F424031

General Info

Members Datasets Scaffolds Average Seq Length
366 278 732 181

Family's Representative Sequence

Representative Sequence 3300025904|Ga0207647_10088462|Ga0207647_100884623
Length 220
Sequence MEPIAKLQAGTDDMPVNVAARDLEARLEALDGRDLYLWSVAILVGVVTLSALSAVGAYQLVRPALDHGHARWQEIAWNFPRDGWPAGRAFRCDSCGEGGTGVELYVRPKIGFCNCDTGVADDDEVDRVADLDLISEKFVPTEAGKVVRVADMKGRSRSYDLKMSDGSQHTAVGIALSHRCDLLVAVAQGRADADTMQRVALDYLASDAMHHWMMAALGGH

Samples

Sample ID Description Type Environment
1 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
47 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
50 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
52 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
53 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
71 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
74 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
75 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
77 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
78 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
79 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
80 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
83 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
91 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
92 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
93 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
94 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
108 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
109 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
112 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
113 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
114 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
117 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
129 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
156 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
171 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
172 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
173 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
174 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
175 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
176 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
177 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
178 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
179 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
180 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
181 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
182 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
183 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
184 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
185 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
186 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
187 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
188 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
189 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
190 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
191 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
192 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
193 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
194 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
195 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
196 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere
197 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
198 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
199 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
200 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
201 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
202 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
203 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
204 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
205 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
206 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
207 2922368715
208 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
209 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
210 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
211 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
