metagRoot

F424121

General Info

Members	Datasets	Scaffolds	Average Seq Length
366	241	366	186

Family's Representative Sequence

Representative Sequence	3300046528\|Ga0495642_0226036\|Ga0495642_0226036_46_714
Length	222
Sequence	VHVPDPVSRRKFERYWRVVRPFSGLIRMSVLRAAKRRAESLQSDPYVLPEGLPVPVDDGAADHLTGAELPDIVLPSSQGGVNVRDFEVIYVYPRAGRPGRPLVPGWDEIPGARGCTPQSCGFRDHNAELAALGARVAGVSAQSLDDQVEFAERNQMPFPVITDEWLDLARDPGLPTFDVEGLTLYKRLALVAERGRIVKVFYPVFPPDRNAQDVLDWLEARA

Samples

	Sample ID	Description	Type	Environment
1	3300001978	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6	Metagenome	Rhizosphere
2	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
3	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
4	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
5	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
6	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
7	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
8	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
9	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
10	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
11	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
12	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
13	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
14	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
15	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
16	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
17	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
18	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
19	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
20	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
21	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
22	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
23	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
24	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
25	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
26	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
27	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
28	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
29	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
30	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
31	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
32	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
33	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
34	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
35	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
36	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
37	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
38	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
39	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
40	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
41	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
42	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
43	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
44	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
45	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
46	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
47	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
48	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
49	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
50	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
51	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
52	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
53	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
54	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
55	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
56	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
57	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
58	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
59	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
60	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
61	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
62	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
63	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
64	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
65	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
66	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
67	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
68	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
69	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
70	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
71	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
72	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
73	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
74	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
75	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
76	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
77	3300012505	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610	Metagenome	Rhizosphere
78	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
79	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
80	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
81	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
82	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
83	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
84	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
85	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
86	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
87	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
88	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
89	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
90	3300024225	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5	Metagenome	Rhizosphere
91	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300028023	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5	Metagenome	Rhizosphere
132	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
135	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
136	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
137	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
138	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
139	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
140	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
141	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
142	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
143	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
144	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
145	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
146	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
147	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
148	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
149	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
150	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
151	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
152	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
153	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
154	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
155	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
156	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
157	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
158	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
159	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
160	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
161	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
162	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
163	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
164	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
165	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
166	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
167	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
168	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
169	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
170	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
171	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
172	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
173	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
174	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
175	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
176	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
177	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
178	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
179	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
180	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
181	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
182	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
183	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
184	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
185	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
186	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
187	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
188	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
189	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
190	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
191	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
192	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
193	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
194	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
195	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
196	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
197	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
198	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
199	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
200	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
201	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
202	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
203	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
204	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
205	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
206	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
207	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
208	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
209	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
210	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
211	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
212	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
213	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
214	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
215	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
216	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
217	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
218	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
219	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
220	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
221	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
222	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
223	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
224	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
225	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
226	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
227	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
228	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
229	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
230	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
231	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
232	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
233	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
234	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
235	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
236	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
237	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
238	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
239	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
240	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
241	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	1.09
Nodule	0
Rhizoplane	9.56
Rhizosphere	88.8
Stem	0
Stem Tuber	0
Unclassified	0.55

