bacteria 636
354 nmdc:mga06z11_715102_c1 3300050494 Bacteria 610
355 nmdc:mga07m45_45931_c1 3300050496 Bacteria 2452
356 nmdc:mga09592_180268_c1 3300050508 Bacteria 1827
357 nmdc:mga08y16_903_c1 3300050511 Bacteria 28673
358 nmdc:mga0n895_744850_c1 3300050512 Bacteria 973
359 nmdc:mga0rr50_1656589_c1 3300050513 Unclassified 539
360 nmdc:mga08x19_820007_c1 3300050514 Bacteria 661
361 nmdc:mga0sz30_23833_c1 3300050516 Bacteria 2494
362 Ga0495601_0194290 3300053077 Bacteria 1326
363 Ga0500641_0015640 3300053096 Bacteria 2820
364 Ga0501084_0337818 3300054114 Bacteria 1272
365 Ga0501082_0098910 3300060353 Bacteria 2522
366 Ga0501082_1111104 3300060353 Bacteria 691
367 Ga0466962_0096715 3300061719 Bacteria 1416
368 Ga0068868_100675804
369 Ga0065712_10299087
370 Ga0070658_10109942
371 Ga0070658_10172061
372 Ga0070658_10204254
373 Ga0070658_10667528
374 Ga0070658_10882173
375 Ga0070676_10069796
376 Ga0070683_100294158
377 Ga0070683_100777248
378 Ga0070683_101584948
379 Ga0070690_100098906
380 Ga0070690_100237163
381 Ga0070670_101091399
382 Ga0068869_100073461
383 Ga0068869_100481447
384 Ga0070666_10377036
385 Ga0070680_101412530
386 Ga0070680_101452931
387 Ga0070682_100639098
388 Ga0070660_100603590
389 Ga0070689_100053718
390 Ga0070689_100159450
391 Ga0070689_100334420
392 Ga0070689_100534215
393 Ga0070687_100030422
394 Ga0070661_101270765
395 Ga0070675_100134606
396 Ga0070674_100015118
397 Ga0070674_100178568
398 Ga0070674_100943899
399 Ga0070673_100043619
400 Ga0070688_100474290
401 Ga0070659_100147936
402 Ga0070659_100514285
403 Ga0070667_100865283
404 Ga0070709_10811687
405 Ga0070714_101000058
406 Ga0070714_101067248
407 Ga0070713_100024329
408 Ga0070710_10178825
409 Ga0070710_10327346
410 Ga0070701_10430456
411 Ga0070705_100108126
412 Ga0070708_100000702
413 Ga0070678_100677981
414 Ga0070681_10066736
415 Ga0070681_10150982
416 Ga0068867_100059113
417 Ga0068867_101257924
418 Ga0068867_101326049
419 Ga0070685_10163751
420 Ga0070685_10467539
421 Ga0070685_10721290
422 Ga0070707_101018007
423 Ga0070698_101104588
424 Ga0070699_100113353
425 Ga0070679_100045414
426 Ga0070679_100172032
427 Ga0070679_100639333
428 Ga0070679_100996990
429 Ga0070679_101973497
430 Ga0070684_100118739
431 Ga0070684_100523570
432 Ga0070684_100681554
433 Ga0070686_100119885
434 Ga0070686_100747513
435 Ga0070696_100184182
436 Ga0070693_100003814
437 Ga0070693_100004839
438 Ga0070693_100256834
439 Ga0070693_100653590
440 Ga0070665_100033933
441 Ga0070704_101189760
442 Ga0068855_100001722
443 Ga0068855_100019301
444 Ga0068855_100023686
445 Ga0070664_100767353
446 Ga0068854_100775788
447 Ga0068856_100078889
448 Ga0068856_100374282
449 Ga0068856_101903645
450 Ga0070702_100458040
451 Ga0068852_100012660
452 Ga0068852_100019902
453 Ga0068852_100029932
454 Ga0068859_100290685
455 Ga0068859_101133022
456 Ga0068866_10281909
457 Ga0068866_10599372
458 Ga0068861_100080454
459 Ga0068851_10413687
460 Ga0068863_100235732
461 Ga0068858_100080789
462 Ga0068858_100907672
463 Ga0068860_100118988
464 Ga0068862_101441288
465 Ga0068862_101746537
466 Ga0070717_10924655
467 Ga0075363_100427073
468 Ga0075364_10371427
469 Ga0075364_10378316
470 Ga0075364_10683126
471 Ga0075432_10177451
472 Ga0070712_101783851
473 Ga0075367_10122229
474 Ga0075369_10003572
475 Ga0075366_10044641
476 Ga0075366_10072921
477 Ga0075366_10400625
478 Ga0097621_100009656
479 Ga0097621_100256827
480 Ga0097621_100339034
481 Ga0097621_100464939
482 Ga0097621_100735259
483 Ga0075370_10046715
484 Ga0068871_100008012
485 Ga0068871_100100118
486 Ga0068871_100178794
487 Ga0068871_100799834
488 Ga0075428_100005876
489 Ga0075429_100247253
490 Ga0075436_100780463
491 Ga0097620_100290695
492 Ga0097620_101132757
493 Ga0105240_10004111
494 Ga0105240_10075027
495 Ga0105240_10611117
496 Ga0105240_10714490
497 Ga0105240_11334173
498 Ga0105240_12056102
499 Ga0111539_10018454
500 Ga0105245_10534239
501 Ga0105243_10303876
502 Ga0105243_10493982
503 Ga0105243_11040806
504 Ga0105241_10059109
505 Ga0105242_10010094
506 Ga0105242_10015614
507 Ga0105242_10040809
508 Ga0105242_10097866
509 Ga0105242_11645882
510 Ga0105248_10253690
511 Ga0105248_10261637
512 Ga0105248_10690633
513 Ga0105248_11150655
514 Ga0105248_12208835
515 Ga0105238_10037659
516 Ga0105238_10094524
517 Ga0105238_10521340
518 Ga0105238_10562616
519 Ga0105238_10956171
520 Ga0105238_11253369
521 Ga0105249_10388293
522 Ga0105239_10190540
523 Ga0105239_10715184
524 Ga0105239_12578117
525 Ga0105246_10796320
526 Ga0157371_10326637
527 Ga0157370_10005575
528 Ga0157370_10188912
529 Ga0157370_10248223
530 Ga0157370_10716131
531 Ga0157370_11533652
532 Ga0157369_10025192
533 Ga0157369_10364611