212 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
213 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
214 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
215 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
216 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
217 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
218 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
219 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
220 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
221 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
222 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
223 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
224 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
225 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
226 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
227 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
228 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
229 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
230 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
231 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
232 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
233 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
234 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
235 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
236 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
237 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
238 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
239 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
240 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
241 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
242 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
243 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
244 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
245 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
246 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
247 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
248 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
249 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
250 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
251 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
252 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
253 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
254 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
255 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
256 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
257 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
258 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
259 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
260 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
261 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
262 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
263 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
264 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
265 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
266 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
267 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
268 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
269 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
270 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
271 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
272 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
273 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
274 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
275 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
276 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
277 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
278 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.53
Metatranscriptomes 0.27
Isolates 22.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.2
Nodule 21.31
Rhizoplane 3.55
Rhizosphere 56.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207647_10088462 3300025904 Bacteria 1849
2 JGI25406J46586_10000956 3300003203 Bacteria 13581
3 JGI25153J46596_10001998 3300003215 Bacteria 12054
4 rootH2_10200872 3300003320 Bacteria 1054
5 rootL2_10027218 3300003322 Bacteria 1330
6 rootL2_10132795 3300003322 Bacteria 1026
7 rootH1_10135775 3300003323 Bacteria 1034
8 Ga0065165_1001827 3300005262 Bacteria 20819
9 Ga0065165_1103617 3300005262 Bacteria 709
10 Ga0070683_100003663 3300005329 Bacteria 12524
11 Ga0070680_100354380 3300005336 Bacteria 1248
12 Ga0070668_100244849 3300005347 Bacteria 1486
13 Ga0070713_100112502 3300005436 Bacteria 2375
14 Ga0070663_100030326 3300005455 Bacteria 3704
15 Ga0070662_100165313 3300005457 Bacteria 1733
16 Ga0070681_10016302 3300005458 Bacteria 7414
17 Ga0070681_10253050 3300005458 Bacteria 1674
18 Ga0070681_10347492 3300005458 Bacteria 1393
19 Ga0068867_100372225 3300005459 Bacteria 1198
20 Ga0070706_101381029 3300005467 Bacteria 645
21 Ga0070698_100124179 3300005471 Bacteria 2539
22 Ga0070679_100063022 3300005530 Bacteria 3696
23 Ga0070679_100084486 3300005530 Bacteria 3162
24 Ga0070679_100118161 3300005530 Bacteria 2636
25 Ga0070679_100927220 3300005530 Bacteria 814
26 Ga0070679_101234261 3300005530 Bacteria 693
27 Ga0070684_100002732 3300005535 Bacteria 13046
28 Ga0070684_100035349 3300005535 Bacteria 4276
29 Ga0070684_100343944 3300005535 Bacteria 1371
30 Ga0070697_100523599 3300005536 Bacteria 1038
31 Ga0068853_100099598 3300005539 Bacteria 2568
32 Ga0068855_100882438 3300005563 Bacteria 946
33 Ga0068855_101165598 3300005563 Bacteria 803
34 Ga0070664_100573688 3300005564 Bacteria 1045
35 Ga0068854_100650516 3300005578 Bacteria 905
36 Ga0068852_100641859 3300005616 Bacteria 1069
37 Ga0068864_100215475 3300005618 Bacteria 1770
38 Ga0081455_10373295 3300005937 Bacteria 999
39 Ga0081540_1016372 3300005983 Bacteria 4642
40 Ga0070717_10836391 3300006028 Bacteria 838
41 Ga0075365_10176090 3300006038 Bacteria 1494
42 Ga0075369_10193517 3300006186 Bacteria 937
43 Ga0068871_100247219 3300006358 Bacteria 1553
44 Ga0075434_100086670 3300006871 Bacteria 3132
45 Ga0105240_10425617 3300009093 Bacteria 1491
46 Ga0105240_10537820 3300009093 Bacteria 1294
47 Ga0105247_10020411 3300009101 Bacteria 3983
48 Ga0105248_10113899 3300009177 Bacteria 3050
49 Ga0105249_10749636 3300009553 Bacteria 1038
50 Ga0105239_10840488 3300010375 Bacteria 1053
51 Ga0157370_10298821 3300013104 Bacteria 1486
52 Ga0157369_10008826 3300013105 Bacteria 11547
53 Ga0157369_10445074 3300013105 Bacteria 1342
54 Ga0157369_10525652 3300013105 Bacteria 1224
55 Ga0157369_11645643 3300013105 Bacteria 653
56 Ga0157374_10047448 3300013296 Bacteria 3983
57 Ga0157372_10635259 3300013307 Bacteria 1244
58 Ga0157372_11623024 3300013307 Bacteria 744
59 Ga0163163_10247221 3300014325 Bacteria 1834
60 Ga0157376_11042290 3300014969 Bacteria 842
61 Ga0206356_11742932 3300020070 Bacteria 821
62 Ga0213873_10023482 3300021358 Bacteria 1470
63 Ga0213872_10044316 3300021361 Bacteria 2025
64 Ga0213872_10290107 3300021361 Bacteria 681
65 Ga0213876_10161255 3300021384 Bacteria 1193
66 Ga0213871_10008284 3300021441 Bacteria 2285
67 Ga0209564_1006041 3300025295 Bacteria 6672
68 Ga0209758_1018886 3300025297 Bacteria 3354
69 Ga0209758_1069664 3300025297 Bacteria 1114
70 Ga0207426_1002293 3300025302 Bacteria 12619
71 Ga0209257_1066082 3300025304 Bacteria 968
72 Ga0207692_10100571 3300025898 Bacteria 1586
73 Ga0207707_10001660 3300025912 Bacteria 20546
74 Ga0207707_10006974 3300025912 Bacteria 9854
75 Ga0207707_10234152 3300025912 Bacteria 1598
76 Ga0207707_10245244 3300025912 Bacteria 1557
77 Ga0207707_10366701 3300025912 Bacteria 1239
78 Ga0207695_10429062 3300025913 Bacteria 1206
79 Ga0207660_10935626 3300025917 Bacteria 707
80 Ga0207652_10010980 3300025921 Bacteria 7302
81 Ga0207652_10661525 3300025921 Bacteria 934
82 Ga0207700_10094883 3300025928 Bacteria 2365
83 Ga0207706_10452040 3300025933 Bacteria 1111
84 Ga0207711_10216193 3300025941 Bacteria 1752
85 Ga0207661_10003335 3300025944 Bacteria 11139
86 Ga0207661_10064261 3300025944 Bacteria 2974
87 Ga0207667_10742120 3300025949 Bacteria 982
88 Ga0207667_11028976 3300025949 Bacteria 810
89 Ga0207668_10026980 3300025972 Bacteria 3737
90 Ga0207678_10057246 3300026067 Bacteria 3354
91 Ga0207702_11004362 3300026078 Bacteria 828
92 Ga0207648_10221584 3300026089 Bacteria 1681
93 Ga0207676_10299803 3300026095 Bacteria 1467
94 Ga0207698_10243398 3300026142 Bacteria 1641
95 Ga0265332_10002221 3300031238 Bacteria 9962
96 Ga0265339_10013613 3300031249 Bacteria 4926