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24747J21853_1014929	3300001978	Bacteria	811
2	Ga0065707_10226012	3300005295	Bacteria	1206
3	Ga0070658_10016058	3300005327	Bacteria	5988
4	Ga0070690_100126864	3300005330	Bacteria	1719
5	Ga0070680_100095260	3300005336	Bacteria	2467
6	Ga0070680_100199644	3300005336	Bacteria	1686
7	Ga0070682_100017359	3300005337	Bacteria	4194
8	Ga0070660_100017192	3300005339	Bacteria	5268
9	Ga0070689_100004305	3300005340	Bacteria	9604
10	Ga0070687_100017281	3300005343	Bacteria	3312
11	Ga0070687_100435892	3300005343	Bacteria	868
12	Ga0070692_10003623	3300005345	Bacteria	6306
13	Ga0070692_10696025	3300005345	Bacteria	683
14	Ga0070668_100025500	3300005347	Bacteria	4483
15	Ga0070668_100031944	3300005347	Bacteria	4006
16	Ga0070669_100370827	3300005353	Bacteria	1166
17	Ga0070675_100439630	3300005354	Bacteria	1168
18	Ga0070675_100554019	3300005354	Bacteria	1040
19	Ga0070671_100399181	3300005355	Bacteria	1176
20	Ga0070673_100046555	3300005364	Bacteria	3370
21	Ga0070688_100007772	3300005365	Bacteria	5791
22	Ga0070659_100059387	3300005366	Bacteria	3020
23	Ga0070659_100078999	3300005366	Bacteria	2626
24	Ga0070667_100138800	3300005367	Bacteria	2127
25	Ga0070703_10042227	3300005406	Bacteria	1425
26	Ga0070713_100391847	3300005436	Bacteria	1296
27	Ga0070713_101642265	3300005436	Bacteria	624
28	Ga0070710_10002970	3300005437	Bacteria	8052
29	Ga0070701_10001255	3300005438	Bacteria	9301
30	Ga0070711_100020669	3300005439	Bacteria	4247
31	Ga0070711_100858512	3300005439	Bacteria	773
32	Ga0070700_100001217	3300005441	Bacteria	12765
33	Ga0070694_100024890	3300005444	Bacteria	3868
34	Ga0070694_100727038	3300005444	Bacteria	809
35	Ga0070708_100380555	3300005445	Bacteria	1331
36	Ga0070663_100206366	3300005455	Bacteria	1536
37	Ga0070678_100025597	3300005456	Bacteria	3973
38	Ga0070678_100177842	3300005456	Bacteria	1739
39	Ga0070662_100416292	3300005457	Bacteria	1111
40	Ga0070681_10375470	3300005458	Bacteria	1332
41	Ga0068867_100009859	3300005459	Bacteria	6733
42	Ga0070685_10024908	3300005466	Bacteria	3291
43	Ga0070706_100016890	3300005467	Bacteria	6741
44	Ga0070707_100073734	3300005468	Bacteria	3291
45	Ga0070699_100064256	3300005518	Bacteria	3183
46	Ga0070699_100115864	3300005518	Bacteria	2355
47	Ga0070697_100124073	3300005536	Bacteria	2162
48	Ga0068853_100114322	3300005539	Bacteria	2401
49	Ga0070672_100151179	3300005543	Bacteria	1920
50	Ga0070686_100002076	3300005544	Bacteria	11062
51	Ga0070686_100689827	3300005544	Bacteria	813
52	Ga0070696_100011699	3300005546	Bacteria	5881
53	Ga0070696_100139122	3300005546	Bacteria	1772
54	Ga0070693_100069115	3300005547	Bacteria	2075
55	Ga0070693_100103507	3300005547	Bacteria	1738
56	Ga0070665_100115933	3300005548	Bacteria	2681
57	Ga0070704_100032740	3300005549	Bacteria	3509
58	Ga0068855_100050951	3300005563	Bacteria	4877
59	Ga0068854_100056028	3300005578	Bacteria	2840
60	Ga0068856_100050945	3300005614	Bacteria	4082
61	Ga0068856_100472926	3300005614	Bacteria	1274
62	Ga0068856_101060665	3300005614	Bacteria	828
63	Ga0070702_100005668	3300005615	Bacteria	5845
64	Ga0070702_100078305	3300005615	Bacteria	1973
65	Ga0068852_100054796	3300005616	Bacteria	3439
66	Ga0068859_100536296	3300005617	Bacteria	1265
67	Ga0068866_10033255	3300005718	Bacteria	2500
68	Ga0068858_100256745	3300005842	Bacteria	1661
69	Ga0068862_100100074	3300005844	Bacteria	2535
70	Ga0075365_10028593	3300006038	Bacteria	3556
71	Ga0075364_10054335	3300006051	Bacteria	2619
72	Ga0075364_10205289	3300006051	Bacteria	1336
73	Ga0070712_100005855	3300006175	Bacteria	7611
74	Ga0070712_100047951	3300006175	Bacteria	2959
75	Ga0070712_100115218	3300006175	Bacteria	2014
76	Ga0075428_100349058	3300006844	Unclassified	1588
77	Ga0075431_100213595	3300006847	Bacteria	1970
78	Ga0075431_100264527	3300006847	Bacteria	1745
79	Ga0075433_10023667	3300006852	Bacteria	5173
80	Ga0075433_10042596	3300006852	Bacteria	3940
81	Ga0075434_100002349	3300006871	Bacteria	16564
82	Ga0068865_100003108	3300006881	Bacteria	9928
83	Ga0068865_100199387	3300006881	Bacteria	1553
84	Ga0075436_100004048	3300006914	Bacteria	10052
85	Ga0075436_100105617	3300006914	Bacteria	1964
86	Ga0097620_100536286	3300006931	Bacteria	1265
87	Ga0075435_100003442	3300007076	Bacteria	10737
88	Ga0075435_100072992	3300007076	Bacteria	2804
89	Ga0105240_10015626	3300009093	Bacteria	10307
90	Ga0111539_10764290	3300009094	Unclassified	1125
91	Ga0105245_10097133	3300009098	Bacteria	2720
92	Ga0105247_10060896	3300009101	Bacteria	2340
93	Ga0114129_10069710	3300009147	Bacteria	4901
94	Ga0114129_10674012	3300009147	Unclassified	1332
95	Ga0105243_10008068	3300009148	Bacteria	8083
96	Ga0105241_10036168	3300009174	Bacteria	3715
97	Ga0105241_10074236	3300009174	Bacteria	2648
98	Ga0105242_10005808	3300009176	Bacteria	9504
99	Ga0105242_10827064	3300009176	Bacteria	919
100	Ga0105248_10059510	3300009177	Bacteria	4291
101	Ga0105248_11209512	3300009177	Bacteria	854
102	Ga0105237_10086098	3300009545	Bacteria	3132
103	Ga0105238_10200502	3300009551	Bacteria	1971
104	Ga0105249_10009377	3300009553	Bacteria	8565
105	Ga0105249_10212723	3300009553	Bacteria	1898
106	Ga0105239_10103685	3300010375	Bacteria	3148
107	Ga0157339_1010474	3300012505	Bacteria	838
108	Ga0157371_10571693	3300013102	Bacteria	839
109	Ga0157371_10876370	3300013102	Bacteria	680
110	Ga0157371_10999072	3300013102	Bacteria	638
111	Ga0157370_10312695	3300013104	Bacteria	1449
112	Ga0157369_10004612	3300013105	Bacteria	16199
113	Ga0157369_10299596	3300013105	Bacteria	1673
114	Ga0157369_10416181	3300013105	Bacteria	1393
115	Ga0157369_10601316	3300013105	Bacteria	1135
116	Ga0157374_10022952	3300013296	Bacteria	5572
117	Ga0157378_10006145	3300013297	Bacteria	10522
118	Ga0157378_11237686	3300013297	Bacteria	787
119	Ga0163162_10006626	3300013306	Bacteria	11223
120	Ga0157375_10114722	3300013308	Bacteria	2796
121	Ga0157380_10044661	3300014326	Bacteria	3474
