F424113

General Info

Members Datasets Scaffolds Average Seq Length
366 239 732 194

Family's Representative Sequence

Representative Sequence 3300046461|Ga0495641_0064827|Ga0495641_0064827_839_1507
Length 222
Sequence MRSEGLAPGVRPAQLHGTAWQAGRVPSFTRAELESFRGVEVPDLVGPGVRLVFVGINPGLLTAARQIHFGNPANRFRPALVAAGLLEPPVDGAPGMSREDLDTLVMRGVGITNLVPFATARADELTKAQLVDGRTRLESFVAEHRPRVVAVLGITAYRAAFGRAGATAGRQPEPIGDAELWVVPNPSGLNAHESVASLAAAYAAPALAAGIELSARADRLDR

Samples

Sample ID Description Type Environment
1 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
132 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
133 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
134 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
135 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
136 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
149 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
161 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
166 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
183 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
212 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
223 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
225 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
229 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
230 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
231 2643221615 Nocardioides sp. Root224 Isolate Unclassified
232 2643221641 Nocardioides sp. Root122 Isolate Unclassified
233 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
234 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
235 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
236 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
237 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
238 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
239 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.99
Metatranscriptomes 0
Isolates 3.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.1
Nodule 0
Rhizoplane 8.2
Rhizosphere 81.69
Stem 0
Stem Tuber 0
Unclassified 3.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495641_0064827 3300046461 Bacteria 1645
2 Ga0070676_10402915 3300005328 Bacteria 952
3 Ga0070683_100009795 3300005329 Bacteria 8210
4 Ga0070683_100047962 3300005329 Bacteria 3948
5 Ga0070683_100097521 3300005329 Bacteria 2765
6 Ga0070683_100390418 3300005329 Bacteria 1327
7 Ga0070690_100301034 3300005330 Bacteria 1150
8 Ga0070677_10000011 3300005333 Bacteria 60102
9 Ga0070680_100067352 3300005336 Bacteria 2937
10 Ga0070682_100000028 3300005337 Bacteria 185177
11 Ga0070682_100011622 3300005337 Bacteria 5034
12 Ga0070682_100047900 3300005337 Bacteria 2659
13 Ga0068868_100142578 3300005338 Bacteria 1968
14 Ga0070660_100121156 3300005339 Bacteria 2088
15 Ga0070691_10082828 3300005341 Bacteria 1573
16 Ga0070687_100033084 3300005343 Bacteria 2549
17 Ga0070692_10033858 3300005345 Bacteria 2577
18 Ga0070675_100128459 3300005354 Bacteria 2158
19 Ga0070671_100844261 3300005355 Bacteria 799
20 Ga0070674_100008255 3300005356 Bacteria 6189
21 Ga0070674_100514683 3300005356 Bacteria 999
22 Ga0070673_100173642 3300005364 Bacteria 1841
23 Ga0070659_100085246 3300005366 Bacteria 2527
24 Ga0070667_100041944 3300005367 Bacteria 3838
25 Ga0070700_100001760 3300005441 Bacteria 10895
26 Ga0070700_100241176 3300005441 Bacteria 1292
27 Ga0070663_100170701 3300005455 Bacteria 1681
28 Ga0070663_100278134 3300005455 Bacteria 1333
29 Ga0070678_100359664 3300005456 Bacteria 1254
30 Ga0070662_100097250 3300005457 Bacteria 2222
31 Ga0070681_10004765 3300005458 Bacteria 12998
32 Ga0068867_100049273 3300005459 Bacteria 3101
33 Ga0070685_10200867 3300005466 Bacteria 1296