534 Ga0157369_10693816
535 Ga0157374_10592893
536 Ga0157378_10025016
537 Ga0157378_10037847
538 Ga0163162_10191989
539 Ga0163162_10360787
540 Ga0163162_10591715
541 Ga0157372_10000824
542 Ga0157372_10109349
543 Ga0157372_10195344
544 Ga0157372_11279293
545 Ga0157372_12046762
546 Ga0157375_10156935
547 Ga0163163_13112829
548 Ga0157380_10163226
549 Ga0157380_10813685
550 Ga0157380_11194957
551 Ga0157380_11567710
552 Ga0157380_12582440
553 Ga0157380_13039507
554 Ga0157379_10166081
555 Ga0157379_12463262
556 Ga0157376_10143970
557 Ga0157376_10547245
558 Ga0157376_11156725
559 Ga0163161_10209031
560 Ga0163161_10606150
561 Ga0213876_10141767
562 Ga0207656_10293603
563 Ga0207682_10110036
564 Ga0207692_10147551
565 Ga0207642_10229177
566 Ga0207685_10057298
567 Ga0207699_10198523
568 Ga0207645_10542409
569 Ga0207705_10036352
570 Ga0207705_10307389
571 Ga0207705_10467731
572 Ga0207705_10724517
573 Ga0207654_10230556
574 Ga0207695_10020088
575 Ga0207695_10305620
576 Ga0207695_10508186
577 Ga0207695_10558225
578 Ga0207695_11550294
579 Ga0207693_10295794
580 Ga0207660_10749830
581 Ga0207660_11628257
582 Ga0207662_10092391
583 Ga0207662_10177217
584 Ga0207657_10329932
585 Ga0207649_11092201
586 Ga0207652_10033396
587 Ga0207646_10281562
588 Ga0207694_10021420
589 Ga0207694_10041235
590 Ga0207694_10270676
591 Ga0207687_10041223
592 Ga0207687_10057364
593 Ga0207687_10300679
594 Ga0207700_10064172
595 Ga0207664_10221894
596 Ga0207664_10472010
597 Ga0207644_10426802
598 Ga0207690_10056496
599 Ga0207686_10023488
600 Ga0207686_10049594
601 Ga0207686_10166056
602 Ga0207709_10251609
603 Ga0207709_10617533
604 Ga0207709_11026129
605 Ga0207670_10096022
606 Ga0207670_10286190
607 Ga0207669_10198250
608 Ga0207669_10201417
609 Ga0207669_11192828
610 Ga0207704_10260148
611 Ga0207711_10058217
612 Ga0207711_10100457
613 Ga0207711_11272095
614 Ga0207689_10338461
615 Ga0207661_10262403
616 Ga0207661_10618913
617 Ga0207661_11446925
618 Ga0207667_10001224
619 Ga0207667_10093960
620 Ga0207667_10159876
621 Ga0207667_10395233
622 Ga0207667_11666697
623 Ga0207640_11153712
624 Ga0207640_11537964
625 Ga0207658_11744254
626 Ga0207677_11135016
627 Ga0207703_10185224
628 Ga0207703_10309502
629 Ga0207703_11683993
630 Ga0207639_10071827
631 Ga0207708_10228298
632 Ga0207702_10073750
633 Ga0207702_10129823
634 Ga0207702_11362363
635 Ga0207641_10324826
636 Ga0207648_10116024
637 Ga0207648_10531910
638 Ga0207648_10742103
639 Ga0207676_10430326
640 Ga0207674_10203618
641 Ga0207675_100338894
642 Ga0207675_100677981
643 Ga0207683_10137744
644 Ga0207683_10711070
645 Ga0207698_10057656
646 Ga0207698_10116403
647 Ga0207698_10340058
648 Ga0207698_10877707
649 Ga0209971_1100621
650 Ga0207428_10001106
651 Ga0268266_11273473
652 Ga0268264_10298138
653 Ga0265323_10040004
654 Ga0265339_10401256
655 Ga0265316_10005578
656 Ga0307509_10285935
657 Ga0307408_100235450
658 Ga0307408_101092893
659 Ga0307408_101434411
660 Ga0265314_10108640
661 Ga0265314_10219721
662 Ga0307405_10594267
663 Ga0307413_11673088
664 Ga0307410_10525440
665 Ga0307410_10612712
666 Ga0307406_10522487
667 Ga0307412_10871394
668 Ga0307416_100145516
669 Ga0307416_100303135
670 Ga0307416_100648409
671 Ga0307416_100939586
672 Ga0307411_10955136
673 Ga0373929_0003674
674 Ga0373934_0143129
675 Ga0373940_0233699
676 Ga0373957_0165791
677 Ga0373924_0036125
678 Ga0373931_0155441
679 Ga0373931_0404927
680 Ga0373937_0147567
681 Ga0373937_0450897
682 Ga0373925_1115281
683 Ga0395900_0033745
684 Ga0395905_0242681
685 Ga0436365_1884239
686 Ga0436365_1908797
687 Ga0451853_3594831
688 Ga0439441_001013
689 Ga0451577_0798894
690 Ga0466963_0490499
691 Ga0466963_0739052
692 Ga0451576_0198517
693 Ga0466958_0018845
694 Ga0495592_0164584
695 Ga0495629_0430409
696 Ga0495653_0305654
697 Ga0495608_0405396
698 Ga0495598_0136383
699 Ga0495621_0015530
700 Ga0495621_0390745
701 Ga0495623_0019128
702 Ga0495658_0148249
703 Ga0495602_0127868
704 Ga0496104_0742087
705 Ga0501034_0962865
706 Ga0501047_0009138
707 Ga0501047_0137906
708 Ga0501070_0001954
709 Ga0501073_0000982
710 Ga0501074_0006721
711 Ga0501079_0000287
712 Ga0501080_0013892
713 Ga0501083_0002527
714 Ga0501035_0073713
715 Ga0501044_0254693
716 nmdc:mga00v17_29228_c1
717 nmdc:mga00v17_890597_c1
718 nmdc:mga0k408_234854_c1
719 nmdc:mga0k408_31295_c1
720 nmdc:mga0k408_622707_c1
721 nmdc:mga06z11_715102_c1
722 nmdc:mga07m45_45931_c1
723 nmdc:mga09592_180268_c1
724 nmdc:mga08y16_903_c1
725 nmdc:mga0n895_744850_c1
726 nmdc:mga0rr50_1656589_c1
727 nmdc:mga08x19_820007_c1
728 nmdc:mga0sz30_23833_c1
729 Ga0495601_0194290
730 Ga0500641_0015640
731 Ga0501084_0337818
732 Ga0501082_0098910
733 Ga0501082_1111104
734 Ga0466962_0096715

