F423957
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 366 | 190 | 359 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300005614|Ga0068856_100411150|Ga0068856_1004111503 |
| Length | 204 |
| Sequence | MGLTAEQINAGLDVIAAREPAIARALSLAGYPPPRVRARGYITLLRTIVGQQVSVAAANSVWNKLETALGEITPEAVLAADFDTLRACGLSRQKQGYARSLSELVTSGEVMLEHLPEDDEEAIAQLTRIKGIGRWSAEIYLLFAEGRPDIFPAGDLAVQAGMGRILGLAERPSEKAIREVAEPWRPHRGAVTLLTWHCYNTAAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 3 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 4 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 5 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 6 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 7 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 8 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 9 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 51 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 52 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 53 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 54 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 55 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 56 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 57 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 58 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 112 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 113 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 114 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 115 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 116 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 117 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 118 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 119 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 120 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 121 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 122 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 123 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 124 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 125 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 126 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 127 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 128 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 129 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 130 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 131 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 132 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 133 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 134 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 135 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 136 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 137 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 158 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 159 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 160 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 161 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 171 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 175 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 176 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 177 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 178 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 179 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 180 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 183 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 184 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 185 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 186 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 187 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 188 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 189 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 190 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.09 |
| Metatranscriptomes | 0 |
| Isolates | 1.91 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.11 |
| Nodule | 0 |
| Rhizoplane | 0.82 |
| Rhizosphere | 87.16 |
| Stem | 0 |
| Stem Tuber | 0.27 |
| Unclassified | 1.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3634486 | 2162886007 | Bacteria | 25034 |
| 2 | JGI24033J26618_1005801 | 3300002155 | Bacteria | 1372 |
| 3 | Ga0055536_1012486 | 3300003781 | Bacteria | 3148 |
| 4 | Ga0055536_1035442 | 3300003781 | Bacteria | 1248 |
| 5 | Ga0055530_10005876 | 3300003791 | Bacteria | 5670 |
| 6 | Ga0055531_10007926 | 3300003794 | Bacteria | 5697 |
| 7 | Ga0055531_10008542 | 3300003794 | Bacteria | 5377 |
| 8 | Ga0065704_10070176 | 3300005289 | Bacteria | 138803 |
| 9 | Ga0065712_10161903 | 3300005290 | Bacteria | 1280 |
| 10 | Ga0065715_10003368 | 3300005293 | Bacteria | 5532 |
| 11 | Ga0070658_10007991 | 3300005327 | Bacteria | 8509 |
| 12 | Ga0070676_10001015 | 3300005328 | Bacteria | 13927 |