34 Ga0070685_10542292 3300005466 Bacteria 829
35 Ga0070679_100000401 3300005530 Bacteria 36912
36 Ga0070684_100052874 3300005535 Bacteria 3533
37 Ga0070684_100430150 3300005535 Bacteria 1219
38 Ga0068853_100036852 3300005539 Bacteria 4160
39 Ga0068853_100180628 3300005539 Bacteria 1913
40 Ga0070672_100017595 3300005543 Bacteria 5148
41 Ga0070665_100000068 3300005548 Bacteria 204531
42 Ga0070665_101234298 3300005548 Bacteria 758
43 Ga0070704_100601230 3300005549 Bacteria 967
44 Ga0070664_100051880 3300005564 Bacteria 3473
45 Ga0070664_100111527 3300005564 Bacteria 2388
46 Ga0068857_100160858 3300005577 Bacteria 2037
47 Ga0068854_100000249 3300005578 Bacteria 36592
48 Ga0068854_100098383 3300005578 Bacteria 2189
49 Ga0068856_100008862 3300005614 Bacteria 9790
50 Ga0070702_100033616 3300005615 Bacteria 2821
51 Ga0070702_100142795 3300005615 Bacteria 1527
52 Ga0068852_100012240 3300005616 Bacteria 6503
53 Ga0068852_100136742 3300005616 Bacteria 2263
54 Ga0068859_100408936 3300005617 Bacteria 1453
55 Ga0068864_101418015 3300005618 Bacteria 697
56 Ga0068866_10024696 3300005718 Bacteria 2816
57 Ga0068861_100016911 3300005719 Bacteria 5171
58 Ga0068861_100127980 3300005719 Bacteria 2058
59 Ga0068851_10001089 3300005834 Bacteria 11783
60 Ga0068851_10042113 3300005834 Bacteria 2298
61 Ga0068870_10014530 3300005840 Bacteria 3720
62 Ga0068863_100000004 3300005841 Bacteria 272478
63 Ga0068858_100000012 3300005842 Bacteria 216931
64 Ga0068858_100220536 3300005842 Bacteria 1796
65 Ga0068862_100172010 3300005844 Bacteria 1940
66 Ga0081540_1000323 3300005983 Bacteria 49388
67 Ga0081540_1009793 3300005983 Bacteria 6559
68 Ga0081539_10023535 3300005985 Bacteria 4032
69 Ga0075365_10005083 3300006038 Bacteria 7063
70 Ga0075365_10032079 3300006038 Bacteria 3374
71 Ga0075368_10055297 3300006042 Bacteria 1582
72 Ga0075364_10037485 3300006051 Bacteria 3139
73 Ga0075364_10143504 3300006051 Bacteria 1607
74 Ga0075364_10720878 3300006051 Bacteria 680
75 Ga0097621_100099202 3300006237 Bacteria 2448
76 Ga0097621_100250721 3300006237 Bacteria 1550
77 Ga0075370_10156006 3300006353 Bacteria 1338
78 Ga0075428_100466026 3300006844 Bacteria 1353
79 Ga0068865_100006164 3300006881 Bacteria 7309
80 Ga0097620_100408920 3300006931 Bacteria 1453
81 Ga0111539_10054495 3300009094 Bacteria 4758
82 Ga0105245_10000295 3300009098 Bacteria 47700
83 Ga0105245_10004946 3300009098 Bacteria 11714
84 Ga0105245_10022328 3300009098 Bacteria 5554
85 Ga0105245_10059976 3300009098 Bacteria 3427
86 Ga0105243_10014780 3300009148 Bacteria 5905
87 Ga0105243_10552230 3300009148 Bacteria 1101
88 Ga0105241_10073517 3300009174 Bacteria 2660
89 Ga0105242_10127826 3300009176 Bacteria 2189
90 Ga0105248_10105368 3300009177 Bacteria 3179
91 Ga0105238_10116829 3300009551 Bacteria 2647
92 Ga0105238_10156663 3300009551 Bacteria 2253
93 Ga0105249_10227060 3300009553 Bacteria 1840
94 Ga0105028_101069 3300009993 Bacteria 2894
95 Ga0105239_10036665 3300010375 Bacteria 5381
96 Ga0105239_10335445 3300010375 Bacteria 1706
97 Ga0105239_10411045 3300010375 Bacteria 1532
98 Ga0105246_10001167 3300011119 Bacteria 15267
99 Ga0105246_10329240 3300011119 Bacteria 1244
100 Ga0105246_10597585 3300011119 Bacteria 953
101 Ga0157369_10255652 3300013105 Bacteria 1828
102 Ga0157374_10003256 3300013296 Bacteria 13641
103 Ga0163162_10040314 3300013306 Bacteria 4670
104 Ga0157372_10000956 3300013307 Bacteria 31481
105 Ga0157372_10015551 3300013307 Bacteria 8154
106 Ga0157372_10043671 3300013307 Bacteria 4964
107 Ga0157375_10072155 3300013308 Bacteria 3468
108 Ga0157375_10202272 3300013308 Bacteria 2142
109 Ga0157375_10755365 3300013308 Bacteria 1123
110 Ga0163163_10079668 3300014325 Bacteria 3274