122	Ga0157380_11396949	3300014326	Bacteria	750
123	Ga0157377_10861491	3300014745	Bacteria	674
124	Ga0157376_10065362	3300014969	Bacteria	3071
125	Ga0163161_10000032	3300017792	Bacteria	165511
126	Ga0163161_10043718	3300017792	Bacteria	3226
127	Ga0213875_10000171	3300021388	Bacteria	68278
128	Ga0224572_1000974	3300024225	Bacteria	3947
129	Ga0207653_10064482	3300025885	Bacteria	1242
130	Ga0207692_10004254	3300025898	Bacteria	5656
131	Ga0207642_10001396	3300025899	Bacteria	7494
132	Ga0207688_10504069	3300025901	Bacteria	758
133	Ga0207647_10111878	3300025904	Bacteria	1614
134	Ga0207685_10340008	3300025905	Bacteria	754
135	Ga0207685_10457460	3300025905	Bacteria	665
136	Ga0207699_10232126	3300025906	Bacteria	1264
137	Ga0207705_10224260	3300025909	Bacteria	1428
138	Ga0207684_10014548	3300025910	Bacteria	6778
139	Ga0207707_10305586	3300025912	Bacteria	1375
140	Ga0207695_10042125	3300025913	Bacteria	4881
141	Ga0207693_10000748	3300025915	Bacteria	29200
142	Ga0207693_10009487	3300025915	Bacteria	7925
143	Ga0207693_10198399	3300025915	Bacteria	1578
144	Ga0207663_10033746	3300025916	Bacteria	3052
145	Ga0207663_10088474	3300025916	Bacteria	2048
146	Ga0207657_10144770	3300025919	Bacteria	1939
147	Ga0207646_10037689	3300025922	Bacteria	4358
148	Ga0207681_10197202	3300025923	Bacteria	1544
149	Ga0207694_10150362	3300025924	Bacteria	1875
150	Ga0207690_10194738	3300025932	Bacteria	1535
151	Ga0207706_10396798	3300025933	Bacteria	1196
152	Ga0207686_10002804	3300025934	Bacteria	9424
153	Ga0207709_10001537	3300025935	Bacteria	15849
154	Ga0207709_10971268	3300025935	Bacteria	693
155	Ga0207670_10019660	3300025936	Bacteria	4130
156	Ga0207670_10522997	3300025936	Bacteria	966
157	Ga0207669_10013586	3300025937	Bacteria	4050
158	Ga0207704_10143459	3300025938	Unclassified	1674
159	Ga0207665_10193169	3300025939	Bacteria	1480
160	Ga0207691_10010062	3300025940	Bacteria	9078
161	Ga0207711_10071801	3300025941	Bacteria	3005
162	Ga0207661_10420406	3300025944	Bacteria	1214
163	Ga0207651_10629997	3300025960	Bacteria	940
164	Ga0207712_10002220	3300025961	Bacteria	12640
165	Ga0207712_10100929	3300025961	Unclassified	2145
166	Ga0207668_10027879	3300025972	Bacteria	3685
167	Ga0207668_10162389	3300025972	Bacteria	1742
168	Ga0207640_10294397	3300025981	Bacteria	1281
169	Ga0207677_10985499	3300026023	Bacteria	764
170	Ga0207639_10094432	3300026041	Bacteria	2401
171	Ga0207708_10000788	3300026075	Bacteria	23917
172	Ga0207708_10065121	3300026075	Bacteria	2785
173	Ga0207702_10125039	3300026078	Bacteria	2307
174	Ga0207641_10355227	3300026088	Bacteria	1398
175	Ga0207648_10002468	3300026089	Bacteria	19868
176	Ga0207648_10167854	3300026089	Bacteria	1939
177	Ga0207675_100015938	3300026118	Bacteria	7011
178	Ga0207675_100127305	3300026118	Bacteria	2413
179	Ga0207683_10000779	3300026121	Bacteria	29071
180	Ga0207683_10165397	3300026121	Bacteria	2001
181	Ga0207683_10355623	3300026121	Bacteria	1345
182	Ga0265357_1000614	3300028023	Bacteria	2199
183	Ga0268266_10161881	3300028379	Bacteria	2025
184	Ga0268265_10072440	3300028380	Bacteria	2688
185	Ga0268265_10465585	3300028380	Bacteria	1184
186	Ga0265338_10089603	3300028800	Bacteria	2548
187	Ga0265320_10030119	3300031240	Bacteria	2802
188	Ga0265339_10050289	3300031249	Bacteria	2280
189	Ga0265316_10043562	3300031344	Bacteria	3576
190	Ga0265314_10058553	3300031711	Bacteria	2639
191	Ga0307409_100069211	3300031995	Bacteria	2795
192	Ga0373930_0006504	3300034816	Bacteria	1979
193	Ga0373950_0029965	3300034818	Bacteria	1003
194	Ga0373938_0002373	3300034957	Bacteria	3036
195	Ga0373928_0005113	3300035084	Bacteria	2502
196	Ga0373929_0039926	3300035085	Bacteria	1038
197	Ga0373944_0056553	3300035089	Bacteria	1249
198	Ga0373951_0005079	3300035091	Bacteria	3076
199	Ga0373932_0037799	3300035112	Bacteria	1377
200	Ga0373936_0120781	3300035113	Bacteria	1119
201	Ga0373939_0032842	3300035114	Bacteria	1511
202	Ga0373945_0011735	3300035116	Bacteria	2901
203	Ga0373960_0000843	3300035121	Bacteria	6468
204	Ga0373943_0007876	3300035170	Bacteria	4782
205	Ga0373946_0048737	3300035171	Unclassified	1764
206	Ga0373961_0001868	3300035241	Bacteria	5738
207	Ga0373962_0000824	3300035242	Bacteria	7089
208	Ga0373931_0009987	3300035691	Bacteria	4551
209	Ga0373935_0176597	3300035692	Bacteria	1464
210	Ga0373935_0869464	3300035692	Bacteria	667
211	Ga0373947_0028526	3300035725	Bacteria	3273
212	Ga0373925_0063754	3300037068	Bacteria	2773
213	Ga0395899_0009812	3300037312	Bacteria	7346
214	Ga0395899_0032810	3300037312	Bacteria	3902
215	Ga0395899_0420192	3300037312	Bacteria	881
216	Ga0395900_0005469	3300037418	Bacteria	13299
217	Ga0395900_0006127	3300037418	Bacteria	12546
218	Ga0395900_0120160	3300037418	Bacteria	2696
219	Ga0395900_0175184	3300037418	Bacteria	2182
220	Ga0395900_0472836	3300037418	Bacteria	1207
221	Ga0395898_0006506	3300037466	Bacteria	12482
222	Ga0395898_0007542	3300037466	Bacteria	11554
223	Ga0395898_0011840	3300037466	Bacteria	9037
224	Ga0395898_0015861	3300037466	Bacteria	7720
225	Ga0395898_0018354	3300037466	Bacteria	7134
226	Ga0395898_0038871	3300037466	Bacteria	4713
227	Ga0395898_0353648	3300037466	Bacteria	1401
228	Ga0395898_0562072	3300037466	Bacteria	1083
229	Ga0395905_0005326	3300037471	Bacteria	13148
230	Ga0395905_0007798	3300037471	Bacteria	10619
231	Ga0395905_0018968	3300037471	Bacteria	6523
232	Ga0395905_0036401	3300037471	Bacteria	4622
233	Ga0395905_0148030	3300037471	Bacteria	2209
234	Ga0395905_0213248	3300037471	Bacteria	1809
235	Ga0395905_0314083	3300037471	Bacteria	1456
236	Ga0395905_0336578	3300037471	Bacteria	1400
237	Ga0395905_0898423	3300037471	Unclassified	789
238	Ga0436364_1374271	3300037853	Bacteria	119265
239	Ga0395901_0002076	3300038443	Bacteria	20543
240	Ga0395901_0002845	3300038443	Bacteria	17467
241	Ga0395901_0007145	3300038443	Bacteria	11271
242	Ga0395901_0014321	3300038443	Bacteria	8075
243	Ga0395901_0069854	3300038443	Bacteria	3658