97 Ga0307516_10475118 3300031730 Bacteria 905
98 Ga0373934_0002909 3300035086 Bacteria 6267
99 Ga0373944_0109741 3300035089 Bacteria 941
100 Ga0373923_0252668 3300035111 Bacteria 825
101 Ga0373936_0040001 3300035113 Bacteria 1877
102 Ga0373936_0258955 3300035113 Bacteria 778
103 Ga0373957_0088924 3300035120 Bacteria 1226
104 Ga0373943_0070927 3300035170 Bacteria 1764
105 Ga0373955_0144776 3300035172 Bacteria 1395
106 Ga0373924_0118194 3300035410 Bacteria 1149
107 Ga0373935_0019435 3300035692 Bacteria 4142
108 Ga0373927_0146411 3300035695 Bacteria 1546
109 Ga0373933_0196869 3300035724 Bacteria 1289
110 Ga0373933_0239683 3300035724 Bacteria 1166
111 Ga0373947_0047519 3300035725 Bacteria 2572
112 Ga0373947_0102669 3300035725 Bacteria 1798
113 Ga0373925_0161982 3300037068 Bacteria 1762
114 Ga0373925_0378654 3300037068 Bacteria 1152
115 Ga0395900_0030083 3300037418 Bacteria 5574
116 Ga0395898_0174144 3300037466 Bacteria 2057
117 Ga0395898_0838719 3300037466 Bacteria 859
118 Ga0395898_1138597 3300037466 Bacteria 713
119 Ga0436364_1241072 3300037853 Bacteria 2480
120 Ga0436365_0255481 3300039437 Bacteria 1468
121 Ga0436365_1528581 3300039437 Bacteria 1751
122 Ga0436360_1148948 3300039438 Bacteria 905
123 Ga0436360_1334781 3300039438 Bacteria 2285
124 Ga0436361_0198848 3300039447 Bacteria 793
125 Ga0436361_0464593 3300039447 Bacteria 849
126 Ga0436361_0862252 3300039447 Bacteria 2036
127 Ga0436361_1022555 3300039447 Bacteria 2760
128 Ga0436363_1042782 3300039450 Bacteria 5407
129 Ga0436362_0134504 3300039453 Bacteria 2150
130 Ga0466969_0027941 3300044656 Bacteria 2887
131 Ga0466966_0448521 3300044684 Bacteria 775
132 Ga0466961_0000897 3300044693 Bacteria 18504
133 Ga0466963_0235636 3300044694 Bacteria 1283
134 Ga0466960_0162286 3300044901 Bacteria 1201
135 Ga0466959_0004435 3300045049 Bacteria 9399
136 Ga0466959_0069505 3300045049 Bacteria 2551
137 Ga0466958_0393687 3300045836 Bacteria 894
138 Ga0495592_0133235 3300046454 Bacteria 1736
139 Ga0495592_0345579 3300046454 Bacteria 955
140 Ga0495603_0208896 3300046455 Bacteria 1128
141 Ga0495629_0007969 3300046459 Bacteria 7792
142 Ga0495629_0075141 3300046459 Bacteria 2360
143 Ga0495651_0027010 3300046462 Bacteria 4469
144 Ga0495653_0088004 3300046463 Bacteria 2280
145 Ga0495580_0013708 3300046472 Bacteria 6175
146 Ga0495582_0087080 3300046473 Bacteria 1739
147 Ga0495582_0127006 3300046473 Bacteria 1439
148 Ga0495639_0063131 3300046475 Bacteria 1700
149 Ga0495639_0098520 3300046475 Bacteria 1378
150 Ga0495639_0377813 3300046475 Bacteria 714
151 Ga0495607_0101879 3300046501 Bacteria 1537
152 Ga0495608_0097641 3300046511 Bacteria 1896
153 Ga0495608_0493158 3300046511 Bacteria 742
154 Ga0495628_0105757 3300046516 Bacteria 2168
155 Ga0495628_0239471 3300046516 Bacteria 1358
156 Ga0495631_0076470 3300046518 Bacteria 1445
157 Ga0495648_0035226 3300046524 Bacteria 3247
158 Ga0495648_0079709 3300046524 Bacteria 1868
159 Ga0495666_0241229 3300046526 Bacteria 825
160 Ga0495652_0004702 3300046529 Bacteria 13012
161 Ga0495652_0193245 3300046529 Bacteria 1551
162 Ga0495652_0495505 3300046529 Bacteria 848
163 Ga0495652_0592377 3300046529 Bacteria 757
164 Ga0495665_0078544 3300046531 Bacteria 1736
165 Ga0495640_0013358 3300046533 Bacteria 6239
166 Ga0495640_0029121 3300046533 Bacteria 3969
167 Ga0495587_0031425 3300046536 Bacteria 3215
168 Ga0495587_0054061 3300046536 Bacteria 2367
169 Ga0495587_0220400 3300046536 Bacteria 1070
170 Ga0495645_0068276 3300046543 Bacteria 2566
171 Ga0495645_0069362 3300046543 Bacteria 2545
172 Ga0495645_0479081 3300046543 Bacteria 781
173 Ga0495622_0025030 3300046557 Bacteria 2787
174 Ga0495634_0011719 3300046642 Bacteria 6375
175 Ga0495634_0174425 3300046642 Bacteria 1350
176 Ga0495625_0307411 3300046660 Bacteria 1013
177 Ga0495635_0016363 3300046663 Bacteria 5178
178 Ga0495635_0094742 3300046663 Bacteria 2041
179 Ga0495588_0024575 3300046674 Bacteria 2994
180 Ga0495588_0119558 3300046674 Bacteria 1389
181 Ga0495657_0010925 3300046675 Bacteria 6812
182 Ga0495657_0017036 3300046675 Bacteria 5281
183 Ga0495599_0008515 3300046678 Bacteria 6240
184 Ga0495599_0554889 3300046678 Bacteria 672
185 Ga0495623_0054800 3300046679 Bacteria 2515
186 Ga0495646_0061850 3300046680 Bacteria 2228
187 Ga0495646_0064544 3300046680 Bacteria 2170
188 Ga0495647_0037192 3300046681 Bacteria 1836