111 Ga0163163_10113048 3300014325 Bacteria 2745
112 Ga0163163_10398306 3300014325 Bacteria 1435
113 Ga0163163_10410013 3300014325 Bacteria 1414
114 Ga0157380_10000028 3300014326 Bacteria 99836
115 Ga0157380_10000097 3300014326 Bacteria 48365
116 Ga0157380_10004844 3300014326 Bacteria 9374
117 Ga0157380_10145000 3300014326 Bacteria 2045
118 Ga0157377_10117664 3300014745 Bacteria 1606
119 Ga0157379_10010922 3300014968 Bacteria 7917
120 Ga0157379_10035530 3300014968 Bacteria 4444
121 Ga0163161_10033073 3300017792 Bacteria 3695
122 Ga0163161_10241932 3300017792 Bacteria 1404
123 Ga0163161_10345949 3300017792 Bacteria 1181
124 Ga0213875_10000545 3300021388 Bacteria 30871
125 Ga0207656_10000899 3300025321 Bacteria 9669
126 Ga0207656_10023010 3300025321 Bacteria 2505
127 Ga0207682_10000159 3300025893 Bacteria 30618
128 Ga0207688_10015453 3300025901 Bacteria 4140
129 Ga0207688_10081441 3300025901 Bacteria 1849
130 Ga0207688_10121703 3300025901 Bacteria 1523
131 Ga0207647_10184652 3300025904 Bacteria 1210
132 Ga0207647_10233877 3300025904 Bacteria 1057
133 Ga0207643_10182564 3300025908 Bacteria 1270
134 Ga0207705_10009390 3300025909 Bacteria 7111
135 Ga0207707_10017049 3300025912 Bacteria 6328
136 Ga0207660_10148943 3300025917 Bacteria 1796
137 Ga0207662_10057945 3300025918 Bacteria 2317
138 Ga0207657_10034493 3300025919 Bacteria 4549
139 Ga0207657_10058297 3300025919 Bacteria 3323
140 Ga0207657_10095965 3300025919 Bacteria 2467
141 Ga0207652_10000577 3300025921 Bacteria 36887
142 Ga0207687_10000578 3300025927 Bacteria 24764
143 Ga0207687_10003178 3300025927 Bacteria 11152
144 Ga0207687_10033522 3300025927 Bacteria 3484
145 Ga0207687_10140294 3300025927 Bacteria 1833
146 Ga0207690_10026930 3300025932 Bacteria 3628
147 Ga0207690_10094157 3300025932 Bacteria 2125
148 Ga0207690_10137698 3300025932 Bacteria 1795
149 Ga0207690_10426220 3300025932 Bacteria 1062
150 Ga0207706_10070211 3300025933 Bacteria 3081
151 Ga0207706_10155798 3300025933 Bacteria 2009
152 Ga0207686_10295115 3300025934 Bacteria 1202
153 Ga0207686_10380112 3300025934 Bacteria 1071
154 Ga0207709_10021930 3300025935 Bacteria 3619
155 Ga0207670_10172693 3300025936 Bacteria 1622
156 Ga0207670_10510145 3300025936 Bacteria 978
157 Ga0207669_10110325 3300025937 Bacteria 1842
158 Ga0207704_10027504 3300025938 Bacteria 3140
159 Ga0207704_10266493 3300025938 Bacteria 1294
160 Ga0207691_10005058 3300025940 Bacteria 12723
161 Ga0207691_10144820 3300025940 Bacteria 2092
162 Ga0207689_10048379 3300025942 Bacteria 3507
163 Ga0207661_10008067 3300025944 Bacteria 7509
164 Ga0207661_10025034 3300025944 Bacteria 4532
165 Ga0207661_10136291 3300025944 Bacteria 2108
166 Ga0207661_10139910 3300025944 Bacteria 2082
167 Ga0207661_10381901 3300025944 Bacteria 1275
168 Ga0207679_10025851 3300025945 Bacteria 4043
169 Ga0207667_10861105 3300025949 Bacteria 900
170 Ga0207712_10000037 3300025961 Bacteria 195906
171 Ga0207712_10030415 3300025961 Bacteria 3630
172 Ga0207640_10000114 3300025981 Bacteria 60718
173 Ga0207640_10009188 3300025981 Bacteria 5524
174 Ga0207658_10041813 3300025986 Bacteria 3321
175 Ga0207677_11080769 3300026023 Bacteria 731
176 Ga0207703_10000091 3300026035 Bacteria 105608
177 Ga0207703_10000126 3300026035 Bacteria 91860
178 Ga0207703_10524384 3300026035 Bacteria 1115
179 Ga0207639_10054668 3300026041 Bacteria 3052
180 Ga0207639_10478907 3300026041 Bacteria 1134
181 Ga0207708_10001728 3300026075 Bacteria 16118
182 Ga0207708_10019082 3300026075 Bacteria 5163
183 Ga0207702_10006884 3300026078 Bacteria 9743
184 Ga0207702_10222436 3300026078 Bacteria 1759
185 Ga0207641_10000698 3300026088 Bacteria 36133
186 Ga0207648_10016862 3300026089 Bacteria 6660
187 Ga0207648_10681108 3300026089 Bacteria 952