244	Ga0395901_0148507	3300038443	Bacteria	2463
245	Ga0395901_0575649	3300038443	Bacteria	1138
246	Ga0395901_0769501	3300038443	Bacteria	954
247	Ga0395901_1254207	3300038443	Bacteria	705
248	Ga0466972_0184301	3300044658	Bacteria	979
249	Ga0466966_0056170	3300044684	Bacteria	2491
250	Ga0466961_0014697	3300044693	Bacteria	5030
251	Ga0466963_0013529	3300044694	Bacteria	5011
252	Ga0466963_0344230	3300044694	Bacteria	1050
253	Ga0466964_0456453	3300044706	Bacteria	679
254	Ga0466971_0162046	3300044719	Bacteria	1047
255	Ga0466970_0013014	3300044765	Bacteria	4263
256	Ga0466957_0149513	3300044842	Bacteria	1509
257	Ga0466959_0038019	3300045049	Bacteria	3557
258	Ga0466958_0003479	3300045836	Bacteria	8174
259	Ga0466958_0575018	3300045836	Bacteria	732
260	Ga0466967_0030980	3300045976	Bacteria	4496
261	Ga0495603_0002950	3300046455	Bacteria	10065
262	Ga0495629_0001462	3300046459	Bacteria	18609
263	Ga0495641_0019660	3300046461	Bacteria	3448
264	Ga0495641_0058557	3300046461	Bacteria	1743
265	Ga0495639_0029349	3300046475	Bacteria	2441
266	Ga0495639_0072211	3300046475	Bacteria	1595
267	Ga0495584_0272003	3300046491	Bacteria	861
268	Ga0495594_0033133	3300046499	Bacteria	2807
269	Ga0495596_0047565	3300046500	Bacteria	1683
270	Ga0495607_0091543	3300046501	Bacteria	1647
271	Ga0495608_0000305	3300046511	Bacteria	34510
272	Ga0495618_0000207	3300046514	Bacteria	42305
273	Ga0495642_0226036	3300046528	Bacteria	817
274	Ga0495665_0045056	3300046531	Bacteria	2343
275	Ga0495588_0148249	3300046674	Bacteria	1240
276	Ga0495588_0154715	3300046674	Bacteria	1212
277	Ga0495647_0013115	3300046681	Bacteria	2866
278	Ga0495647_0019128	3300046681	Bacteria	2447
279	Ga0495647_0019942	3300046681	Bacteria	2403
280	Ga0495658_0255253	3300046683	Bacteria	1103
281	Ga0495613_0004612	3300046689	Bacteria	10342
282	Ga0495624_0056044	3300046690	Bacteria	2481
283	Ga0495589_0068149	3300046794	Bacteria	1741
284	Ga0495589_0211469	3300046794	Bacteria	913
285	Ga0495589_0259990	3300046794	Bacteria	810
286	Ga0495581_0001664	3300047315	Bacteria	12376
287	Ga0495581_0441245	3300047315	Bacteria	758
288	Ga0495676_0099195	3300047321	Bacteria	2159
289	Ga0495676_0108815	3300047321	Bacteria	2038
290	Ga0495684_0364635	3300047471	Bacteria	1022
291	Ga0495593_0004371	3300047673	Bacteria	8410
292	Ga0496100_0017736	3300048903	Bacteria	4209
293	Ga0496100_0050778	3300048903	Bacteria	2689
294	Ga0496100_0201990	3300048903	Bacteria	1449
295	Ga0496101_0109782	3300048904	Bacteria	2075
296	Ga0496102_0003918	3300048905	Bacteria	12605
297	Ga0496102_0057040	3300048905	Bacteria	3564
298	Ga0496103_0001746	3300048906	Bacteria	14195
299	Ga0496103_0015001	3300048906	Bacteria	4606
300	Ga0496104_0006454	3300048907	Bacteria	10310
301	Ga0496104_0100050	3300048907	Bacteria	2775
302	Ga0496104_0101184	3300048907	Bacteria	2759
303	Ga0496104_0241640	3300048907	Bacteria	1718
304	Ga0496105_0004034	3300048908	Bacteria	10986
305	Ga0496105_0147349	3300048908	Bacteria	1935
306	Ga0496105_0188259	3300048908	Bacteria	1688
307	Ga0496106_0021153	3300048909	Bacteria	4830
308	Ga0496106_0028568	3300048909	Bacteria	4154
309	Ga0496106_1019572	3300048909	Bacteria	650
310	Ga0496107_0005349	3300048910	Bacteria	8780
311	Ga0496107_0144485	3300048910	Bacteria	1759
312	Ga0496107_0171921	3300048910	Bacteria	1608
313	Ga0496109_0093971	3300048912	Bacteria	2775
314	Ga0496109_0810486	3300048912	Bacteria	874
315	Ga0496110_0099073	3300048913	Bacteria	2613
316	Ga0496111_0137361	3300048914	Bacteria	1811
317	Ga0496111_0396091	3300048914	Bacteria	1021
318	Ga0496112_0037580	3300048915	Bacteria	4725
319	Ga0496112_0792777	3300048915	Bacteria	872
320	Ga0496113_0054255	3300048916	Bacteria	2999
321	Ga0496113_0106685	3300048916	Bacteria	2176
322	Ga0496114_0001187	3300048917	Bacteria	19739
323	Ga0496114_0097294	3300048917	Bacteria	2507
324	Ga0496114_0172757	3300048917	Bacteria	1884
325	Ga0496115_0016040	3300048918	Bacteria	5696
326	Ga0496115_0299781	3300048918	Bacteria	1317
327	Ga0501031_0381960	3300049568	Bacteria	911
328	Ga0501031_0614090	3300049568	Bacteria	699
329	Ga0501034_0000097	3300049571	Bacteria	161027
330	Ga0501036_0537064	3300049572	Bacteria	972
331	Ga0501038_0081472	3300049574	Bacteria	2726
332	Ga0501042_0095908	3300049578	Bacteria	2131
333	Ga0501069_0021054	3300049585	Bacteria	3536
334	Ga0501071_0193127	3300049587	Bacteria	1527
335	Ga0501071_0360904	3300049587	Bacteria	1106
336	Ga0501072_0067782	3300049588	Bacteria	2816
337	Ga0501073_0154843	3300049589	Bacteria	1588
338	Ga0501074_0141843	3300049590	Bacteria	1718
339	Ga0501076_0408503	3300049592	Bacteria	1117
340	Ga0501077_0126660	3300049593	Bacteria	1619
341	Ga0501079_0118961	3300049741	Bacteria	2054
342	Ga0501079_0595778	3300049741	Bacteria	870
343	Ga0501080_0183044	3300049742	Bacteria	1927
344	Ga0501080_0745644	3300049742	Bacteria	861
345	Ga0501081_0135330	3300049743	Bacteria	1764
346	Ga0501083_0112138	3300049744	Bacteria	1792
347	nmdc:mga0yw44_42547_c1	3300050492	Unclassified	2709
348	nmdc:mga05p37_48535_c1	3300050507	Bacteria	5221
349	nmdc:mga06r32_184568_c1	3300050510	Bacteria	2072
350	nmdc:mga06r32_502562_c1	3300050510	Unclassified	1189
351	nmdc:mga08y16_229180_c1	3300050511	Bacteria	1921
352	nmdc:mga0n895_1373511_c1	3300050512	Bacteria	675
353	nmdc:mga0n895_183535_c1	3300050512	Bacteria	2124
354	nmdc:mga0n895_39525_c1	3300050512	Bacteria	4578
355	nmdc:mga0rr50_150343_c1	3300050513	Bacteria	1881
356	nmdc:mga0rr50_59218_c1	3300050513	Bacteria	2875
357	nmdc:mga08x19_167562_c1	3300050514	Bacteria	1494
358	nmdc:mga08x19_19046_c1	3300050514	Bacteria	4210
359	nmdc:mga0a205_141080_c1	3300050515	Bacteria	2310
360	nmdc:mga0a205_82333_c1	3300050515	Bacteria	3109
361	Ga0495595_0000087	3300053084	Bacteria	43931
362	Ga0501084_0021920	3300054114	Bacteria	5328
363	Ga0501084_0241793	3300054114	Bacteria	1524
364	Ga0501082_0185591	3300060353	Bacteria	1809
365	Ga0501082_0370975	3300060353	Bacteria	1248
366	Ga0530510_0181725	3300061734	Bacteria	1560