189 Ga0495613_0039815 3300046689 Bacteria 3483
190 Ga0495613_0059044 3300046689 Bacteria 2813
191 Ga0495613_0533051 3300046689 Bacteria 787
192 Ga0495624_0023255 3300046690 Bacteria 4088
193 Ga0495624_0048951 3300046690 Bacteria 2681
194 Ga0495624_0260452 3300046690 Bacteria 1048
195 Ga0495624_0330856 3300046690 Bacteria 917
196 Ga0495600_0002477 3300046809 Bacteria 10603
197 Ga0495600_0090783 3300046809 Bacteria 1992
198 Ga0495600_0518684 3300046809 Bacteria 731
199 Ga0495581_0021966 3300047315 Bacteria 3699
200 Ga0495581_0049008 3300047315 Bacteria 2439
201 Ga0495604_0076979 3300047317 Bacteria 2508
202 Ga0495674_0006663 3300047319 Bacteria 11066
203 Ga0495674_0083343 3300047319 Bacteria 2741
204 Ga0495674_0209664 3300047319 Bacteria 1614
205 Ga0495674_0516386 3300047319 Bacteria 954
206 Ga0495676_0028615 3300047321 Bacteria 4755
207 Ga0495676_0334833 3300047321 Bacteria 1014
208 Ga0495680_0001058 3300047322 Bacteria 30479
209 Ga0495675_0293693 3300047444 Bacteria 966
210 Ga0495684_0089430 3300047471 Bacteria 2333
211 Ga0495684_0242016 3300047471 Bacteria 1316
212 Ga0495593_0066748 3300047673 Bacteria 1874
213 Ga0495602_0033384 3300048088 Bacteria 4828
214 Ga0495602_0053074 3300048088 Bacteria 3593
215 Ga0495614_0049935 3300048089 Bacteria 1793
216 Ga0495614_0268134 3300048089 Bacteria 784
217 Ga0496100_0562224 3300048903 Bacteria 883
218 Ga0496101_0059985 3300048904 Bacteria 2759
219 Ga0496102_0718542 3300048905 Bacteria 922
220 Ga0496104_0001403 3300048907 Bacteria 20868
221 Ga0496104_0058026 3300048907 Bacteria 3663
222 Ga0496105_0003256 3300048908 Bacteria 11964
223 Ga0496105_0003429 3300048908 Bacteria 11732
224 Ga0496106_0036824 3300048909 Bacteria 3660
225 Ga0496107_0068714 3300048910 Bacteria 2571
226 Ga0496108_0426799 3300048911 Bacteria 1158
227 Ga0496113_0125530 3300048916 Bacteria 2009
228 Ga0496115_0200112 3300048918 Bacteria 1650
229 Ga0496115_0268827 3300048918 Bacteria 1401
230 Ga0496116_0039136 3300048919 Bacteria 3282
231 Ga0496118_0102284 3300048921 Bacteria 1932
232 Ga0496119_0011251 3300048922 Bacteria 7442
233 Ga0496119_0043790 3300048922 Bacteria 2825
234 Ga0496120_0002168 3300048923 Bacteria 20847
235 Ga0496121_0022709 3300048924 Bacteria 6072
236 Ga0496121_0036190 3300048924 Bacteria 4403
237 Ga0496122_0287229 3300048925 Bacteria 895
238 Ga0496124_0056917 3300048927 Bacteria 3296
239 Ga0496124_0624597 3300048927 Bacteria 696
240 Ga0496125_0203680 3300048928 Bacteria 1292
241 Ga0496125_0219444 3300048928 Bacteria 1227
242 Ga0496126_0033872 3300048929 Bacteria 4804
243 Ga0496126_0078583 3300048929 Bacteria 2923
244 Ga0495682_0111632 3300049460 Bacteria 980
245 Ga0501046_0088350 3300049580 Bacteria 2387
246 Ga0501070_0176594 3300049586 Bacteria 1758
247 Ga0501074_0101058 3300049590 Bacteria 2064
248 Ga0501080_0138020 3300049742 Bacteria 2255
249 Ga0501044_0151005 3300049823 Bacteria 2305
250 nmdc:mga03n38_554417_c1 3300050490 Bacteria 650
251 nmdc:mga0n895_49730_c1 3300050512 Bacteria 4109
252 Ga0495612_0121655 3300053078 Bacteria 1123
253 Ga0495655_0151595 3300053083 Bacteria 729
254 Ga0500578_0398430 3300053086 Bacteria 794
255 Ga0500647_0015778 3300053091 Bacteria 3460
256 Ga0500647_0018591 3300053091 Bacteria 3220
257 Ga0500566_0006555 3300053094 Bacteria 6901
258 Ga0500640_002276 3300053095 Bacteria 6281
259 Ga0500557_000038 3300053105 Bacteria 69178
260 Ga0500572_001553 3300053111 Bacteria 6144
261 Ga0500591_041541 3300053115 Bacteria 2186
262 Ga0500607_027031 3300053121 Bacteria 3186
263 Ga0500608_171719 3300053122 Bacteria 928
264 Ga0500614_006449 3300053123 Bacteria 2468
265 Ga0500614_024635 3300053123 Bacteria 1423
266 Ga0500642_0000231 3300053130 Bacteria 21800
267 Ga0500655_024660 3300053133 Bacteria 1139
268 Ga0500559_0001255 3300053136 Bacteria 14886
269 Ga0500559_0006971 3300053136 Bacteria 5052
270 Ga0500559_0032796 3300053136 Bacteria 2233
271 Ga0500603_000409 3300053150 Bacteria 11222
272 Ga0500620_191049 3300053155 Bacteria 702
273 Ga0500630_006718 3300053159 Bacteria 5640
274 Ga0500638_064511 3300053162 Bacteria 1756
275 Ga0500639_000155 3300053163 Bacteria 32949
276 Ga0500636_0000390 3300053177 Bacteria 24204
277 Ga0500636_0438117 3300053177 Bacteria 595
278 Ga0500637_0181498 3300053178 Bacteria 1206
279 Ga0500576_091530 3300053725 Bacteria 1262