| 13 | Ga0070670_100001290 | 3300005331 | Bacteria | 19979 |
| 14 | Ga0070670_100009958 | 3300005331 | Bacteria | 8113 |
| 15 | Ga0070670_100488648 | 3300005331 | Bacteria | 1094 |
| 16 | Ga0070677_10004500 | 3300005333 | Bacteria | 4556 |
| 17 | Ga0070666_10124304 | 3300005335 | Bacteria | 1790 |
| 18 | Ga0070680_100346532 | 3300005336 | Bacteria | 1263 |
| 19 | Ga0070682_100178876 | 3300005337 | Bacteria | 1480 |
| 20 | Ga0070689_100159213 | 3300005340 | Bacteria | 1824 |
| 21 | Ga0070661_100148175 | 3300005344 | Bacteria | 1773 |
| 22 | Ga0070668_100028004 | 3300005347 | Bacteria | 4277 |
| 23 | Ga0070668_100238328 | 3300005347 | Bacteria | 1506 |
| 24 | Ga0070669_100015209 | 3300005353 | Bacteria | 5480 |
| 25 | Ga0070669_100017295 | 3300005353 | Bacteria | 5143 |
| 26 | Ga0070669_100941745 | 3300005353 | Bacteria | 739 |
| 27 | Ga0070671_100002289 | 3300005355 | Bacteria | 14780 |
| 28 | Ga0070671_100013854 | 3300005355 | Bacteria | 6505 |
| 29 | Ga0070671_100037249 | 3300005355 | Bacteria | 4033 |
| 30 | Ga0070674_100014313 | 3300005356 | Bacteria | 4931 |
| 31 | Ga0070674_100018281 | 3300005356 | Bacteria | 4428 |
| 32 | Ga0070674_100060786 | 3300005356 | Bacteria | 2635 |
| 33 | Ga0070673_100004100 | 3300005364 | Bacteria | 9176 |
| 34 | Ga0070659_100073017 | 3300005366 | Bacteria | 2731 |
| 35 | Ga0070659_100153589 | 3300005366 | Bacteria | 1879 |
| 36 | Ga0070667_100012450 | 3300005367 | Bacteria | 7037 |
| 37 | Ga0070667_101210747 | 3300005367 | Bacteria | 707 |
| 38 | Ga0070714_100123332 | 3300005435 | Bacteria | 2307 |
| 39 | Ga0070663_100021228 | 3300005455 | Bacteria | 4315 |
| 40 | Ga0070663_100039247 | 3300005455 | Bacteria | 3308 |
| 41 | Ga0070678_100015300 | 3300005456 | Bacteria | 4872 |
| 42 | Ga0070662_100002657 | 3300005457 | Bacteria | 11026 |
| 43 | Ga0070662_100012125 | 3300005457 | Bacteria | 5706 |
| 44 | Ga0070681_10138566 | 3300005458 | Bacteria | 2363 |
| 45 | Ga0068867_100017416 | 3300005459 | Bacteria | 5104 |
| 46 | Ga0070679_100240050 | 3300005530 | Bacteria | 1770 |
| 47 | Ga0070672_100018503 | 3300005543 | Bacteria | 5038 |
| 48 | Ga0070672_100223050 | 3300005543 | Bacteria | 1581 |
| 49 | Ga0070695_100065956 | 3300005545 | Bacteria | 2359 |
| 50 | Ga0070664_100188001 | 3300005564 | Bacteria | 1839 |
| 51 | Ga0068854_100006061 | 3300005578 | Bacteria | 7667 |
| 52 | Ga0068854_100114353 | 3300005578 | Bacteria | 2040 |
| 53 | Ga0068856_100411150 | 3300005614 | Bacteria | 1373 |
| 54 | Ga0068852_100455142 | 3300005616 | Bacteria | 1268 |
| 55 | Ga0068859_100044147 | 3300005617 | Bacteria | 4479 |
| 56 | Ga0068859_100189373 | 3300005617 | Bacteria | 2142 |
| 57 | Ga0068864_100062663 | 3300005618 | Bacteria | 3222 |
| 58 | Ga0068863_100016476 | 3300005841 | Bacteria | 7090 |
| 59 | Ga0068858_100078607 | 3300005842 | Bacteria | 3065 |
| 60 | Ga0068860_100119683 | 3300005843 | Bacteria | 2521 |
| 61 | Ga0068860_100219471 | 3300005843 | Bacteria | 1846 |
| 62 | Ga0068862_100013226 | 3300005844 | Bacteria | 6825 |
| 63 | Ga0068862_100023489 | 3300005844 | Bacteria | 5167 |
| 64 | Ga0068862_100455120 | 3300005844 | Bacteria | 1207 |
| 65 | Ga0075368_10004233 | 3300006042 | Bacteria | 4845 |
| 66 | Ga0075363_100024303 | 3300006048 | Bacteria | 3079 |
| 67 | Ga0075364_10253386 | 3300006051 | Bacteria | 1196 |
| 68 | Ga0075432_10001883 | 3300006058 | Bacteria | 6952 |
| 69 | Ga0075362_10001164 | 3300006177 | Bacteria | 8227 |
| 70 | Ga0075367_10001794 | 3300006178 | Bacteria | 9449 |
| 71 | Ga0075369_10020819 | 3300006186 | Bacteria | 2688 |
| 72 | Ga0075366_10181826 | 3300006195 | Bacteria | 1277 |
| 73 | Ga0075370_10095838 | 3300006353 | Bacteria | 1714 |
| 74 | Ga0075431_100012663 | 3300006847 | Bacteria | 8519 |
| 75 | Ga0097620_100044149 | 3300006931 | Bacteria | 4479 |
| 76 | Ga0097620_100189351 | 3300006931 | Bacteria | 2142 |
| 77 | Ga0111539_10699742 | 3300009094 | Bacteria | 1180 |
| 78 | Ga0105243_10139246 | 3300009148 | Bacteria | 2068 |
| 79 | Ga0105241_10043202 | 3300009174 | Bacteria | 3413 |
| 80 | Ga0105242_10272843 | 3300009176 | Bacteria | 1533 |
| 81 | Ga0105248_10016423 | 3300009177 | Bacteria | 8147 |
| 82 | Ga0105249_10013707 | 3300009553 | Bacteria | 7159 |
| 83 | Ga0105249_10015106 | 3300009553 | Bacteria | 6831 |
| 84 | Ga0105246_10021827 | 3300011119 | Bacteria | 4125 |
| 85 | Ga0157371_10413660 | 3300013102 | Bacteria | 988 |
| 86 | Ga0157378_11290063 | 3300013297 | Bacteria | 771 |
| 87 | Ga0157375_10675630 | 3300013308 | Bacteria | 1188 |
| 88 | Ga0157380_10007408 | 3300014326 | Bacteria | 7791 |
| 89 | Ga0157380_10044825 | 3300014326 | Bacteria | 3468 |
| 90 | Ga0157380_10334581 | 3300014326 | Bacteria | 1409 |
| 91 | Ga0163161_10006677 | 3300017792 | Bacteria | 7985 |
| 92 | Ga0209675_1000126 | 3300025291 | Bacteria | 104792 |
| 93 | Ga0209676_1000060 | 3300025292 | Bacteria | 338238 |