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300014326	Ga0157380_11396949	Ga0157380_113969491	159
2	3300048907	Ga0496104_0241640	Ga0496104_0241640_1142_1702	164
3	3300049741	Ga0501079_0595778	Ga0501079_0595778_81_653	168
4	3300049593	Ga0501077_0126660	Ga0501077_0126660_16_558	175
5	3300025905	Ga0207685_10457460	Ga0207685_104574601	176
6	3300006175	Ga0070712_100115218	Ga0070712_1001152182	178
7	3300025915	Ga0207693_10198399	Ga0207693_101983992	178
8	3300048903	Ga0496100_0201990	Ga0496100_0201990_20_568	178
9	3300048907	Ga0496104_0006454	Ga0496104_0006454_1910_2458	178
10	3300048908	Ga0496105_0004034	Ga0496105_0004034_9395_9943	178
11	3300048912	Ga0496109_0810486	Ga0496109_0810486_204_752	178
12	3300048917	Ga0496114_0097294	Ga0496114_0097294_1063_1611	178
13	3300005544	Ga0070686_100689827	Ga0070686_1006898272	179
14	3300005614	Ga0068856_101060665	Ga0068856_1010606652	179
15	3300013102	Ga0157371_10571693	Ga0157371_105716932	179
16	3300031995	Ga0307409_100069211	Ga0307409_1000692114	179
17	3300037466	Ga0395898_0007542	Ga0395898_0007542_9140_9685	179
18	3300037471	Ga0395905_0148030	Ga0395905_0148030_608_1153	179
19	3300038443	Ga0395901_0002076	Ga0395901_0002076_19043_19588	179
20	3300038443	Ga0395901_0769501	Ga0395901_0769501_210_764	179
21	3300044694	Ga0466963_0344230	Ga0466963_0344230_357_959	179
22	3300048905	Ga0496102_0057040	Ga0496102_0057040_2015_2560	179
23	3300048906	Ga0496103_0015001	Ga0496103_0015001_299_844	179
24	3300048909	Ga0496106_1019572	Ga0496106_1019572_54_611	179
25	3300048910	Ga0496107_0144485	Ga0496107_0144485_492_1037	179
26	3300048913	Ga0496110_0099073	Ga0496110_0099073_1018_1563	179
27	3300048914	Ga0496111_0137361	Ga0496111_0137361_1130_1675	179
28	3300048916	Ga0496113_0106685	Ga0496113_0106685_1519_2064	179
29	3300050512	nmdc:mga0n895_1373511_c1	nmdc:mga0n895_1373511_c1_108_653	179
30	3300005345	Ga0070692_10696025	Ga0070692_106960251	180
31	3300005354	Ga0070675_100554019	Ga0070675_1005540192	180
32	3300005436	Ga0070713_101642265	Ga0070713_1016422651	180
33	3300005456	Ga0070678_100177842	Ga0070678_1001778423	180
34	3300005543	Ga0070672_100151179	Ga0070672_1001511792	180
35	3300006881	Ga0068865_100199387	Ga0068865_1001993872	180
36	3300009176	Ga0105242_10827064	Ga0105242_108270642	180
37	3300013105	Ga0157369_10004612	Ga0157369_1000461211	180
38	3300025935	Ga0207709_10971268	Ga0207709_109712682	180
39	3300025938	Ga0207704_10143459	Ga0207704_101434592	180
40	3300025944	Ga0207661_10420406	Ga0207661_104204061	180
41	3300026023	Ga0207677_10985499	Ga0207677_109854992	180
42	3300026121	Ga0207683_10165397	Ga0207683_101653972	180
43	3300026121	Ga0207683_10355623	Ga0207683_103556232	180
44	3300028023	Ga0265357_1000614	Ga0265357_10006144	180
45	3300028800	Ga0265338_10089603	Ga0265338_100896032	180
46	3300031240	Ga0265320_10030119	Ga0265320_100301193	180
47	3300031249	Ga0265339_10050289	Ga0265339_100502893	180
48	3300031344	Ga0265316_10043562	Ga0265316_100435623	180
49	3300031711	Ga0265314_10058553	Ga0265314_100585532	180
50	3300037312	Ga0395899_0009812	Ga0395899_0009812_1914_2468	180
51	3300037418	Ga0395900_0005469	Ga0395900_0005469_7994_8548	180
52	3300037466	Ga0395898_0006506	Ga0395898_0006506_7881_8435	180
53	3300037466	Ga0395898_0353648	Ga0395898_0353648_383_931	180
54	3300037471	Ga0395905_0018968	Ga0395905_0018968_263_817	180
55	3300037471	Ga0395905_0213248	Ga0395905_0213248_1039_1587	180
56	3300038443	Ga0395901_0014321	Ga0395901_0014321_236_790	180
57	3300038443	Ga0395901_1254207	Ga0395901_1254207_74_622	180
58	3300045836	Ga0466958_0575018	Ga0466958_0575018_143_715	180
59	3300046794	Ga0495589_0211469	Ga0495589_0211469_63_608	180
60	3300049742	Ga0501080_0183044	Ga0501080_0183044_1134_1682	180
61	3300005295	Ga0065707_10226012	Ga0065707_102260122	181
62	3300005343	Ga0070687_100435892	Ga0070687_1004358922	181
63	3300005347	Ga0070668_100031944	Ga0070668_1000319442	181
64	3300005366	Ga0070659_100078999	Ga0070659_1000789993	181
65	3300005445	Ga0070708_100380555	Ga0070708_1003805552	181
66	3300005467	Ga0070706_100016890	Ga0070706_1000168905	181
67	3300005468	Ga0070707_100073734	Ga0070707_1000737341	181
68	3300005518	Ga0070699_100064256	Ga0070699_1000642565	181
69	3300005536	Ga0070697_100124073	Ga0070697_1001240732	181
70	3300005547	Ga0070693_100103507	Ga0070693_1001035071	181
71	3300006038	Ga0075365_10028593	Ga0075365_100285932	181
72	3300006051	Ga0075364_10054335	Ga0075364_100543353	181
73	3300006051	Ga0075364_10205289	Ga0075364_102052892	181
74	3300006847	Ga0075431_100264527	Ga0075431_1002645273	181
75	3300006852	Ga0075433_10023667	Ga0075433_100236674	181
76	3300006871	Ga0075434_100002349	Ga0075434_10000234910	181
77	3300006914	Ga0075436_100004048	Ga0075436_1000040484	181
78	3300006914	Ga0075436_100105617	Ga0075436_1001056173	181
79	3300007076	Ga0075435_100003442	Ga0075435_1000034424	181
80	3300007076	Ga0075435_100072992	Ga0075435_1000729925	181
81	3300009147	Ga0114129_10069710	Ga0114129_100697104	181
82	3300009174	Ga0105241_10036168	Ga0105241_100361684	181
83	3300009177	Ga0105248_11209512	Ga0105248_112095122	181
84	3300012505	Ga0157339_1010474	Ga0157339_10104742	181
85	3300013102	Ga0157371_10876370	Ga0157371_108763701	181
86	3300013105	Ga0157369_10416181	Ga0157369_104161812	181
87	3300013105	Ga0157369_10601316	Ga0157369_106013162	181
88	3300025910	Ga0207684_10014548	Ga0207684_100145485	181
89	3300025922	Ga0207646_10037689	Ga0207646_100376893	181
90	3300025936	Ga0207670_10522997	Ga0207670_105229972	181
91	3300025972	Ga0207668_10162389	Ga0207668_101623893	181
92	3300026075	Ga0207708_10065121	Ga0207708_100651213	181
93	3300026089	Ga0207648_10167854	Ga0207648_101678543	181
94	3300026118	Ga0207675_100127305	Ga0207675_1001273053	181
95	3300028380	Ga0268265_10465585	Ga0268265_104655851	181
96	3300034816	Ga0373930_0006504	Ga0373930_0006504_769_1347	181
97	3300034818	Ga0373950_0029965	Ga0373950_0029965_269_847	181
98	3300034957	Ga0373938_0002373	Ga0373938_0002373_478_1056	181
99	3300035084	Ga0373928_0005113	Ga0373928_0005113_801_1379	181
100	3300035085	Ga0373929_0039926	Ga0373929_0039926_442_1020	181
101	3300035089	Ga0373944_0056553	Ga0373944_0056553_379_957	181
102	3300035091	Ga0373951_0005079	Ga0373951_0005079_765_1343	181
103	3300035112	Ga0373932_0037799	Ga0373932_0037799_256_834	181
104	3300035113	Ga0373936_0120781	Ga0373936_0120781_111_689	181
105	3300035114	Ga0373939_0032842	Ga0373939_0032842_367_945	181
106	3300035116	Ga0373945_0011735	Ga0373945_0011735_668_1246	181
107	3300035121	Ga0373960_0000843	Ga0373960_0000843_3354_3932	181
108	3300035170	Ga0373943_0007876	Ga0373943_0007876_715_1293	181
109	3300035171	Ga0373946_0048737	Ga0373946_0048737_300_878	181
110	3300035241	Ga0373961_0001868	Ga0373961_0001868_1963_2541	181
111	3300035242	Ga0373962_0000824	Ga0373962_0000824_6213_6791	181
112	3300035691	Ga0373931_0009987	Ga0373931_0009987_2405_2983	181
113	3300035692	Ga0373935_0176597	Ga0373935_0176597_442_1020	181
114	3300035725	Ga0373947_0028526	Ga0373947_0028526_658_1236	181
115	3300037068	Ga0373925_0063754	Ga0373925_0063754_334_912	181
116	3300037312	Ga0395899_0032810	Ga0395899_0032810_1925_2473	181
117	3300037312	Ga0395899_0420192	Ga0395899_0420192_227_778	181
118	3300037418	Ga0395900_0006127	Ga0395900_0006127_2170_2718	181
119	3300037418	Ga0395900_0120160	Ga0395900_0120160_1197_1748	181
120	3300037418	Ga0395900_0472836	Ga0395900_0472836_183_740	181
121	3300037466	Ga0395898_0011840	Ga0395898_0011840_8462_9010	181
122	3300037466	Ga0395898_0015861	Ga0395898_0015861_6464_7015	181
123	3300037466	Ga0395898_0018354	Ga0395898_0018354_951_1502	181