188 Ga0207676_10091361 3300026095 Bacteria 2501
189 Ga0207674_10011316 3300026116 Bacteria 10027
190 Ga0207675_100002793 3300026118 Bacteria 17155
191 Ga0207675_100430959 3300026118 Bacteria 1304
192 Ga0207683_10352978 3300026121 Bacteria 1350
193 Ga0207698_10108926 3300026142 Bacteria 2317
194 Ga0207428_10001212 3300027907 Bacteria 27686
195 Ga0268266_10000020 3300028379 Bacteria 527065
196 Ga0268265_10080798 3300028380 Bacteria 2565
197 Ga0268264_10110121 3300028381 Bacteria 2411
198 Ga0268264_10116156 3300028381 Bacteria 2352
199 Ga0307405_10378850 3300031731 Bacteria 1101
200 Ga0307405_11129518 3300031731 Bacteria 675
201 Ga0307410_10267120 3300031852 Bacteria 1337
202 Ga0307410_10415216 3300031852 Bacteria 1090
203 Ga0307406_10299582 3300031901 Bacteria 1235
204 Ga0307409_100164420 3300031995 Bacteria 1945
205 Ga0307409_100401492 3300031995 Bacteria 1309
206 Ga0307416_100024051 3300032002 Bacteria 4436
207 Ga0307415_100001496 3300032126 Bacteria 11208
208 Ga0307415_100179494 3300032126 Bacteria 1660
209 Ga0307415_100374384 3300032126 Bacteria 1207
210 Ga0316574_0009863 3300035398 Bacteria 5370
211 Ga0373931_0649407 3300035691 Bacteria 693
212 Ga0436364_0513584 3300037853 Bacteria 44658
213 Ga0451793_1164986 3300041452 Bacteria 761
214 Ga0451833_0082925 3300041491 Bacteria 873
215 Ga0451853_1178860 3300041512 Bacteria 2835
216 Ga0450906_030543 3300042145 Bacteria 953
217 Ga0439464_0008993 3300042439 Bacteria 2622
218 Ga0466969_0039887 3300044656 Bacteria 2356
219 Ga0466965_0052257 3300044683 Bacteria 2029
220 Ga0466966_0045858 3300044684 Bacteria 2793
221 Ga0466961_0021165 3300044693 Bacteria 4186
222 Ga0466963_0128361 3300044694 Bacteria 1749
223 Ga0451576_0264685 3300045051 Bacteria 1797
224 Ga0466958_0097518 3300045836 Bacteria 1824
225 Ga0466967_0030646 3300045976 Bacteria 4516
226 Ga0466967_0095425 3300045976 Bacteria 2710
227 Ga0466967_0765928 3300045976 Bacteria 957
228 Ga0495603_0001631 3300046455 Bacteria 13179
229 Ga0495591_085532 3300046458 Bacteria 798
230 Ga0495641_0000003 3300046461 Bacteria 242879
231 Ga0495639_0047307 3300046475 Bacteria 1948
232 Ga0495594_0000035 3300046499 Bacteria 61175
233 Ga0495616_0139803 3300046513 Unclassified 1103
234 Ga0495620_0000477 3300046515 Bacteria 26080
235 Ga0495620_0066136 3300046515 Bacteria 1490
236 Ga0495628_0054992 3300046516 Bacteria 3136
237 Ga0495628_0229409 3300046516 Bacteria 1392
238 Ga0495630_0000903 3300046517 Bacteria 20752
239 Ga0495663_0119525 3300046525 Unclassified 881
240 Ga0495586_0001701 3300046535 Bacteria 12041
241 Ga0495609_0152883 3300046538 Bacteria 981
242 Ga0495645_0057562 3300046543 Bacteria 2821
243 Ga0495622_0000171 3300046557 Bacteria 53421
244 Ga0495656_0000342 3300046615 Bacteria 15822
245 Ga0495599_0007615 3300046678 Bacteria 6575
246 Ga0495624_0000030 3300046690 Bacteria 91755
247 Ga0495670_0449322 3300046691 Unclassified 698
248 Ga0495649_0006497 3300046694 Bacteria 7276
249 Ga0495672_0036152 3300047320 Bacteria 3035
250 Ga0495676_0000283 3300047321 Bacteria 40939
251 Ga0495680_0004998 3300047322 Bacteria 12542
252 Ga0495679_010608 3300047446 Unclassified 3609
253 Ga0495685_086834 3300047447 Bacteria 1038
254 Ga0496101_0144176 3300048904 Bacteria 1818
255 Ga0496101_0799122 3300048904 Bacteria 744
256 Ga0496102_0088909 3300048905 Bacteria 2857
257 Ga0496102_0183254 3300048905 Bacteria 1973
258 Ga0496103_0017772 3300048906 Bacteria 4260
259 Ga0496104_0025108 3300048907 Bacteria 5491
260 Ga0496105_0009795 3300048908 Bacteria 7504
261 Ga0496106_0000049 3300048909 Bacteria 97550
262 Ga0496106_0221587 3300048909 Bacteria 1509
263 Ga0496107_0016293 3300048910 Bacteria 5216
264 Ga0496107_0034407 3300048910 Bacteria 3629