| 94 | Ga0209676_1000148 | 3300025292 | Bacteria | 172161 |
| 95 | Ga0209025_1006023 | 3300025294 | Bacteria | 9612 |
| 96 | Ga0209050_1000047 | 3300025298 | Bacteria | 380561 |
| 97 | Ga0209050_1008397 | 3300025298 | Bacteria | 5531 |
| 98 | Ga0209050_1014877 | 3300025298 | Bacteria | 3313 |
| 99 | Ga0209257_1005238 | 3300025304 | Bacteria | 9274 |
| 100 | Ga0209257_1006164 | 3300025304 | Bacteria | 7910 |
| 101 | Ga0207697_10003320 | 3300025315 | Bacteria | 8009 |
| 102 | Ga0207682_10002133 | 3300025893 | Bacteria | 8972 |
| 103 | Ga0207680_10301116 | 3300025903 | Bacteria | 1118 |
| 104 | Ga0207645_10002195 | 3300025907 | Bacteria | 15584 |
| 105 | Ga0207645_10027578 | 3300025907 | Bacteria | 3667 |
| 106 | Ga0207707_10034762 | 3300025912 | Bacteria | 4409 |
| 107 | Ga0207657_10575175 | 3300025919 | Bacteria | 880 |
| 108 | Ga0207652_10056943 | 3300025921 | Bacteria | 3366 |
| 109 | Ga0207652_10275055 | 3300025921 | Bacteria | 1519 |
| 110 | Ga0207681_10052686 | 3300025923 | Bacteria | 2760 |
| 111 | Ga0207681_10481787 | 3300025923 | Bacteria | 1013 |
| 112 | Ga0207681_10625715 | 3300025923 | Bacteria | 891 |
| 113 | Ga0207650_10013803 | 3300025925 | Bacteria | 5601 |
| 114 | Ga0207659_10000660 | 3300025926 | Bacteria | 20395 |
| 115 | Ga0207659_10530343 | 3300025926 | Bacteria | 999 |
| 116 | Ga0207644_10004854 | 3300025931 | Bacteria | 8752 |
| 117 | Ga0207644_10015544 | 3300025931 | Bacteria | 5112 |
| 118 | Ga0207690_10213043 | 3300025932 | Bacteria | 1474 |
| 119 | Ga0207706_10006280 | 3300025933 | Bacteria | 11042 |
| 120 | Ga0207706_10010084 | 3300025933 | Bacteria | 8653 |
| 121 | Ga0207706_10675577 | 3300025933 | Bacteria | 883 |
| 122 | Ga0207709_10120541 | 3300025935 | Bacteria | 1770 |
| 123 | Ga0207670_10060765 | 3300025936 | Bacteria | 2576 |
| 124 | Ga0207670_10435228 | 3300025936 | Bacteria | 1055 |
| 125 | Ga0207669_10091271 | 3300025937 | Bacteria | 1984 |
| 126 | Ga0207691_10019054 | 3300025940 | Bacteria | 6498 |
| 127 | Ga0207691_10064907 | 3300025940 | Bacteria | 3306 |
| 128 | Ga0207691_10545715 | 3300025940 | Bacteria | 983 |
| 129 | Ga0207689_10025472 | 3300025942 | Bacteria | 4957 |
| 130 | Ga0207661_10195378 | 3300025944 | Bacteria | 1776 |
| 131 | Ga0207651_10023590 | 3300025960 | Bacteria | 3789 |
| 132 | Ga0207668_10015916 | 3300025972 | Bacteria | 4682 |
| 133 | Ga0207668_10024980 | 3300025972 | Bacteria | 3862 |
| 134 | Ga0207668_10150033 | 3300025972 | Bacteria | 1803 |
| 135 | Ga0207668_10270091 | 3300025972 | Bacteria | 1390 |
| 136 | Ga0207640_10027521 | 3300025981 | Bacteria | 3465 |
| 137 | Ga0207640_10082064 | 3300025981 | Bacteria | 2206 |
| 138 | Ga0207640_10151290 | 3300025981 | Bacteria | 1705 |
| 139 | Ga0207678_10017396 | 3300026067 | Bacteria | 6312 |
| 140 | Ga0207678_10029358 | 3300026067 | Bacteria | 4799 |
| 141 | Ga0207678_10050957 | 3300026067 | Bacteria | 3575 |
| 142 | Ga0207648_10042523 | 3300026089 | Bacteria | 3988 |
| 143 | Ga0207676_10043027 | 3300026095 | Bacteria | 3475 |
| 144 | Ga0207674_10047499 | 3300026116 | Bacteria | 4399 |
| 145 | Ga0207675_100017757 | 3300026118 | Bacteria | 6636 |
| 146 | Ga0207683_10005512 | 3300026121 | Bacteria | 10848 |
| 147 | Ga0207698_10402379 | 3300026142 | Bacteria | 1309 |
| 148 | Ga0209983_1027859 | 3300027665 | Bacteria | 1197 |
| 149 | Ga0209813_10000330 | 3300027866 | Bacteria | 12446 |
| 150 | Ga0268265_10006294 | 3300028380 | Bacteria | 8040 |
| 151 | Ga0268265_10165245 | 3300028380 | Bacteria | 1885 |
| 152 | Ga0268264_10100870 | 3300028381 | Bacteria | 2508 |
| 153 | Ga0268264_10103647 | 3300028381 | Bacteria | 2478 |
| 154 | Ga0268264_10694490 | 3300028381 | Bacteria | 1010 |
| 155 | Ga0307408_100030175 | 3300031548 | Bacteria | 3763 |
| 156 | Ga0307408_100210696 | 3300031548 | Bacteria | 1579 |
| 157 | Ga0307408_100313094 | 3300031548 | Bacteria | 1320 |
| 158 | Ga0307408_100808375 | 3300031548 | Bacteria | 851 |
| 159 | Ga0307405_10008034 | 3300031731 | Bacteria | 5320 |
| 160 | Ga0307405_10012974 | 3300031731 | Bacteria | 4432 |
| 161 | Ga0307405_10075045 | 3300031731 | Bacteria | 2189 |
| 162 | Ga0307405_10085056 | 3300031731 | Bacteria | 2078 |
| 163 | Ga0307405_10102298 | 3300031731 | Bacteria | 1924 |
| 164 | Ga0307405_10116314 | 3300031731 | Bacteria | 1821 |
| 165 | Ga0307405_10142586 | 3300031731 | Bacteria | 1673 |
| 166 | Ga0307405_10599709 | 3300031731 | Bacteria | 898 |
| 167 | Ga0307413_10010495 | 3300031824 | Bacteria | 4498 |
| 168 | Ga0307413_10014206 | 3300031824 | Bacteria | 4034 |
| 169 | Ga0307413_10146976 | 3300031824 | Bacteria | 1637 |
| 170 | Ga0307413_10358996 | 3300031824 | Bacteria | 1127 |
| 171 | Ga0307413_10386767 | 3300031824 | Bacteria | 1092 |
| 172 | Ga0307413_10482449 | 3300031824 | Bacteria | 991 |
| 173 | Ga0307413_10719509 | 3300031824 | Bacteria | 831 |
| 174 | Ga0307410_10034244 | 3300031852 | Bacteria | 3287 |
| 175 | Ga0307410_10050626 | 3300031852 | Bacteria | 2794 |