124	3300037466	Ga0395898_0038871	Ga0395898_0038871_4111_4668	181
125	3300037466	Ga0395898_0562072	Ga0395898_0562072_217_768	181
126	3300037471	Ga0395905_0005326	Ga0395905_0005326_2783_3331	181
127	3300037471	Ga0395905_0007798	Ga0395905_0007798_881_1432	181
128	3300037471	Ga0395905_0036401	Ga0395905_0036401_963_1514	181
129	3300037471	Ga0395905_0314083	Ga0395905_0314083_776_1333	181
130	3300038443	Ga0395901_0002845	Ga0395901_0002845_16081_16632	181
131	3300038443	Ga0395901_0007145	Ga0395901_0007145_3403_3951	181
132	3300038443	Ga0395901_0069854	Ga0395901_0069854_1305_1856	181
133	3300038443	Ga0395901_0148507	Ga0395901_0148507_1482_2039	181
134	3300038443	Ga0395901_0575649	Ga0395901_0575649_362_925	181
135	3300046455	Ga0495603_0002950	Ga0495603_0002950_8336_8914	181
136	3300046459	Ga0495629_0001462	Ga0495629_0001462_7492_8070	181
137	3300046461	Ga0495641_0019660	Ga0495641_0019660_1205_1783	181
138	3300046475	Ga0495639_0029349	Ga0495639_0029349_1717_2295	181
139	3300046499	Ga0495594_0033133	Ga0495594_0033133_2033_2611	181
140	3300046528	Ga0495642_0226036	Ga0495642_0226036_46_714	181
141	3300046674	Ga0495588_0148249	Ga0495588_0148249_392_970	181
142	3300046681	Ga0495647_0013115	Ga0495647_0013115_1891_2469	181
143	3300046689	Ga0495613_0004612	Ga0495613_0004612_7703_8281	181
144	3300046794	Ga0495589_0259990	Ga0495589_0259990_35_613	181
145	3300047321	Ga0495676_0099195	Ga0495676_0099195_275_853	181
146	3300047471	Ga0495684_0364635	Ga0495684_0364635_364_942	181
147	3300047673	Ga0495593_0004371	Ga0495593_0004371_4145_4723	181
148	3300048907	Ga0496104_0100050	Ga0496104_0100050_689_1267	181
149	3300048908	Ga0496105_0188259	Ga0496105_0188259_590_1168	181
150	3300048912	Ga0496109_0093971	Ga0496109_0093971_689_1267	181
151	3300048914	Ga0496111_0396091	Ga0496111_0396091_217_795	181
152	3300048915	Ga0496112_0037580	Ga0496112_0037580_689_1267	181
153	3300048916	Ga0496113_0054255	Ga0496113_0054255_647_1225	181
154	3300049568	Ga0501031_0381960	Ga0501031_0381960_269_841	181
155	3300049568	Ga0501031_0614090	Ga0501031_0614090_118_687	181
156	3300049571	Ga0501034_0000097	Ga0501034_0000097_10345_10917	181
157	3300049572	Ga0501036_0537064	Ga0501036_0537064_261_830	181
158	3300049574	Ga0501038_0081472	Ga0501038_0081472_1285_1857	181
159	3300049585	Ga0501069_0021054	Ga0501069_0021054_757_1329	181
160	3300049587	Ga0501071_0193127	Ga0501071_0193127_557_1129	181
161	3300049587	Ga0501071_0360904	Ga0501071_0360904_433_1002	181
162	3300049588	Ga0501072_0067782	Ga0501072_0067782_128_700	181
163	3300049589	Ga0501073_0154843	Ga0501073_0154843_666_1238	181
164	3300049590	Ga0501074_0141843	Ga0501074_0141843_100_672	181
165	3300049592	Ga0501076_0408503	Ga0501076_0408503_351_923	181
166	3300049742	Ga0501080_0745644	Ga0501080_0745644_201_773	181
167	3300049744	Ga0501083_0112138	Ga0501083_0112138_903_1475	181
168	3300050492	nmdc:mga0yw44_42547_c1	nmdc:mga0yw44_42547_c1_295_846	181
169	3300050507	nmdc:mga05p37_48535_c1	nmdc:mga05p37_48535_c1_802_1353	181
170	3300050510	nmdc:mga06r32_184568_c1	nmdc:mga06r32_184568_c1_1472_2023	181
171	3300050512	nmdc:mga0n895_183535_c1	nmdc:mga0n895_183535_c1_109_687	181
172	3300050512	nmdc:mga0n895_39525_c1	nmdc:mga0n895_39525_c1_2201_2752	181
173	3300050513	nmdc:mga0rr50_59218_c1	nmdc:mga0rr50_59218_c1_1792_2343	181
174	3300050514	nmdc:mga08x19_167562_c1	nmdc:mga08x19_167562_c1_785_1345	181
175	3300050514	nmdc:mga08x19_19046_c1	nmdc:mga08x19_19046_c1_1977_2528	181
176	3300050515	nmdc:mga0a205_82333_c1	nmdc:mga0a205_82333_c1_1744_2295	181
177	3300054114	Ga0501084_0021920	Ga0501084_0021920_755_1327	181
178	3300054114	Ga0501084_0241793	Ga0501084_0241793_383_952	181
179	3300060353	Ga0501082_0185591	Ga0501082_0185591_347_919	181
180	3300060353	Ga0501082_0370975	Ga0501082_0370975_32_601	181
181	3300001978	JGI24747J21853_1014929	JGI24747J21853_10149292	182
182	3300005327	Ga0070658_10016058	Ga0070658_100160584	182
183	3300005330	Ga0070690_100126864	Ga0070690_1001268642	182
184	3300005336	Ga0070680_100095260	Ga0070680_1000952602	182
185	3300005336	Ga0070680_100199644	Ga0070680_1001996442	182
186	3300005337	Ga0070682_100017359	Ga0070682_1000173594	182
187	3300005339	Ga0070660_100017192	Ga0070660_1000171926	182
188	3300005340	Ga0070689_100004305	Ga0070689_1000043053	182
189	3300005343	Ga0070687_100017281	Ga0070687_1000172812	182
190	3300005345	Ga0070692_10003623	Ga0070692_100036232	182
191	3300005347	Ga0070668_100025500	Ga0070668_1000255002	182
192	3300005353	Ga0070669_100370827	Ga0070669_1003708272	182
193	3300005354	Ga0070675_100439630	Ga0070675_1004396302	182
194	3300005355	Ga0070671_100399181	Ga0070671_1003991812	182
195	3300005364	Ga0070673_100046555	Ga0070673_1000465553	182
196	3300005365	Ga0070688_100007772	Ga0070688_1000077724	182
197	3300005366	Ga0070659_100059387	Ga0070659_1000593873	182
198	3300005367	Ga0070667_100138800	Ga0070667_1001388003	182
199	3300005406	Ga0070703_10042227	Ga0070703_100422272	182
200	3300005436	Ga0070713_100391847	Ga0070713_1003918472	182
201	3300005437	Ga0070710_10002970	Ga0070710_100029706	182
202	3300005438	Ga0070701_10001255	Ga0070701_100012553	182
203	3300005439	Ga0070711_100020669	Ga0070711_1000206693	182
204	3300005439	Ga0070711_100858512	Ga0070711_1008585121	182
205	3300005441	Ga0070700_100001217	Ga0070700_10000121713	182
206	3300005444	Ga0070694_100024890	Ga0070694_1000248902	182
207	3300005444	Ga0070694_100727038	Ga0070694_1007270382	182
208	3300005455	Ga0070663_100206366	Ga0070663_1002063662	182
209	3300005456	Ga0070678_100025597	Ga0070678_1000255974	182
210	3300005457	Ga0070662_100416292	Ga0070662_1004162922	182
211	3300005458	Ga0070681_10375470	Ga0070681_103754703	182
212	3300005459	Ga0068867_100009859	Ga0068867_1000098592	182
213	3300005466	Ga0070685_10024908	Ga0070685_100249082	182
214	3300005518	Ga0070699_100115864	Ga0070699_1001158642	182
215	3300005539	Ga0068853_100114322	Ga0068853_1001143223	182
216	3300005544	Ga0070686_100002076	Ga0070686_1000020763	182
217	3300005546	Ga0070696_100011699	Ga0070696_1000116992	182
218	3300005546	Ga0070696_100139122	Ga0070696_1001391223	182
219	3300005547	Ga0070693_100069115	Ga0070693_1000691153	182
220	3300005548	Ga0070665_100115933	Ga0070665_1001159332	182
221	3300005549	Ga0070704_100032740	Ga0070704_1000327403	182
222	3300005563	Ga0068855_100050951	Ga0068855_1000509516	182
223	3300005578	Ga0068854_100056028	Ga0068854_1000560285	182
224	3300005614	Ga0068856_100050945	Ga0068856_1000509455	182
225	3300005614	Ga0068856_100472926	Ga0068856_1004729263	182
226	3300005615	Ga0070702_100005668	Ga0070702_1000056686	182
227	3300005615	Ga0070702_100078305	Ga0070702_1000783052	182
228	3300005616	Ga0068852_100054796	Ga0068852_1000547962	182
229	3300005617	Ga0068859_100536296	Ga0068859_1005362962	182
230	3300005718	Ga0068866_10033255	Ga0068866_100332552	182
231	3300005842	Ga0068858_100256745	Ga0068858_1002567452	182
232	3300005844	Ga0068862_100100074	Ga0068862_1001000742	182
233	3300006175	Ga0070712_100005855	Ga0070712_1000058554	182
234	3300006175	Ga0070712_100047951	Ga0070712_1000479512	182
235	3300006844	Ga0075428_100349058	Ga0075428_1003490582	182
236	3300006847	Ga0075431_100213595	Ga0075431_1002135953	182
237	3300006852	Ga0075433_10042596	Ga0075433_100425963	182
238	3300006881	Ga0068865_100003108	Ga0068865_1000031088	182
239	3300006931	Ga0097620_100536286	Ga0097620_1005362862	182
240	3300009093	Ga0105240_10015626	Ga0105240_1001562610	182
241	3300009094	Ga0111539_10764290	Ga0111539_107642902	182
242	3300009098	Ga0105245_10097133	Ga0105245_100971332	182
243	3300009101	Ga0105247_10060896	Ga0105247_100608963	182
244	3300009147	Ga0114129_10674012	Ga0114129_106740122	182