265 Ga0496107_0478091 3300048910 Bacteria 925
266 Ga0496108_0037012 3300048911 Bacteria 4063
267 Ga0496108_0039580 3300048911 Bacteria 3929
268 Ga0496108_0119423 3300048911 Bacteria 2260
269 Ga0496108_0237625 3300048911 Bacteria 1585
270 Ga0496109_0000006 3300048912 Bacteria 325513
271 Ga0496109_0011872 3300048912 Bacteria 7501
272 Ga0496109_0213681 3300048912 Bacteria 1814
273 Ga0496110_0000018 3300048913 Bacteria 79734
274 Ga0496110_0010056 3300048913 Bacteria 7680
275 Ga0496110_0024911 3300048913 Bacteria 5106
276 Ga0496110_0091470 3300048913 Bacteria 2722
277 Ga0496111_0000015 3300048914 Bacteria 77334
278 Ga0496111_0015844 3300048914 Bacteria 5184
279 Ga0496114_0002643 3300048917 Bacteria 13674
280 Ga0496114_0006091 3300048917 Bacteria 9495
281 Ga0496114_0038911 3300048917 Bacteria 3936
282 Ga0496115_0009641 3300048918 Bacteria 7184
283 Ga0496119_0004012 3300048922 Bacteria 14886
284 Ga0496120_0041932 3300048923 Bacteria 2676
285 Ga0496122_0000095 3300048925 Bacteria 200509
286 Ga0496123_0000100 3300048926 Bacteria 170019
287 Ga0496124_0007851 3300048927 Bacteria 11254
288 Ga0496124_0010327 3300048927 Bacteria 9472
289 Ga0496125_0045541 3300048928 Bacteria 3690
290 Ga0496125_0112180 3300048928 Bacteria 1971
291 Ga0496125_0358083 3300048928 Bacteria 868
292 Ga0496126_0052423 3300048929 Bacteria 3707
293 Ga0501034_0006176 3300049571 Bacteria 12915
294 Ga0501036_0147976 3300049572 Bacteria 1981
295 Ga0501037_0163320 3300049573 Bacteria 1587
296 Ga0501038_0083639 3300049574 Bacteria 2686
297 Ga0501039_0218366 3300049575 Unclassified 1499
298 Ga0501039_0340900 3300049575 Bacteria 1178
299 Ga0501041_0144481 3300049577 Unclassified 1484
300 Ga0501043_0647140 3300049579 Bacteria 777
301 Ga0501048_0071351 3300049582 Bacteria 2452
302 Ga0501067_0004038 3300049583 Bacteria 8097
303 Ga0501068_0013539 3300049584 Bacteria 4642
304 Ga0501068_0041548 3300049584 Unclassified 2764
305 Ga0501069_0009978 3300049585 Bacteria 5020
306 Ga0501069_0143142 3300049585 Bacteria 1372
307 Ga0501069_0419691 3300049585 Bacteria 793
308 Ga0501070_0021069 3300049586 Bacteria 5469
309 Ga0501071_0003196 3300049587 Bacteria 10203
310 Ga0501071_0018208 3300049587 Unclassified 4859
311 Ga0501071_0484397 3300049587 Bacteria 948
312 Ga0501072_0015765 3300049588 Bacteria 5793
313 Ga0501072_0023403 3300049588 Bacteria 4798
314 Ga0501072_0036107 3300049588 Bacteria 3874
315 Ga0501073_0027461 3300049589 Bacteria 4069
316 Ga0501074_0006159 3300049590 Bacteria 8662
317 Ga0501075_0001287 3300049591 Bacteria 16261
318 Ga0501075_0128495 3300049591 Unclassified 1930
319 Ga0501076_0186509 3300049592 Unclassified 1692
320 Ga0501076_1160328 3300049592 Bacteria 636
321 Ga0501077_0202947 3300049593 Bacteria 1259
322 Ga0501079_0059047 3300049741 Unclassified 2959
323 Ga0501079_0121094 3300049741 Bacteria 2035
324 Ga0501080_0065009 3300049742 Bacteria 3393
325 Ga0501081_0088348 3300049743 Unclassified 2177
326 Ga0501083_0095697 3300049744 Bacteria 1959
327 Ga0501045_0193861 3300049824 Bacteria 1514
328 nmdc:mga00v17_291805_c1 3300050491 Bacteria 1059
329 nmdc:mga00v17_325805_c1 3300050491 Bacteria 998
330 nmdc:mga0yw44_6063_c1 3300050492 Bacteria 5795
331 nmdc:mga0yw44_68719_c1 3300050492 Bacteria 2192
332 nmdc:mga0yw44_84388_c1 3300050492 Bacteria 1997
333 nmdc:mga07m45_63248_c1 3300050496 Unclassified 2098
334 nmdc:mga07m45_7500_c2 3300050496 Bacteria 3778
335 nmdc:mga05p37_10540_c1 3300050507 Bacteria 10961
336 nmdc:mga09592_10881_c1 3300050508 Bacteria 7404
337 nmdc:mga06r32_170963_c1 3300050510 Bacteria 2157
338 nmdc:mga08y16_152015_c1 3300050511 Bacteria 2406
339 nmdc:mga08y16_27181_c1 3300050511 Bacteria 6029
340 nmdc:mga0n895_634106_c1 3300050512 Bacteria 1069