| 176 | Ga0307410_10065471 | 3300031852 | Bacteria | 2500 |
| 177 | Ga0307410_10109718 | 3300031852 | Bacteria | 1994 |
| 178 | Ga0307410_10137034 | 3300031852 | Bacteria | 1805 |
| 179 | Ga0307410_10259106 | 3300031852 | Bacteria | 1355 |
| 180 | Ga0307410_10344391 | 3300031852 | Bacteria | 1189 |
| 181 | Ga0307410_10735202 | 3300031852 | Bacteria | 834 |
| 182 | Ga0307406_10035278 | 3300031901 | Bacteria | 3075 |
| 183 | Ga0307406_10070664 | 3300031901 | Bacteria | 2286 |
| 184 | Ga0307406_10146969 | 3300031901 | Bacteria | 1676 |
| 185 | Ga0307406_10179918 | 3300031901 | Bacteria | 1538 |
| 186 | Ga0307406_10181387 | 3300031901 | Bacteria | 1533 |
| 187 | Ga0307407_10015031 | 3300031903 | Bacteria | 3810 |
| 188 | Ga0307407_10062444 | 3300031903 | Bacteria | 2181 |
| 189 | Ga0307407_10068151 | 3300031903 | Bacteria | 2106 |
| 190 | Ga0307407_10084812 | 3300031903 | Bacteria | 1926 |
| 191 | Ga0307407_10132194 | 3300031903 | Bacteria | 1598 |
| 192 | Ga0307407_10140501 | 3300031903 | Bacteria | 1557 |
| 193 | Ga0307407_10457949 | 3300031903 | Bacteria | 927 |
| 194 | Ga0307407_10519923 | 3300031903 | Bacteria | 875 |
| 195 | Ga0307412_10044005 | 3300031911 | Bacteria | 2911 |
| 196 | Ga0307412_10110541 | 3300031911 | Bacteria | 1961 |
| 197 | Ga0307412_10118745 | 3300031911 | Bacteria | 1900 |
| 198 | Ga0307412_10123197 | 3300031911 | Bacteria | 1870 |
| 199 | Ga0307412_10146392 | 3300031911 | Bacteria | 1737 |
| 200 | Ga0307412_10148598 | 3300031911 | Bacteria | 1726 |
| 201 | Ga0307412_10238513 | 3300031911 | Bacteria | 1405 |
| 202 | Ga0307412_10329247 | 3300031911 | Bacteria | 1218 |
| 203 | Ga0307412_10339244 | 3300031911 | Bacteria | 1202 |
| 204 | Ga0307412_10342365 | 3300031911 | Bacteria | 1197 |
| 205 | Ga0307409_100013350 | 3300031995 | Bacteria | 5282 |
| 206 | Ga0307409_100028852 | 3300031995 | Bacteria | 3961 |
| 207 | Ga0307409_100037285 | 3300031995 | Bacteria | 3583 |
| 208 | Ga0307409_100103523 | 3300031995 | Bacteria | 2368 |
| 209 | Ga0307409_100176109 | 3300031995 | Bacteria | 1888 |
| 210 | Ga0307409_100589676 | 3300031995 | Bacteria | 1097 |
| 211 | Ga0307409_100659528 | 3300031995 | Bacteria | 1041 |
| 212 | Ga0307409_100748896 | 3300031995 | Bacteria | 980 |
| 213 | Ga0307409_101029238 | 3300031995 | Bacteria | 842 |
| 214 | Ga0307416_100000337 | 3300032002 | Bacteria | 24339 |
| 215 | Ga0307416_100032798 | 3300032002 | Bacteria | 3930 |
| 216 | Ga0307416_100262578 | 3300032002 | Bacteria | 1689 |
| 217 | Ga0307416_100289407 | 3300032002 | Bacteria | 1621 |
| 218 | Ga0307416_100488787 | 3300032002 | Bacteria | 1292 |
| 219 | Ga0307416_100641972 | 3300032002 | Bacteria | 1145 |
| 220 | Ga0307416_100656040 | 3300032002 | Bacteria | 1134 |
| 221 | Ga0307416_100717029 | 3300032002 | Bacteria | 1090 |
| 222 | Ga0307416_100723005 | 3300032002 | Bacteria | 1086 |
| 223 | Ga0307416_100822709 | 3300032002 | Bacteria | 1025 |
| 224 | Ga0307416_100879250 | 3300032002 | Bacteria | 995 |
| 225 | Ga0307416_101799192 | 3300032002 | Bacteria | 716 |
| 226 | Ga0307414_10008399 | 3300032004 | Bacteria | 5854 |
| 227 | Ga0307414_10020774 | 3300032004 | Bacteria | 4101 |
| 228 | Ga0307414_10022464 | 3300032004 | Bacteria | 3979 |
| 229 | Ga0307414_10023337 | 3300032004 | Bacteria | 3922 |
| 230 | Ga0307414_10051414 | 3300032004 | Bacteria | 2861 |
| 231 | Ga0307414_10059601 | 3300032004 | Bacteria | 2696 |
| 232 | Ga0307414_10061541 | 3300032004 | Bacteria | 2659 |
| 233 | Ga0307414_10087113 | 3300032004 | Bacteria | 2306 |
| 234 | Ga0307414_10107446 | 3300032004 | Bacteria | 2114 |
| 235 | Ga0307414_10179245 | 3300032004 | Bacteria | 1702 |
| 236 | Ga0307414_10180463 | 3300032004 | Bacteria | 1697 |
| 237 | Ga0307414_10246351 | 3300032004 | Bacteria | 1482 |
| 238 | Ga0307414_10533127 | 3300032004 | Bacteria | 1044 |
| 239 | Ga0307414_10882230 | 3300032004 | Bacteria | 819 |
| 240 | Ga0307411_10029388 | 3300032005 | Bacteria | 3355 |
| 241 | Ga0307411_10073056 | 3300032005 | Bacteria | 2331 |
| 242 | Ga0307411_10080535 | 3300032005 | Bacteria | 2239 |
| 243 | Ga0307411_10095718 | 3300032005 | Bacteria | 2085 |
| 244 | Ga0307411_10137217 | 3300032005 | Bacteria | 1798 |
| 245 | Ga0307411_10263466 | 3300032005 | Bacteria | 1362 |
| 246 | Ga0307411_10288110 | 3300032005 | Bacteria | 1311 |
| 247 | Ga0307415_100048339 | 3300032126 | Bacteria | 2870 |
| 248 | Ga0307415_100082752 | 3300032126 | Bacteria | 2297 |
| 249 | Ga0307415_100158289 | 3300032126 | Bacteria | 1752 |
| 250 | Ga0307415_100165840 | 3300032126 | Bacteria | 1717 |
| 251 | Ga0307415_100176094 | 3300032126 | Bacteria | 1673 |
| 252 | Ga0307415_100241462 | 3300032126 | Bacteria | 1461 |
| 253 | Ga0307415_100329175 | 3300032126 | Bacteria | 1277 |
| 254 | Ga0307415_100427595 | 3300032126 | Bacteria | 1138 |
| 255 | Ga0307415_100513022 | 3300032126 | Bacteria | 1050 |