280 Ga0500625_047083 3300053729 Bacteria 2007
281 Ga0500596_006082 3300053735 Bacteria 2070
282 Ga0500601_000227 3300053737 Bacteria 11147
283 Ga0500613_067402 3300053738 Bacteria 585
284 Ga0466962_0136831 3300061719 Bacteria 1186
285 2508694300 2508501042 Bacteria 8719808
286 2513892971 2513237141 Bacteria 8496279
287 2524438253 2524023205 Bacteria 8918781
288 2528853572 2528768022 Bacteria 10457665
289 2745077317 2744054633 Bacteria 8678936
290 2874631041 2874628541 Bacteria 8630250
291 2876765943 2876761206 Bacteria 10111113
292 2876766492 2876761206 Bacteria 10111113
293 2879102673 2879099564 Bacteria 10442239
294 2922363556 2922361189 Bacteria 7436256
295 2922370627
296 2929620195 2929615660 Bacteria 9193770
297 2929629508 2929624759 Bacteria 9339455
298 2932791553 2932784394 Bacteria 9704911
299 2932802271 2932801729 Bacteria 7987968
300 2932816815 2932809354 Bacteria 9135765
301 2932824008 2932818245 Bacteria 9955613
302 2932835456 2932828146 Bacteria 9745859
303 2933582112 2933577622 Bacteria 9116884
304 2935621198 2935616580 Bacteria 9032984
305 2935643482 2935638405 Bacteria 10015038
306 2935650535 2935648319 Bacteria 8801166
307 2935662977 2935656913 Bacteria 8965014
308 2935671195 2935665750 Bacteria 9571747
309 2935681202 2935675223 Bacteria 9928132
310 2935689459 2935684952 Bacteria 9590419
311 2935700032 2935694250 Bacteria 9291695
312 2935710758 2935703347 Bacteria 10242284
313 2935720710 2935713505 Bacteria 9608509
314 2935727979 2935722832 Bacteria 9608746
315 2935737425 2935732158 Bacteria 9706831
316 2935746514 2935741537 Bacteria 9707219
317 2935757481 2935750917 Bacteria 9590372
318 2935763858 2935760218 Bacteria 9817913
319 2935776599 2935769743 Bacteria 7878163
320 2935781415 2935777560 Bacteria 8077691
321 2935792511 2935785616 Bacteria 7962367
322 2935797980 2935793552 Bacteria 8012592
323 2935807836 2935801545 Bacteria 9301974
324 2935818259 2935810662 Bacteria 9401221
325 2935832999 2935827899 Bacteria 10038562
326 2935844329 2935837841 Bacteria 9454360
327 2935859609 2935855204 Bacteria 9035059
328 2935871326 2935864058 Bacteria 9784707
329 2935879069 2935873716 Bacteria 9632195
330 2935889488 2935883170 Bacteria 7964738
331 2935990792 2935984226 Bacteria 8302647
332 2935996712 2935992306 Bacteria 9802711
333 2936008588 2936002035 Bacteria 9362176
334 2936017109 2936011229 Bacteria 8801034
335 2936026756 2936019824 Bacteria 8804134
336 2936035499 2936028420 Bacteria 8965941
337 2936044923 2936037263 Bacteria 9446081
338 2936053648 2936046547 Bacteria 8903709
339 2936062723 2936055302 Bacteria 8785755
340 2940563695 2940556831 Bacteria 9590747
341 2941537060 2941531003 Bacteria 7653939
342 2941542661 2941538514 Bacteria 9402094
343 3005601371 3005594810 Bacteria 8716512
344 3005724064 3005718088 Bacteria 8283608
345 8006931708 8006926726 Bacteria 6749210
346 8016519558 8016511872 Bacteria 9921665
347 8016524804 8016522445 Bacteria 8156687
348 8016538373 8016530956 Bacteria 8155261
349 8016542654 8016539877 Bacteria 8155419
350 8016550620 8016548790 Bacteria 8155074
351 8016559043 8016557553 Bacteria 8154380
352 8016580721 8016575299 Bacteria 8154085
353 8016596998 8016595262 Bacteria 8149947
354 8016607904 8016603502 Bacteria 8731218
355 8016619687 8016613128 Bacteria 8794220
356 8016629927 8016622563 Bacteria 7999408
357 8016637271 8016630954 Bacteria 9217207
358 8017065967 8017057580 Bacteria 10023680
359 8019538043 8019530166 Bacteria 8155624
360 8019541937 8019538911 Bacteria 7872763
361 8019548861 8019547302 Bacteria 7996444
362 8019578683 8019576017 Bacteria 10049540
363 8019596720 8019586578 Bacteria 10212056
364 8019604969 8019597564 Bacteria 10041141
365 8019613564 8019608314 Bacteria 10042931
366 8055750052 8055742211 Bacteria 9226248
367 Ga0207647_10088462
368 JGI25406J46586_10000956
369 JGI25153J46596_10001998
370 rootH2_10200872
371 rootL2_10027218
372 rootL2_10132795
373 rootH1_10135775
374 Ga0065165_1001827
375 Ga0065165_1103617
376 Ga0070683_100003663
377 Ga0070680_100354380
378 Ga0070668_100244849
379 Ga0070713_100112502
380 Ga0070663_100030326
381 Ga0070662_100165313
382 Ga0070681_10016302
383 Ga0070681_10253050
384 Ga0070681_10347492
385 Ga0068867_100372225
386 Ga0070706_101381029
387 Ga0070698_100124179
388 Ga0070679_100063022
389 Ga0070679_100084486