245	3300009148	Ga0105243_10008068	Ga0105243_100080687	182
246	3300009174	Ga0105241_10074236	Ga0105241_100742362	182
247	3300009176	Ga0105242_10005808	Ga0105242_100058088	182
248	3300009177	Ga0105248_10059510	Ga0105248_100595102	182
249	3300009545	Ga0105237_10086098	Ga0105237_100860983	182
250	3300009551	Ga0105238_10200502	Ga0105238_102005022	182
251	3300009553	Ga0105249_10009377	Ga0105249_100093772	182
252	3300009553	Ga0105249_10212723	Ga0105249_102127233	182
253	3300010375	Ga0105239_10103685	Ga0105239_101036853	182
254	3300013102	Ga0157371_10999072	Ga0157371_109990721	182
255	3300013104	Ga0157370_10312695	Ga0157370_103126952	182
256	3300013105	Ga0157369_10299596	Ga0157369_102995962	182
257	3300013296	Ga0157374_10022952	Ga0157374_100229526	182
258	3300013297	Ga0157378_10006145	Ga0157378_100061453	182
259	3300013297	Ga0157378_11237686	Ga0157378_112376862	182
260	3300013306	Ga0163162_10006626	Ga0163162_100066269	182
261	3300013308	Ga0157375_10114722	Ga0157375_101147222	182
262	3300014326	Ga0157380_10044661	Ga0157380_100446613	182
263	3300014745	Ga0157377_10861491	Ga0157377_108614911	182
264	3300014969	Ga0157376_10065362	Ga0157376_100653622	182
265	3300017792	Ga0163161_10000032	Ga0163161_10000032136	182
266	3300017792	Ga0163161_10043718	Ga0163161_100437183	182
267	3300021388	Ga0213875_10000171	Ga0213875_1000017144	182
268	3300024225	Ga0224572_1000974	Ga0224572_10009742	182
269	3300025885	Ga0207653_10064482	Ga0207653_100644822	182
270	3300025898	Ga0207692_10004254	Ga0207692_100042542	182
271	3300025899	Ga0207642_10001396	Ga0207642_100013967	182
272	3300025901	Ga0207688_10504069	Ga0207688_105040691	182
273	3300025904	Ga0207647_10111878	Ga0207647_101118782	182
274	3300025905	Ga0207685_10340008	Ga0207685_103400082	182
275	3300025906	Ga0207699_10232126	Ga0207699_102321262	182
276	3300025909	Ga0207705_10224260	Ga0207705_102242602	182
277	3300025912	Ga0207707_10305586	Ga0207707_103055862	182
278	3300025913	Ga0207695_10042125	Ga0207695_100421253	182
279	3300025915	Ga0207693_10000748	Ga0207693_1000074821	182
280	3300025915	Ga0207693_10009487	Ga0207693_100094878	182
281	3300025916	Ga0207663_10033746	Ga0207663_100337462	182
282	3300025916	Ga0207663_10088474	Ga0207663_100884743	182
283	3300025919	Ga0207657_10144770	Ga0207657_101447702	182
284	3300025923	Ga0207681_10197202	Ga0207681_101972022	182
285	3300025924	Ga0207694_10150362	Ga0207694_101503622	182
286	3300025932	Ga0207690_10194738	Ga0207690_101947382	182
287	3300025933	Ga0207706_10396798	Ga0207706_103967982	182
288	3300025934	Ga0207686_10002804	Ga0207686_100028049	182
289	3300025935	Ga0207709_10001537	Ga0207709_1000153713	182
290	3300025936	Ga0207670_10019660	Ga0207670_100196604	182
291	3300025937	Ga0207669_10013586	Ga0207669_100135863	182
292	3300025939	Ga0207665_10193169	Ga0207665_101931692	182
293	3300025940	Ga0207691_10010062	Ga0207691_100100622	182
294	3300025941	Ga0207711_10071801	Ga0207711_100718012	182
295	3300025960	Ga0207651_10629997	Ga0207651_106299972	182
296	3300025961	Ga0207712_10002220	Ga0207712_100022207	182
297	3300025961	Ga0207712_10100929	Ga0207712_101009292	182
298	3300025972	Ga0207668_10027879	Ga0207668_100278794	182
299	3300025981	Ga0207640_10294397	Ga0207640_102943971	182
300	3300026041	Ga0207639_10094432	Ga0207639_100944322	182
301	3300026075	Ga0207708_10000788	Ga0207708_1000078820	182
302	3300026078	Ga0207702_10125039	Ga0207702_101250392	182
303	3300026088	Ga0207641_10355227	Ga0207641_103552272	182
304	3300026089	Ga0207648_10002468	Ga0207648_1000246814	182
305	3300026118	Ga0207675_100015938	Ga0207675_1000159387	182
306	3300026121	Ga0207683_10000779	Ga0207683_1000077918	182
307	3300028379	Ga0268266_10161881	Ga0268266_101618813	182
308	3300028380	Ga0268265_10072440	Ga0268265_100724404	182
309	3300035692	Ga0373935_0869464	Ga0373935_0869464_50_604	182
310	3300037418	Ga0395900_0175184	Ga0395900_0175184_1132_1683	182
311	3300037471	Ga0395905_0336578	Ga0395905_0336578_92_646	182
312	3300037471	Ga0395905_0898423	Ga0395905_0898423_195_749	182
313	3300037853	Ga0436364_1374271	Ga0436364_1374271_27723_28313	182
314	3300044658	Ga0466972_0184301	Ga0466972_0184301_167_724	182
315	3300044684	Ga0466966_0056170	Ga0466966_0056170_915_1472	182
316	3300044693	Ga0466961_0014697	Ga0466961_0014697_2101_2658	182
317	3300044694	Ga0466963_0013529	Ga0466963_0013529_4208_4765	182
318	3300044706	Ga0466964_0456453	Ga0466964_0456453_84_641	182
319	3300044719	Ga0466971_0162046	Ga0466971_0162046_414_971	182
320	3300044765	Ga0466970_0013014	Ga0466970_0013014_2500_3057	182
321	3300044842	Ga0466957_0149513	Ga0466957_0149513_162_719	182
322	3300045049	Ga0466959_0038019	Ga0466959_0038019_1292_1849	182
323	3300045836	Ga0466958_0003479	Ga0466958_0003479_5000_5557	182
324	3300045976	Ga0466967_0030980	Ga0466967_0030980_1594_2151	182
325	3300046461	Ga0495641_0058557	Ga0495641_0058557_527_1081	182
326	3300046475	Ga0495639_0072211	Ga0495639_0072211_1007_1561	182
327	3300046491	Ga0495584_0272003	Ga0495584_0272003_267_821	182
328	3300046500	Ga0495596_0047565	Ga0495596_0047565_424_978	182
329	3300046501	Ga0495607_0091543	Ga0495607_0091543_634_1188	182
330	3300046511	Ga0495608_0000305	Ga0495608_0000305_5099_5692	182
331	3300046514	Ga0495618_0000207	Ga0495618_0000207_38132_38710	182
332	3300046531	Ga0495665_0045056	Ga0495665_0045056_393_947	182
333	3300046674	Ga0495588_0154715	Ga0495588_0154715_648_1202	182
334	3300046681	Ga0495647_0019128	Ga0495647_0019128_1049_1624	182
335	3300046681	Ga0495647_0019942	Ga0495647_0019942_1543_2097	182
336	3300046683	Ga0495658_0255253	Ga0495658_0255253_325_879	182
337	3300046690	Ga0495624_0056044	Ga0495624_0056044_1003_1557	182
338	3300046794	Ga0495589_0068149	Ga0495589_0068149_323_877	182
339	3300047315	Ga0495581_0001664	Ga0495581_0001664_4652_5206	182
340	3300047315	Ga0495581_0441245	Ga0495581_0441245_52_606	182
341	3300047321	Ga0495676_0108815	Ga0495676_0108815_134_688	182
342	3300048903	Ga0496100_0017736	Ga0496100_0017736_1778_2332	182
343	3300048903	Ga0496100_0050778	Ga0496100_0050778_1902_2453	182
344	3300048904	Ga0496101_0109782	Ga0496101_0109782_742_1293	182
345	3300048905	Ga0496102_0003918	Ga0496102_0003918_4079_4633	182
346	3300048906	Ga0496103_0001746	Ga0496103_0001746_4168_4722	182
347	3300048907	Ga0496104_0101184	Ga0496104_0101184_835_1389	182
348	3300048908	Ga0496105_0147349	Ga0496105_0147349_822_1376	182
349	3300048909	Ga0496106_0021153	Ga0496106_0021153_1680_2231	182
350	3300048909	Ga0496106_0028568	Ga0496106_0028568_1708_2262	182
351	3300048910	Ga0496107_0005349	Ga0496107_0005349_6292_6846	182
352	3300048910	Ga0496107_0171921	Ga0496107_0171921_49_600	182
353	3300048915	Ga0496112_0792777	Ga0496112_0792777_277_831	182
354	3300048917	Ga0496114_0001187	Ga0496114_0001187_9451_10005	182
355	3300048917	Ga0496114_0172757	Ga0496114_0172757_239_820	182
356	3300048918	Ga0496115_0016040	Ga0496115_0016040_4321_4875	182
357	3300048918	Ga0496115_0299781	Ga0496115_0299781_505_1056	182
358	3300049578	Ga0501042_0095908	Ga0501042_0095908_325_891	182
359	3300049741	Ga0501079_0118961	Ga0501079_0118961_1224_1796	182
360	3300049743	Ga0501081_0135330	Ga0501081_0135330_313_885	182
361	3300050510	nmdc:mga06r32_502562_c1	nmdc:mga06r32_502562_c1_579_1151	182
362	3300050511	nmdc:mga08y16_229180_c1	nmdc:mga08y16_229180_c1_93_665	182
363	3300050513	nmdc:mga0rr50_150343_c1	nmdc:mga0rr50_150343_c1_1187_1738	182
364	3300050515	nmdc:mga0a205_141080_c1	nmdc:mga0a205_141080_c1_144_695	182
365	3300053084	Ga0495595_0000087	Ga0495595_0000087_27458_28051	182
366	3300061734	Ga0530510_0181725	Ga0530510_0181725_496_1068	182