| 256 | Ga0307415_100517450 | 3300032126 | Bacteria | 1046 |
| 257 | Ga0307415_100582545 | 3300032126 | Bacteria | 993 |
| 258 | Ga0307415_100780287 | 3300032126 | Bacteria | 870 |
| 259 | Ga0307415_100810194 | 3300032126 | Bacteria | 856 |
| 260 | Ga0395899_0011901 | 3300037312 | Bacteria | 6662 |
| 261 | Ga0395899_0033927 | 3300037312 | Bacteria | 3832 |
| 262 | Ga0395900_0001169 | 3300037418 | Bacteria | 32753 |
| 263 | Ga0395900_0035553 | 3300037418 | Bacteria | 5131 |
| 264 | Ga0395900_0089282 | 3300037418 | Bacteria | 3168 |
| 265 | Ga0395900_0155944 | 3300037418 | Bacteria | 2332 |
| 266 | Ga0395898_0071186 | 3300037466 | Bacteria | 3360 |
| 267 | Ga0395898_0147998 | 3300037466 | Bacteria | 2247 |
| 268 | Ga0395905_0000818 | 3300037471 | Bacteria | 40874 |
| 269 | Ga0395905_0002628 | 3300037471 | Bacteria | 19724 |
| 270 | Ga0395905_0192401 | 3300037471 | Bacteria | 1913 |
| 271 | Ga0395905_0551634 | 3300037471 | Bacteria | 1054 |
| 272 | Ga0395905_0671599 | 3300037471 | Bacteria | 938 |
| 273 | Ga0395901_0002349 | 3300038443 | Bacteria | 19233 |
| 274 | Ga0395901_0033788 | 3300038443 | Bacteria | 5281 |
| 275 | Ga0395901_0037352 | 3300038443 | Bacteria | 5023 |
| 276 | Ga0395901_0113667 | 3300038443 | Bacteria | 2843 |
| 277 | Ga0395901_0129106 | 3300038443 | Bacteria | 2657 |
| 278 | Ga0436365_1315168 | 3300039437 | Bacteria | 940 |
| 279 | Ga0439445_0005947 | 3300042004 | Bacteria | 2795 |
| 280 | Ga0439462_0000170 | 3300042015 | Bacteria | 10898 |
| 281 | Ga0451577_0268277 | 3300042876 | Bacteria | 1546 |
| 282 | Ga0466969_0059563 | 3300044656 | Bacteria | 1857 |
| 283 | Ga0453684_0115264 | 3300044712 | Bacteria | 3256 |
| 284 | Ga0466970_0076298 | 3300044765 | Bacteria | 1806 |
| 285 | Ga0466957_0151725 | 3300044842 | Bacteria | 1499 |
| 286 | Ga0466967_0866353 | 3300045976 | Bacteria | 898 |
| 287 | Ga0495638_0012558 | 3300046460 | Bacteria | 5798 |
| 288 | Ga0495596_0054551 | 3300046500 | Bacteria | 1563 |
| 289 | Ga0495583_0000248 | 3300046506 | Bacteria | 89173 |
| 290 | Ga0495583_0004867 | 3300046506 | Bacteria | 9380 |
| 291 | Ga0495643_0059771 | 3300046522 | Bacteria | 2025 |
| 292 | Ga0495663_0002307 | 3300046525 | Bacteria | 5768 |
| 293 | Ga0495663_0031795 | 3300046525 | Bacteria | 1569 |
| 294 | Ga0495642_0006249 | 3300046528 | Bacteria | 4571 |
| 295 | Ga0495598_0016247 | 3300046537 | Bacteria | 1896 |
| 296 | Ga0495621_0000162 | 3300046539 | Bacteria | 14957 |
| 297 | Ga0495621_0006043 | 3300046539 | Bacteria | 3515 |
| 298 | Ga0495621_0025677 | 3300046539 | Bacteria | 1981 |
| 299 | Ga0495668_0000024 | 3300046616 | Bacteria | 359469 |
| 300 | Ga0495668_0013175 | 3300046616 | Bacteria | 4889 |
| 301 | Ga0495611_0145838 | 3300046648 | Bacteria | 1105 |
| 302 | Ga0495625_0009967 | 3300046660 | Bacteria | 7903 |
| 303 | Ga0495625_0018105 | 3300046660 | Bacteria | 5507 |
| 304 | Ga0495625_0292191 | 3300046660 | Bacteria | 1045 |
| 305 | Ga0495625_0365959 | 3300046660 | Bacteria | 908 |
| 306 | Ga0495625_0406142 | 3300046660 | Bacteria | 850 |
| 307 | Ga0495659_0005610 | 3300046664 | Bacteria | 3952 |
| 308 | Ga0495659_0109862 | 3300046664 | Bacteria | 1076 |
| 309 | Ga0495661_0036795 | 3300046665 | Bacteria | 3061 |
| 310 | Ga0495669_0008652 | 3300046684 | Bacteria | 4283 |
| 311 | Ga0495669_0163507 | 3300046684 | Bacteria | 1057 |
| 312 | Ga0495670_0013454 | 3300046691 | Bacteria | 4025 |
| 313 | Ga0495670_0015655 | 3300046691 | Bacteria | 3727 |
| 314 | Ga0495670_0038953 | 3300046691 | Bacteria | 2370 |
| 315 | Ga0495670_0046715 | 3300046691 | Bacteria | 2163 |
| 316 | Ga0495670_0131577 | 3300046691 | Bacteria | 1304 |
| 317 | Ga0495671_0011227 | 3300046692 | Bacteria | 4940 |
| 318 | Ga0495677_0009974 | 3300047445 | Bacteria | 3495 |
| 319 | Ga0495686_0000986 | 3300047472 | Bacteria | 34762 |
| 320 | Ga0495615_0002923 | 3300048090 | Bacteria | 2806 |
| 321 | Ga0496101_0740210 | 3300048904 | Bacteria | 776 |
| 322 | Ga0496102_0170144 | 3300048905 | Bacteria | 2051 |
| 323 | Ga0496103_0169920 | 3300048906 | Bacteria | 1400 |
| 324 | Ga0496125_0207012 | 3300048928 | Bacteria | 1278 |
| 325 | Ga0496126_0508850 | 3300048929 | Bacteria | 961 |
| 326 | Ga0495682_0070177 | 3300049460 | Bacteria | 1261 |
| 327 | Ga0495682_0138415 | 3300049460 | Bacteria | 870 |
| 328 | Ga0501031_0289261 | 3300049568 | Bacteria | 1063 |
| 329 | Ga0501033_0058789 | 3300049570 | Bacteria | 2839 |
| 330 | Ga0501038_0082142 | 3300049574 | Bacteria | 2713 |
| 331 | Ga0501039_0014310 | 3300049575 | Bacteria | 6075 |
| 332 | Ga0501043_0022505 | 3300049579 | Bacteria | 4941 |
| 333 | Ga0501047_0131027 | 3300049581 | Bacteria | 2388 |
| 334 | Ga0501047_0281176 | 3300049581 | Bacteria | 1509 |
| 335 | Ga0501047_0315486 | 3300049581 | Bacteria | 1404 |
| 336 | Ga0501048_0312378 | 3300049582 | Bacteria | 1119 |
| 337 | Ga0501068_0268368 | 3300049584 | Bacteria | 1089 |
| 338 | Ga0501224_019023 | 3300049664 | Bacteria | 1023 |