390 Ga0070679_100118161
391 Ga0070679_100927220
392 Ga0070679_101234261
393 Ga0070684_100002732
394 Ga0070684_100035349
395 Ga0070684_100343944
396 Ga0070697_100523599
397 Ga0068853_100099598
398 Ga0068855_100882438
399 Ga0068855_101165598
400 Ga0070664_100573688
401 Ga0068854_100650516
402 Ga0068852_100641859
403 Ga0068864_100215475
404 Ga0081455_10373295
405 Ga0081540_1016372
406 Ga0070717_10836391
407 Ga0075365_10176090
408 Ga0075369_10193517
409 Ga0068871_100247219
410 Ga0075434_100086670
411 Ga0105240_10425617
412 Ga0105240_10537820
413 Ga0105247_10020411
414 Ga0105248_10113899
415 Ga0105249_10749636
416 Ga0105239_10840488
417 Ga0157370_10298821
418 Ga0157369_10008826
419 Ga0157369_10445074
420 Ga0157369_10525652
421 Ga0157369_11645643
422 Ga0157374_10047448
423 Ga0157372_10635259
424 Ga0157372_11623024
425 Ga0163163_10247221
426 Ga0157376_11042290
427 Ga0206356_11742932
428 Ga0213873_10023482
429 Ga0213872_10044316
430 Ga0213872_10290107
431 Ga0213876_10161255
432 Ga0213871_10008284
433 Ga0209564_1006041
434 Ga0209758_1018886
435 Ga0209758_1069664
436 Ga0207426_1002293
437 Ga0209257_1066082
438 Ga0207692_10100571
439 Ga0207707_10001660
440 Ga0207707_10006974
441 Ga0207707_10234152
442 Ga0207707_10245244
443 Ga0207707_10366701
444 Ga0207695_10429062
445 Ga0207660_10935626
446 Ga0207652_10010980
447 Ga0207652_10661525
448 Ga0207700_10094883
449 Ga0207706_10452040
450 Ga0207711_10216193
451 Ga0207661_10003335
452 Ga0207661_10064261
453 Ga0207667_10742120
454 Ga0207667_11028976
455 Ga0207668_10026980
456 Ga0207678_10057246
457 Ga0207702_11004362
458 Ga0207648_10221584
459 Ga0207676_10299803
460 Ga0207698_10243398
461 Ga0265332_10002221
462 Ga0265339_10013613
463 Ga0307516_10475118
464 Ga0373934_0002909
465 Ga0373944_0109741
466 Ga0373923_0252668
467 Ga0373936_0040001
468 Ga0373936_0258955
469 Ga0373957_0088924
470 Ga0373943_0070927
471 Ga0373955_0144776
472 Ga0373924_0118194
473 Ga0373935_0019435
474 Ga0373927_0146411
475 Ga0373933_0196869
476 Ga0373933_0239683
477 Ga0373947_0047519
478 Ga0373947_0102669
479 Ga0373925_0161982
480 Ga0373925_0378654
481 Ga0395900_0030083
482 Ga0395898_0174144
483 Ga0395898_0838719
484 Ga0395898_1138597
485 Ga0436364_1241072
486 Ga0436365_0255481
487 Ga0436365_1528581
488 Ga0436360_1148948
489 Ga0436360_1334781
490 Ga0436361_0198848
491 Ga0436361_0464593
492 Ga0436361_0862252
493 Ga0436361_1022555
494 Ga0436363_1042782
495 Ga0436362_0134504
496 Ga0466969_0027941
497 Ga0466966_0448521
498 Ga0466961_0000897
499 Ga0466963_0235636
500 Ga0466960_0162286
501 Ga0466959_0004435
502 Ga0466959_0069505
503 Ga0466958_0393687
504 Ga0495592_0133235
505 Ga0495592_0345579
506 Ga0495603_0208896
507 Ga0495629_0007969
508 Ga0495629_0075141
509 Ga0495651_0027010
510 Ga0495653_0088004
511 Ga0495580_0013708
512 Ga0495582_0087080
513 Ga0495582_0127006
514 Ga0495639_0063131
515 Ga0495639_0098520
516 Ga0495639_0377813
517 Ga0495607_0101879
518 Ga0495608_0097641
519 Ga0495608_0493158
520 Ga0495628_0105757
521 Ga0495628_0239471
522 Ga0495631_0076470
523 Ga0495648_0035226
524 Ga0495648_0079709
525 Ga0495666_0241229
526 Ga0495652_0004702
527 Ga0495652_0193245
528 Ga0495652_0495505
529 Ga0495652_0592377
530 Ga0495665_0078544
531 Ga0495640_0013358
532 Ga0495640_0029121
533 Ga0495587_0031425
534 Ga0495587_0054061
535 Ga0495587_0220400
536 Ga0495645_0068276
537 Ga0495645_0069362
538 Ga0495645_0479081
539 Ga0495622_0025030
540 Ga0495634_0011719
541 Ga0495634_0174425
542 Ga0495625_0307411
543 Ga0495635_0016363
544 Ga0495635_0094742
545 Ga0495588_0024575
546 Ga0495588_0119558
547 Ga0495657_0010925
548 Ga0495657_0017036
549 Ga0495599_0008515
550 Ga0495599_0554889
551 Ga0495623_0054800
552 Ga0495646_0061850
553 Ga0495646_0064544
554 Ga0495647_0037192
555 Ga0495613_0039815
556 Ga0495613_0059044
557 Ga0495613_0533051
558 Ga0495624_0023255
559 Ga0495624_0048951
560 Ga0495624_0260452
561 Ga0495624_0330856
562 Ga0495600_0002477
563 Ga0495600_0090783
564 Ga0495600_0518684
565 Ga0495581_0021966
566 Ga0495581_0049008
567 Ga0495604_0076979
568 Ga0495674_0006663
569 Ga0495674_0083343
570 Ga0495674_0209664
571 Ga0495674_0516386
572 Ga0495676_0028615
573 Ga0495676_0334833
574 Ga0495680_0001058
575 Ga0495675_0293693
576 Ga0495684_0089430
577 Ga0495684_0242016
578 Ga0495593_0066748
579 Ga0495602_0033384