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08534

Redoxin

64

215

0.85 PF00578

AhpC-TSA

AhpC/TSA family

109

200

0.84 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4eo3-assembly1.cif.gz_B	peroxiredoxin nitroreductase fusion enzyme	0.836	26	179
5epf-assembly1.cif.gz_A	crystal structure of peroxidoxin bcpb from mycobacterium tuberculosis	0.8268	24	182
5enu-assembly2.cif.gz_B	crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria	0.8215	24	179
3drn-assembly2.cif.gz_B	the crystal structure of bcp1 from sulfolobus sulfataricus	0.8169	24	179
3ixr-assembly1.cif.gz_A	crystal structure of xylella fastidiosa prxq c47s mutant	0.8083	24	182

ID	Description	Score	Start	End	Superfamily
af_Q5A7P9_48_194_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.8362	26	179	3.40.30.10
4eo3B01	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.836	26	179	3.40.30.10
af_I1MS47_66_213_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.835	24	179	3.40.30.10
af_O94561_50_193_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.8325	26	180	3.40.30.10
af_O94561_50_193_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.8271	26	180	3.40.30.10

ID	Description	Score	Start	End	GO Terms
AF-A0A7Y5U7E2-F1-model_v4	Peroxiredoxin	0.98	29	181	GO:0005737 GO:0008379 GO:0034599 GO:0045454
AF-A0A7W0S362-F1-model_v4	Peroxiredoxin	0.9781	59	181	GO:0005737 GO:0008379 GO:0034599 GO:0045454
AF-A0A1V8M1Z1-F1-model_v4	Redoxin domain-containing protein	0.9761	47	179	GO:0005737 GO:0008379 GO:0034599 GO:0045454
AF-A0A1H6XWC9-F1-model_v4	Peroxiredoxin	0.9756	47	179	GO:0005737 GO:0008379 GO:0034599 GO:0045454
AF-A0A210S0D5-F1-model_v4	Peroxiredoxin	0.9751	1	179	GO:0005737 GO:0008379 GO:0034599 GO:0045454

Feature Viewer

pLDDT	pTM	Quality
94.71	0.91	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F424121

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF08534

Redoxin

Redoxin

64

215

0.85

PF00578

AhpC-TSA

AhpC/TSA family

109

200

0.84

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map