| 339 | Ga0501035_0070196 | 3300049822 | Bacteria | 3103 |
| 340 | Ga0501044_0003561 | 3300049823 | Bacteria | 17529 |
| 341 | Ga0501044_0415910 | 3300049823 | Bacteria | 1255 |
| 342 | Ga0501045_0083884 | 3300049824 | Bacteria | 2351 |
| 343 | nmdc:mga03683_567_c1 | 3300050489 | Bacteria | 10622 |
| 344 | nmdc:mga03n38_68377_c1 | 3300050490 | Bacteria | 1638 |
| 345 | nmdc:mga0k408_55974_c1 | 3300050493 | Bacteria | 2288 |
| 346 | nmdc:mga06z11_107_c1 | 3300050494 | Bacteria | 34558 |
| 347 | nmdc:mga04h51_127_c1 | 3300050495 | Bacteria | 22206 |
| 348 | nmdc:mga07m45_90_c1 | 3300050496 | Bacteria | 34935 |
| 349 | nmdc:mga06r32_5150_c1 | 3300050510 | Bacteria | 11753 |
| 350 | nmdc:mga08y16_573471_c1 | 3300050511 | Bacteria | 1140 |
| 351 | nmdc:mga08y16_603301_c1 | 3300050511 | Bacteria | 1106 |
| 352 | nmdc:mga0sz30_960_c1 | 3300050516 | Bacteria | 10339 |
| 353 | Ga0500555_000466 | 3300053103 | Bacteria | 16783 |
| 354 | Ga0500592_002611 | 3300053116 | Bacteria | 2894 |
| 355 | Ga0500594_0004500 | 3300053118 | Bacteria | 3073 |
| 356 | Ga0500658_0118904 | 3300053134 | Bacteria | 1170 |
| 357 | Ga0500568_0055417 | 3300053139 | Bacteria | 1547 |
| 358 | Ga0500604_0014245 | 3300053151 | Bacteria | 2164 |
| 359 | Ga0500627_0000068 | 3300053158 | Bacteria | 44198 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037471 | Ga0395905_0671599 | Ga0395905_0671599_399_917 | 170 |
| 2 | 3300050489 | nmdc:mga03683_567_c1 | nmdc:mga03683_567_c1_361_945 | 194 |
| 3 | 3300050490 | nmdc:mga03n38_68377_c1 | nmdc:mga03n38_68377_c1_222_806 | 194 |
| 4 | 3300050493 | nmdc:mga0k408_55974_c1 | nmdc:mga0k408_55974_c1_855_1439 | 194 |
| 5 | 3300050494 | nmdc:mga06z11_107_c1 | nmdc:mga06z11_107_c1_16206_16790 | 194 |
| 6 | 3300050495 | nmdc:mga04h51_127_c1 | nmdc:mga04h51_127_c1_13198_13782 | 194 |
| 7 | 3300050496 | nmdc:mga07m45_90_c1 | nmdc:mga07m45_90_c1_29036_29620 | 194 |
| 8 | 3300050516 | nmdc:mga0sz30_960_c1 | nmdc:mga0sz30_960_c1_7874_8458 | 194 |
| 9 | 3300037418 | Ga0395900_0155944 | Ga0395900_0155944_1671_2288 | 196 |
| 10 | 3300037471 | Ga0395905_0192401 | Ga0395905_0192401_829_1446 | 196 |
| 11 | 3300032002 | Ga0307416_101799192 | Ga0307416_1017991921 | 197 |
| 12 | 3300005356 | Ga0070674_100060786 | Ga0070674_1000607864 | 200 |
| 13 | 3300014326 | Ga0157380_10044825 | Ga0157380_100448251 | 200 |
| 14 | 3300025926 | Ga0207659_10530343 | Ga0207659_105303431 | 200 |
| 15 | 3300025933 | Ga0207706_10675577 | Ga0207706_106755771 | 200 |
| 16 | 3300025937 | Ga0207669_10091271 | Ga0207669_100912714 | 200 |
| 17 | 3300050511 | nmdc:mga08y16_573471_c1 | nmdc:mga08y16_573471_c1_50_667 | 200 |
| 18 | iso_pu_bacteria | 2643221560 | 2643822476 | 201 |
| 19 | iso_pu_bacteria | 2643221563 | 2643833508 | 201 |
| 20 | iso_pu_bacteria | 2643221608 | 2644054435 | 201 |
| 21 | iso_pu_bacteria | 2852653556 | 2852656782 | 201 |
| 22 | iso_pu_bacteria | 2852680915 | 2852682017 | 201 |
| 23 | iso_pu_bacteria | 2885427238 | 2885427413 | 201 |
| 24 | iso_pu_bacteria | 8054302542 | 8054304982 | 201 |
| 25 | 3300005327 | Ga0070658_10007991 | Ga0070658_100079919 | 204 |
| 26 | 3300005435 | Ga0070714_100123332 | Ga0070714_1001233323 | 204 |
| 27 | 3300005614 | Ga0068856_100411150 | Ga0068856_1004111503 | 204 |
| 28 | 3300046660 | Ga0495625_0365959 | Ga0495625_0365959_11_625 | 204 |
| 29 | 3300046692 | Ga0495671_0011227 | Ga0495671_0011227_3347_3961 | 204 |
| 30 | 3300053118 | Ga0500594_0004500 | Ga0500594_0004500_2341_2955 | 204 |
| 31 | 2162886007 | SwRhRL2b_contig_3634486 | SwRhRL2b_0227.00006650 | 205 |
| 32 | 3300002155 | JGI24033J26618_1005801 | JGI24033J26618_10058012 | 205 |
| 33 | 3300003781 | Ga0055536_1012486 | Ga0055536_10124865 | 205 |
| 34 | 3300003781 | Ga0055536_1035442 | Ga0055536_10354421 | 205 |
| 35 | 3300003791 | Ga0055530_10005876 | Ga0055530_100058764 | 205 |
| 36 | 3300003794 | Ga0055531_10007926 | Ga0055531_100079265 | 205 |
| 37 | 3300003794 | Ga0055531_10008542 | Ga0055531_100085423 | 205 |
| 38 | 3300005289 | Ga0065704_10070176 | Ga0065704_1007017613 | 205 |
| 39 | 3300005290 | Ga0065712_10161903 | Ga0065712_101619032 | 205 |
| 40 | 3300005293 | Ga0065715_10003368 | Ga0065715_100033686 | 205 |
| 41 | 3300005328 | Ga0070676_10001015 | Ga0070676_1000101514 | 205 |
| 42 | 3300005331 | Ga0070670_100001290 | Ga0070670_10000129013 | 205 |
| 43 | 3300005331 | Ga0070670_100009958 | Ga0070670_1000099585 | 205 |
| 44 | 3300005331 | Ga0070670_100488648 | Ga0070670_1004886482 | 205 |
| 45 | 3300005333 | Ga0070677_10004500 | Ga0070677_100045003 | 205 |
| 46 | 3300005335 | Ga0070666_10124304 | Ga0070666_101243042 | 205 |
| 47 | 3300005336 | Ga0070680_100346532 | Ga0070680_1003465321 | 205 |
| 48 | 3300005337 | Ga0070682_100178876 | Ga0070682_1001788761 | 205 |
| 49 | 3300005340 | Ga0070689_100159213 | Ga0070689_1001592132 | 205 |
| 50 | 3300005344 | Ga0070661_100148175 | Ga0070661_1001481752 | 205 |