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00401

ATP-synt_DE

ATP synthase, Delta/Epsilon chain, long alpha-helix domain

90

135

0.97

PF02823

ATP-synt_DE_N

ATP synthase, Delta/Epsilon chain, beta-sandwich domain

6

86

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dn6-assembly1.cif.gz_I atp synthase from paracoccus denitrificans 0.9403 10 80
7nk9-assembly1.cif.gz_H mycobacterium smegmatis atp synthase fo domain state 1 0.9237 21 78
3fks-assembly1.cif.gz_H yeast f1 atpase in the absence of bound nucleotides 0.9192 7 84
3ofn-assembly1.cif.gz_H structure of four mutant forms of yeast f1 atpase: alpha-n67i 0.9086 5 85
1h8e-assembly1.cif.gz_H (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied) 0.9076 5 85
ID Description Score Start End Superfamily
2e5yB01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9809 3 88 2.60.15.10
af_Q2FWF1_1_89_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9703 3 87 2.60.15.10
af_A0A0R0KXY9_13_77_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9548 26 88 2.60.15.10
af_P00835_1_88_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9541 4 88 2.60.15.10
1aqtA01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9505 3 88 2.60.15.10
ID Description Score Start End GO Terms
AF-A0A353DPA1-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9932 3 80 GO:0005524
GO:0005886
GO:0012505
GO:0045261
GO:0046933
AF-A0A419EG36-F1-model_v4 ATP synthase F1 subunit epsilon (EC 3.6.3.14) 0.9927 4 88 GO:0012505
GO:0016787
GO:0045261
GO:0046933
AF-A0A7X7DMU9-F1-model_v4 ATP synthase F1 subunit epsilon 0.9915 1 85 GO:0012505
GO:0045261
GO:0046933
AF-A0A7X3YWB8-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9894 5 85 GO:0005524
GO:0005886
GO:0012505
GO:0045261
GO:0046933
AF-T1BVN2-F1-model_v4 ATPase, F1 complex, delta/epsilon subunit (EC 3.6.3.14) 0.9889 4 78 GO:0016787
GO:0045261
GO:0046933

Map