341 nmdc:mga08x19_429761_c1 3300050514 Bacteria 928
342 nmdc:mga0a205_129044_c1 3300050515 Bacteria 2429
343 Ga0495601_0000260 3300053077 Bacteria 28505
344 Ga0495612_0003461 3300053078 Bacteria 6543
345 Ga0495655_0004572 3300053083 Bacteria 2376
346 Ga0495619_0000001 3300053085 Bacteria 586054
347 Ga0495619_0000075 3300053085 Bacteria 76341
348 Ga0500641_0008397 3300053096 Bacteria 3683
349 Ga0501084_0172522 3300054114 Bacteria 1825
350 Ga0501084_0755120 3300054114 Bacteria 819
351 Ga0501082_0048380 3300060353 Bacteria 3665
352 Ga0501082_0102676 3300060353 Bacteria 2473
353 Ga0501082_0136996 3300060353 Unclassified 2124
354 Ga0530510_0012505 3300061734 Bacteria 5962
355 Ga0530510_1069989 3300061734 Bacteria 618
356 2523386941 2523231044 Bacteria 6434991
357 2566991425 2565956761 Bacteria 6601618
358 2644091510 2643221615 Bacteria 5487866
359 2644229376 2643221641 Bacteria 4490190
360 2644321313 2643221657 Bacteria 5490246
361 2644457741 2643221681 Bacteria 3707866
362 2645722623 2643221961 Bacteria 3919167
363 2645725587 2643221962 Bacteria 3874254
364 2857484456 2857481737 Bacteria 4761446
365 2904538230 2904535858 Bacteria 6308016
366 8057347353 8057345674 Bacteria 4160394
367 Ga0495641_0064827
368 Ga0070676_10402915
369 Ga0070683_100009795
370 Ga0070683_100047962
371 Ga0070683_100097521
372 Ga0070683_100390418
373 Ga0070690_100301034
374 Ga0070677_10000011
375 Ga0070680_100067352
376 Ga0070682_100000028
377 Ga0070682_100011622
378 Ga0070682_100047900
379 Ga0068868_100142578
380 Ga0070660_100121156
381 Ga0070691_10082828
382 Ga0070687_100033084
383 Ga0070692_10033858
384 Ga0070675_100128459
385 Ga0070671_100844261
386 Ga0070674_100008255
387 Ga0070674_100514683
388 Ga0070673_100173642
389 Ga0070659_100085246
390 Ga0070667_100041944
391 Ga0070700_100001760
392 Ga0070700_100241176
393 Ga0070663_100170701
394 Ga0070663_100278134
395 Ga0070678_100359664
396 Ga0070662_100097250
397 Ga0070681_10004765
398 Ga0068867_100049273
399 Ga0070685_10200867
400 Ga0070685_10542292
401 Ga0070679_100000401
402 Ga0070684_100052874
403 Ga0070684_100430150
404 Ga0068853_100036852
405 Ga0068853_100180628
406 Ga0070672_100017595
407 Ga0070665_100000068
408 Ga0070665_101234298
409 Ga0070704_100601230
410 Ga0070664_100051880
411 Ga0070664_100111527
412 Ga0068857_100160858
413 Ga0068854_100000249
414 Ga0068854_100098383
415 Ga0068856_100008862
416 Ga0070702_100033616
417 Ga0070702_100142795
418 Ga0068852_100012240
419 Ga0068852_100136742
420 Ga0068859_100408936
421 Ga0068864_101418015
422 Ga0068866_10024696
423 Ga0068861_100016911
424 Ga0068861_100127980
425 Ga0068851_10001089
426 Ga0068851_10042113
427 Ga0068870_10014530
428 Ga0068863_100000004
429 Ga0068858_100000012
430 Ga0068858_100220536
431 Ga0068862_100172010
432 Ga0081540_1000323
433 Ga0081540_1009793
434 Ga0081539_10023535
435 Ga0075365_10005083
436 Ga0075365_10032079
437 Ga0075368_10055297
438 Ga0075364_10037485
439 Ga0075364_10143504
440 Ga0075364_10720878
441 Ga0097621_100099202
442 Ga0097621_100250721
443 Ga0075370_10156006
444 Ga0075428_100466026
445 Ga0068865_100006164
446 Ga0097620_100408920
447 Ga0111539_10054495
448 Ga0105245_10000295
449 Ga0105245_10004946
450 Ga0105245_10022328
451 Ga0105245_10059976
452 Ga0105243_10014780
453 Ga0105243_10552230
454 Ga0105241_10073517
455 Ga0105242_10127826
456 Ga0105248_10105368
457 Ga0105238_10116829
458 Ga0105238_10156663
459 Ga0105249_10227060
460 Ga0105028_101069
461 Ga0105239_10036665
462 Ga0105239_10335445
463 Ga0105239_10411045
464 Ga0105246_10001167
465 Ga0105246_10329240
466 Ga0105246_10597585
467 Ga0157369_10255652
468 Ga0157374_10003256
469 Ga0163162_10040314
470 Ga0157372_10000956
471 Ga0157372_10015551