| 51 | 3300005347 | Ga0070668_100028004 | Ga0070668_1000280042 | 205 |
| 52 | 3300005347 | Ga0070668_100238328 | Ga0070668_1002383282 | 205 |
| 53 | 3300005353 | Ga0070669_100015209 | Ga0070669_1000152094 | 205 |
| 54 | 3300005353 | Ga0070669_100017295 | Ga0070669_1000172952 | 205 |
| 55 | 3300005353 | Ga0070669_100941745 | Ga0070669_1009417451 | 205 |
| 56 | 3300005355 | Ga0070671_100002289 | Ga0070671_10000228910 | 205 |
| 57 | 3300005355 | Ga0070671_100013854 | Ga0070671_1000138544 | 205 |
| 58 | 3300005355 | Ga0070671_100037249 | Ga0070671_1000372494 | 205 |
| 59 | 3300005356 | Ga0070674_100014313 | Ga0070674_1000143135 | 205 |
| 60 | 3300005356 | Ga0070674_100018281 | Ga0070674_1000182812 | 205 |
| 61 | 3300005364 | Ga0070673_100004100 | Ga0070673_1000041009 | 205 |
| 62 | 3300005366 | Ga0070659_100073017 | Ga0070659_1000730173 | 205 |
| 63 | 3300005366 | Ga0070659_100153589 | Ga0070659_1001535892 | 205 |
| 64 | 3300005367 | Ga0070667_100012450 | Ga0070667_1000124505 | 205 |
| 65 | 3300005367 | Ga0070667_101210747 | Ga0070667_1012107471 | 205 |
| 66 | 3300005455 | Ga0070663_100021228 | Ga0070663_1000212281 | 205 |
| 67 | 3300005455 | Ga0070663_100039247 | Ga0070663_1000392476 | 205 |
| 68 | 3300005456 | Ga0070678_100015300 | Ga0070678_1000153002 | 205 |
| 69 | 3300005457 | Ga0070662_100002657 | Ga0070662_1000026575 | 205 |
| 70 | 3300005457 | Ga0070662_100012125 | Ga0070662_1000121253 | 205 |
| 71 | 3300005458 | Ga0070681_10138566 | Ga0070681_101385662 | 205 |
| 72 | 3300005459 | Ga0068867_100017416 | Ga0068867_1000174164 | 205 |
| 73 | 3300005530 | Ga0070679_100240050 | Ga0070679_1002400502 | 205 |
| 74 | 3300005543 | Ga0070672_100018503 | Ga0070672_1000185035 | 205 |
| 75 | 3300005543 | Ga0070672_100223050 | Ga0070672_1002230502 | 205 |
| 76 | 3300005545 | Ga0070695_100065956 | Ga0070695_1000659562 | 205 |
| 77 | 3300005564 | Ga0070664_100188001 | Ga0070664_1001880012 | 205 |
| 78 | 3300005578 | Ga0068854_100006061 | Ga0068854_1000060614 | 205 |
| 79 | 3300005578 | Ga0068854_100114353 | Ga0068854_1001143532 | 205 |
| 80 | 3300005616 | Ga0068852_100455142 | Ga0068852_1004551422 | 205 |
| 81 | 3300005617 | Ga0068859_100044147 | Ga0068859_1000441471 | 205 |
| 82 | 3300005617 | Ga0068859_100189373 | Ga0068859_1001893733 | 205 |
| 83 | 3300005618 | Ga0068864_100062663 | Ga0068864_1000626636 | 205 |
| 84 | 3300005841 | Ga0068863_100016476 | Ga0068863_10001647611 | 205 |
| 85 | 3300005842 | Ga0068858_100078607 | Ga0068858_1000786073 | 205 |
| 86 | 3300005843 | Ga0068860_100119683 | Ga0068860_1001196832 | 205 |
| 87 | 3300005843 | Ga0068860_100219471 | Ga0068860_1002194712 | 205 |
| 88 | 3300005844 | Ga0068862_100013226 | Ga0068862_1000132267 | 205 |
| 89 | 3300005844 | Ga0068862_100023489 | Ga0068862_1000234899 | 205 |
| 90 | 3300005844 | Ga0068862_100455120 | Ga0068862_1004551201 | 205 |
| 91 | 3300006042 | Ga0075368_10004233 | Ga0075368_100042333 | 205 |
| 92 | 3300006048 | Ga0075363_100024303 | Ga0075363_1000243033 | 205 |
| 93 | 3300006051 | Ga0075364_10253386 | Ga0075364_102533862 | 205 |
| 94 | 3300006058 | Ga0075432_10001883 | Ga0075432_100018837 | 205 |
| 95 | 3300006177 | Ga0075362_10001164 | Ga0075362_100011642 | 205 |
| 96 | 3300006178 | Ga0075367_10001794 | Ga0075367_100017948 | 205 |
| 97 | 3300006186 | Ga0075369_10020819 | Ga0075369_100208192 | 205 |
| 98 | 3300006195 | Ga0075366_10181826 | Ga0075366_101818262 | 205 |
| 99 | 3300006353 | Ga0075370_10095838 | Ga0075370_100958382 | 205 |
| 100 | 3300006847 | Ga0075431_100012663 | Ga0075431_1000126639 | 205 |
| 101 | 3300006931 | Ga0097620_100044149 | Ga0097620_1000441491 | 205 |
| 102 | 3300006931 | Ga0097620_100189351 | Ga0097620_1001893513 | 205 |
| 103 | 3300009094 | Ga0111539_10699742 | Ga0111539_106997422 | 205 |
| 104 | 3300009148 | Ga0105243_10139246 | Ga0105243_101392463 | 205 |
| 105 | 3300009174 | Ga0105241_10043202 | Ga0105241_100432022 | 205 |
| 106 | 3300009176 | Ga0105242_10272843 | Ga0105242_102728432 | 205 |
| 107 | 3300009177 | Ga0105248_10016423 | Ga0105248_100164234 | 205 |
| 108 | 3300009553 | Ga0105249_10013707 | Ga0105249_100137079 | 205 |
| 109 | 3300009553 | Ga0105249_10015106 | Ga0105249_100151065 | 205 |
| 110 | 3300011119 | Ga0105246_10021827 | Ga0105246_100218278 | 205 |
| 111 | 3300013102 | Ga0157371_10413660 | Ga0157371_104136602 | 205 |
| 112 | 3300013297 | Ga0157378_11290063 | Ga0157378_112900631 | 205 |
| 113 | 3300013308 | Ga0157375_10675630 | Ga0157375_106756302 | 205 |
| 114 | 3300014326 | Ga0157380_10007408 | Ga0157380_100074085 | 205 |
| 115 | 3300014326 | Ga0157380_10334581 | Ga0157380_103345812 | 205 |
| 116 | 3300017792 | Ga0163161_10006677 | Ga0163161_100066773 | 205 |
| 117 | 3300025291 | Ga0209675_1000126 | Ga0209675_100012637 | 205 |
| 118 | 3300025292 | Ga0209676_1000060 | Ga0209676_1000060285 | 205 |
| 119 | 3300025292 | Ga0209676_1000148 | Ga0209676_1000148147 | 205 |