580 Ga0495602_0053074
581 Ga0495614_0049935
582 Ga0495614_0268134
583 Ga0496100_0562224
584 Ga0496101_0059985
585 Ga0496102_0718542
586 Ga0496104_0001403
587 Ga0496104_0058026
588 Ga0496105_0003256
589 Ga0496105_0003429
590 Ga0496106_0036824
591 Ga0496107_0068714
592 Ga0496108_0426799
593 Ga0496113_0125530
594 Ga0496115_0200112
595 Ga0496115_0268827
596 Ga0496116_0039136
597 Ga0496118_0102284
598 Ga0496119_0011251
599 Ga0496119_0043790
600 Ga0496120_0002168
601 Ga0496121_0022709
602 Ga0496121_0036190
603 Ga0496122_0287229
604 Ga0496124_0056917
605 Ga0496124_0624597
606 Ga0496125_0203680
607 Ga0496125_0219444
608 Ga0496126_0033872
609 Ga0496126_0078583
610 Ga0495682_0111632
611 Ga0501046_0088350
612 Ga0501070_0176594
613 Ga0501074_0101058
614 Ga0501080_0138020
615 Ga0501044_0151005
616 nmdc:mga03n38_554417_c1
617 nmdc:mga0n895_49730_c1
618 Ga0495612_0121655
619 Ga0495655_0151595
620 Ga0500578_0398430
621 Ga0500647_0015778
622 Ga0500647_0018591
623 Ga0500566_0006555
624 Ga0500640_002276
625 Ga0500557_000038
626 Ga0500572_001553
627 Ga0500591_041541
628 Ga0500607_027031
629 Ga0500608_171719
630 Ga0500614_006449
631 Ga0500614_024635
632 Ga0500642_0000231
633 Ga0500655_024660
634 Ga0500559_0001255
635 Ga0500559_0006971
636 Ga0500559_0032796
637 Ga0500603_000409
638 Ga0500620_191049
639 Ga0500630_006718
640 Ga0500638_064511
641 Ga0500639_000155
642 Ga0500636_0000390
643 Ga0500636_0438117
644 Ga0500637_0181498
645 Ga0500576_091530
646 Ga0500625_047083
647 Ga0500596_006082
648 Ga0500601_000227
649 Ga0500613_067402
650 Ga0466962_0136831
651 2508694300
652 2513892971
653 2524438253
654 2528853572
655 2745077317
656 2874631041
657 2876765943
658 2876766492
659 2879102673
660 2922363556
661 2922370627
662 2929620195
663 2929629508
664 2932791553
665 2932802271
666 2932816815
667 2932824008
668 2932835456
669 2933582112
670 2935621198
671 2935643482
672 2935650535
673 2935662977
674 2935671195
675 2935681202
676 2935689459
677 2935700032
678 2935710758
679 2935720710
680 2935727979
681 2935737425
682 2935746514
683 2935757481
684 2935763858
685 2935776599
686 2935781415
687 2935792511
688 2935797980
689 2935807836
690 2935818259
691 2935832999
692 2935844329
693 2935859609
694 2935871326
695 2935879069
696 2935889488
697 2935990792
698 2935996712
699 2936008588
700 2936017109
701 2936026756
702 2936035499
703 2936044923
704 2936053648
705 2936062723
706 2940563695
707 2941537060
708 2941542661
709 3005601371
710 3005724064
711 8006931708
712 8016519558
713 8016524804
714 8016538373
715 8016542654
716 8016550620
717 8016559043
718 8016580721
719 8016596998
720 8016607904
721 8016619687
722 8016629927
723 8016637271
724 8017065967
725 8019538043
726 8019541937
727 8019548861
728 8019578683
729 8019596720
730 8019604969
731 8019613564
732 8055750052

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1viu-assembly2.cif.gz_D crystal structure of putative adp ribose pyrophosphatase 0.7439 93 132
3o61-assembly1.cif.gz_B structure of the e100a e.coli gdp-mannose hydrolase (yffh) in complex with gdp-mannose and mg++ 0.7392 93 132
3o61-assembly1.cif.gz_A structure of the e100a e.coli gdp-mannose hydrolase (yffh) in complex with gdp-mannose and mg++ 0.7236 93 132
3o52-assembly1.cif.gz_B structure of the e.coli gdp-mannose hydrolase (yffh) in complex with tartrate 0.7211 93 132
4ied-assembly4.cif.gz_D crystal structure of fus-1 (oxa-85), a class d beta-lactamase from fusobacterium nucleatum subsp. polymorphum 0.7054 102 161
ID Description Score Start End Superfamily
af_Q5BI42_1_825_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7906 110 148 3.40.50.410
3o69B00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7407 93 132 3.90.79.10
af_A0A0P0Y3G5_714_919_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.7162 110 136 1.10.510.10
af_Q9LDI9_5_132_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.699 93 132 3.10.450.50
4iedB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.6977 102 165 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A023XQW6-F1-model_v4 deleted 0.9403 63 176
AF-A0A023XQW6-F1-model_v4 deleted 0.9249 63 176
AF-A0A1Q5RMR1-F1-model_v4 Uncharacterized protein 0.9206 33 176
AF-A0A1Q5RMR1-F1-model_v4 Uncharacterized protein 0.9145 33 176
AF-A0A0E3VVD4-F1-model_v4 Uncharacterized protein 0.8972 7 176

Map