472 Ga0157372_10043671
473 Ga0157375_10072155
474 Ga0157375_10202272
475 Ga0157375_10755365
476 Ga0163163_10079668
477 Ga0163163_10113048
478 Ga0163163_10398306
479 Ga0163163_10410013
480 Ga0157380_10000028
481 Ga0157380_10000097
482 Ga0157380_10004844
483 Ga0157380_10145000
484 Ga0157377_10117664
485 Ga0157379_10010922
486 Ga0157379_10035530
487 Ga0163161_10033073
488 Ga0163161_10241932
489 Ga0163161_10345949
490 Ga0213875_10000545
491 Ga0207656_10000899
492 Ga0207656_10023010
493 Ga0207682_10000159
494 Ga0207688_10015453
495 Ga0207688_10081441
496 Ga0207688_10121703
497 Ga0207647_10184652
498 Ga0207647_10233877
499 Ga0207643_10182564
500 Ga0207705_10009390
501 Ga0207707_10017049
502 Ga0207660_10148943
503 Ga0207662_10057945
504 Ga0207657_10034493
505 Ga0207657_10058297
506 Ga0207657_10095965
507 Ga0207652_10000577
508 Ga0207687_10000578
509 Ga0207687_10003178
510 Ga0207687_10033522
511 Ga0207687_10140294
512 Ga0207690_10026930
513 Ga0207690_10094157
514 Ga0207690_10137698
515 Ga0207690_10426220
516 Ga0207706_10070211
517 Ga0207706_10155798
518 Ga0207686_10295115
519 Ga0207686_10380112
520 Ga0207709_10021930
521 Ga0207670_10172693
522 Ga0207670_10510145
523 Ga0207669_10110325
524 Ga0207704_10027504
525 Ga0207704_10266493
526 Ga0207691_10005058
527 Ga0207691_10144820
528 Ga0207689_10048379
529 Ga0207661_10008067
530 Ga0207661_10025034
531 Ga0207661_10136291
532 Ga0207661_10139910
533 Ga0207661_10381901
534 Ga0207679_10025851
535 Ga0207667_10861105
536 Ga0207712_10000037
537 Ga0207712_10030415
538 Ga0207640_10000114
539 Ga0207640_10009188
540 Ga0207658_10041813
541 Ga0207677_11080769
542 Ga0207703_10000091
543 Ga0207703_10000126
544 Ga0207703_10524384
545 Ga0207639_10054668
546 Ga0207639_10478907
547 Ga0207708_10001728
548 Ga0207708_10019082
549 Ga0207702_10006884
550 Ga0207702_10222436
551 Ga0207641_10000698
552 Ga0207648_10016862
553 Ga0207648_10681108
554 Ga0207676_10091361
555 Ga0207674_10011316
556 Ga0207675_100002793
557 Ga0207675_100430959
558 Ga0207683_10352978
559 Ga0207698_10108926
560 Ga0207428_10001212
561 Ga0268266_10000020
562 Ga0268265_10080798
563 Ga0268264_10110121
564 Ga0268264_10116156
565 Ga0307405_10378850
566 Ga0307405_11129518
567 Ga0307410_10267120
568 Ga0307410_10415216
569 Ga0307406_10299582
570 Ga0307409_100164420
571 Ga0307409_100401492
572 Ga0307416_100024051
573 Ga0307415_100001496
574 Ga0307415_100179494
575 Ga0307415_100374384
576 Ga0316574_0009863
577 Ga0373931_0649407
578 Ga0436364_0513584
579 Ga0451793_1164986
580 Ga0451833_0082925
581 Ga0451853_1178860
582 Ga0450906_030543
583 Ga0439464_0008993
584 Ga0466969_0039887
585 Ga0466965_0052257
586 Ga0466966_0045858
587 Ga0466961_0021165
588 Ga0466963_0128361
589 Ga0451576_0264685
590 Ga0466958_0097518
591 Ga0466967_0030646
592 Ga0466967_0095425
593 Ga0466967_0765928
594 Ga0495603_0001631
595 Ga0495591_085532
596 Ga0495641_0000003
597 Ga0495639_0047307
598 Ga0495594_0000035
599 Ga0495616_0139803
600 Ga0495620_0000477
601 Ga0495620_0066136
602 Ga0495628_0054992
603 Ga0495628_0229409
604 Ga0495630_0000903
605 Ga0495663_0119525
606 Ga0495586_0001701
607 Ga0495609_0152883
608 Ga0495645_0057562
609 Ga0495622_0000171
610 Ga0495656_0000342
611 Ga0495599_0007615
612 Ga0495624_0000030
613 Ga0495670_0449322
614 Ga0495649_0006497
615 Ga0495672_0036152
616 Ga0495676_0000283
617 Ga0495680_0004998
618 Ga0495679_010608
619 Ga0495685_086834
620 Ga0496101_0144176
621 Ga0496101_0799122
622 Ga0496102_0088909
623 Ga0496102_0183254
624 Ga0496103_0017772
625 Ga0496104_0025108
626 Ga0496105_0009795
627 Ga0496106_0000049
628 Ga0496106_0221587
629 Ga0496107_0016293
630 Ga0496107_0034407
631 Ga0496107_0478091
632 Ga0496108_0037012
633 Ga0496108_0039580
634 Ga0496108_0119423
635 Ga0496108_0237625
636 Ga0496109_0000006
637 Ga0496109_0011872
638 Ga0496109_0213681
639 Ga0496110_0000018
640 Ga0496110_0010056
641 Ga0496110_0024911
642 Ga0496110_0091470
643 Ga0496111_0000015
644 Ga0496111_0015844
645 Ga0496114_0002643
646 Ga0496114_0006091
647 Ga0496114_0038911
648 Ga0496115_0009641
649 Ga0496119_0004012
650 Ga0496120_0041932
651 Ga0496122_0000095
652 Ga0496123_0000100
653 Ga0496124_0007851
654 Ga0496124_0010327
655 Ga0496125_0045541
656 Ga0496125_0112180
657 Ga0496125_0358083
658 Ga0496126_0052423
659 Ga0501034_0006176
660 Ga0501036_0147976
661 Ga0501037_0163320
662 Ga0501038_0083639
663 Ga0501039_0218366
664 Ga0501039_0340900
665 Ga0501041_0144481
666 Ga0501043_0647140
667 Ga0501048_0071351
668 Ga0501067_0004038
669 Ga0501068_0013539
670 Ga0501068_0041548
671 Ga0501069_0009978
672 Ga0501069_0143142
673 Ga0501069_0419691
674 Ga0501070_0021069
675 Ga0501071_0003196
676 Ga0501071_0018208
677 Ga0501071_0484397
678 Ga0501072_0015765
679 Ga0501072_0023403
680 Ga0501072_0036107
681 Ga0501073_0027461
682 Ga0501074_0006159
683 Ga0501075_0001287
684 Ga0501075_0128495
685 Ga0501076_0186509
686 Ga0501076_1160328
687 Ga0501077_0202947
688 Ga0501079_0059047
689 Ga0501079_0121094
690 Ga0501080_0065009
691 Ga0501081_0088348
692 Ga0501083_0095697
693 Ga0501045_0193861
694 nmdc:mga00v17_291805_c1
695 nmdc:mga00v17_325805_c1
696 nmdc:mga0yw44_6063_c1
697 nmdc:mga0yw44_68719_c1
698 nmdc:mga0yw44_84388_c1
699 nmdc:mga07m45_63248_c1
700 nmdc:mga07m45_7500_c2
701 nmdc:mga05p37_10540_c1
702 nmdc:mga09592_10881_c1
703 nmdc:mga06r32_170963_c1
704 nmdc:mga08y16_152015_c1
705 nmdc:mga08y16_27181_c1
706 nmdc:mga0n895_634106_c1
707 nmdc:mga08x19_429761_c1
708 nmdc:mga0a205_129044_c1
709 Ga0495601_0000260
710 Ga0495612_0003461
711 Ga0495655_0004572
712 Ga0495619_0000001
713 Ga0495619_0000075
714 Ga0500641_0008397
715 Ga0501084_0172522
716 Ga0501084_0755120
717 Ga0501082_0048380
718 Ga0501082_0102676
719 Ga0501082_0136996
720 Ga0530510_0012505
721 Ga0530510_1069989
722 2523386941
723 2566991425
724 2644091510
725 2644229376
726 2644321313
727 2644457741
728 2645722623
729 2645725587
730 2857484456
731 2904538230
732 8057347353

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

42

205

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mwj-assembly1.cif.gz_A crystal structure of a mug-dna pseudo substrate complex 0.9308 16 183
1mtl-assembly1.cif.gz_A non-productive mug-dna complex 0.9135 16 184
1mtl-assembly1.cif.gz_B non-productive mug-dna complex 0.9105 16 184
1mwj-assembly1.cif.gz_A crystal structure of a mug-dna pseudo substrate complex 0.9039 16 183
1mtl-assembly1.cif.gz_A non-productive mug-dna complex 0.9025 16 184
ID Description Score Start End Superfamily
1mtlA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9135 16 184 3.40.470.10
1mtlA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9025 16 184 3.40.470.10
3uobA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8648 16 187 3.40.470.10
af_Q9V4D8_761_956_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8504 1 190 3.40.470.10
af_Q9V4D8_761_956_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8463 1 190 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A3N0GPE4-F1-model_v4 Mismatch-specific DNA-glycosylase 0.9956 2 187 GO:0004844
GO:0006285
GO:0008263
AF-A0A5J6V750-F1-model_v4 Mismatch-specific DNA-glycosylase 0.9918 1 189 GO:0004844
GO:0006285
GO:0008263
AF-A0A4R5AAG0-F1-model_v4 Mismatch-specific DNA-glycosylase 0.9898 1 190 GO:0004844
GO:0006285
GO:0008263
AF-A0A7C8BMJ5-F1-model_v4 Mismatch-specific DNA-glycosylase 0.9897 1 189 GO:0004844
GO:0006285
GO:0008263
AF-A0A2E1GFG3-F1-model_v4 deleted 0.9884 1 187

Map