| 120 | 3300025294 | Ga0209025_1006023 | Ga0209025_10060235 | 205 |
| 121 | 3300025298 | Ga0209050_1000047 | Ga0209050_100004740 | 205 |
| 122 | 3300025298 | Ga0209050_1008397 | Ga0209050_10083974 | 205 |
| 123 | 3300025298 | Ga0209050_1014877 | Ga0209050_10148774 | 205 |
| 124 | 3300025304 | Ga0209257_1005238 | Ga0209257_10052385 | 205 |
| 125 | 3300025304 | Ga0209257_1006164 | Ga0209257_10061647 | 205 |
| 126 | 3300025315 | Ga0207697_10003320 | Ga0207697_100033206 | 205 |
| 127 | 3300025893 | Ga0207682_10002133 | Ga0207682_1000213310 | 205 |
| 128 | 3300025903 | Ga0207680_10301116 | Ga0207680_103011162 | 205 |
| 129 | 3300025907 | Ga0207645_10002195 | Ga0207645_100021956 | 205 |
| 130 | 3300025907 | Ga0207645_10027578 | Ga0207645_100275783 | 205 |
| 131 | 3300025912 | Ga0207707_10034762 | Ga0207707_100347624 | 205 |
| 132 | 3300025919 | Ga0207657_10575175 | Ga0207657_105751752 | 205 |
| 133 | 3300025921 | Ga0207652_10056943 | Ga0207652_100569435 | 205 |
| 134 | 3300025921 | Ga0207652_10275055 | Ga0207652_102750551 | 205 |
| 135 | 3300025923 | Ga0207681_10052686 | Ga0207681_100526862 | 205 |
| 136 | 3300025923 | Ga0207681_10481787 | Ga0207681_104817872 | 205 |
| 137 | 3300025923 | Ga0207681_10625715 | Ga0207681_106257151 | 205 |
| 138 | 3300025925 | Ga0207650_10013803 | Ga0207650_100138034 | 205 |
| 139 | 3300025926 | Ga0207659_10000660 | Ga0207659_100006604 | 205 |
| 140 | 3300025931 | Ga0207644_10004854 | Ga0207644_100048546 | 205 |
| 141 | 3300025931 | Ga0207644_10015544 | Ga0207644_100155444 | 205 |
| 142 | 3300025932 | Ga0207690_10213043 | Ga0207690_102130432 | 205 |
| 143 | 3300025933 | Ga0207706_10006280 | Ga0207706_100062806 | 205 |
| 144 | 3300025933 | Ga0207706_10010084 | Ga0207706_100100844 | 205 |
| 145 | 3300025935 | Ga0207709_10120541 | Ga0207709_101205412 | 205 |
| 146 | 3300025936 | Ga0207670_10060765 | Ga0207670_100607653 | 205 |
| 147 | 3300025936 | Ga0207670_10435228 | Ga0207670_104352282 | 205 |
| 148 | 3300025940 | Ga0207691_10019054 | Ga0207691_100190544 | 205 |
| 149 | 3300025940 | Ga0207691_10064907 | Ga0207691_100649076 | 205 |
| 150 | 3300025940 | Ga0207691_10545715 | Ga0207691_105457152 | 205 |
| 151 | 3300025942 | Ga0207689_10025472 | Ga0207689_100254722 | 205 |
| 152 | 3300025944 | Ga0207661_10195378 | Ga0207661_101953782 | 205 |
| 153 | 3300025960 | Ga0207651_10023590 | Ga0207651_100235904 | 205 |
| 154 | 3300025972 | Ga0207668_10015916 | Ga0207668_100159165 | 205 |
| 155 | 3300025972 | Ga0207668_10024980 | Ga0207668_100249802 | 205 |
| 156 | 3300025972 | Ga0207668_10150033 | Ga0207668_101500332 | 205 |
| 157 | 3300025972 | Ga0207668_10270091 | Ga0207668_102700912 | 205 |
| 158 | 3300025981 | Ga0207640_10027521 | Ga0207640_100275213 | 205 |
| 159 | 3300025981 | Ga0207640_10082064 | Ga0207640_100820643 | 205 |
| 160 | 3300025981 | Ga0207640_10151290 | Ga0207640_101512902 | 205 |
| 161 | 3300026067 | Ga0207678_10017396 | Ga0207678_100173967 | 205 |
| 162 | 3300026067 | Ga0207678_10029358 | Ga0207678_100293582 | 205 |
| 163 | 3300026067 | Ga0207678_10050957 | Ga0207678_100509572 | 205 |
| 164 | 3300026089 | Ga0207648_10042523 | Ga0207648_100425233 | 205 |
| 165 | 3300026095 | Ga0207676_10043027 | Ga0207676_100430272 | 205 |
| 166 | 3300026116 | Ga0207674_10047499 | Ga0207674_100474994 | 205 |
| 167 | 3300026118 | Ga0207675_100017757 | Ga0207675_1000177575 | 205 |
| 168 | 3300026121 | Ga0207683_10005512 | Ga0207683_100055128 | 205 |
| 169 | 3300026142 | Ga0207698_10402379 | Ga0207698_104023792 | 205 |
| 170 | 3300027665 | Ga0209983_1027859 | Ga0209983_10278591 | 205 |
| 171 | 3300027866 | Ga0209813_10000330 | Ga0209813_100003305 | 205 |
| 172 | 3300028380 | Ga0268265_10006294 | Ga0268265_100062946 | 205 |
| 173 | 3300028380 | Ga0268265_10165245 | Ga0268265_101652452 | 205 |
| 174 | 3300028381 | Ga0268264_10100870 | Ga0268264_101008703 | 205 |
| 175 | 3300028381 | Ga0268264_10103647 | Ga0268264_101036472 | 205 |
| 176 | 3300028381 | Ga0268264_10694490 | Ga0268264_106944902 | 205 |
| 177 | 3300031548 | Ga0307408_100030175 | Ga0307408_1000301752 | 205 |
| 178 | 3300031548 | Ga0307408_100210696 | Ga0307408_1002106962 | 205 |
| 179 | 3300031548 | Ga0307408_100313094 | Ga0307408_1003130942 | 205 |
| 180 | 3300031548 | Ga0307408_100808375 | Ga0307408_1008083752 | 205 |
| 181 | 3300031731 | Ga0307405_10008034 | Ga0307405_100080344 | 205 |
| 182 | 3300031731 | Ga0307405_10012974 | Ga0307405_100129746 | 205 |
| 183 | 3300031731 | Ga0307405_10075045 | Ga0307405_100750451 | 205 |
| 184 | 3300031731 | Ga0307405_10085056 | Ga0307405_100850562 | 205 |
| 185 | 3300031731 | Ga0307405_10102298 | Ga0307405_101022981 | 205 |
| 186 | 3300031731 | Ga0307405_10116314 | Ga0307405_101163142 | 205 |
| 187 | 3300031731 | Ga0307405_10142586 | Ga0307405_101425862 | 205 |
| 188 | 3300031731 | Ga0307405_10599709 | Ga0307405_105997091 | 205 |
| 189 | 3300031824 | Ga0307413_10010495 | Ga0307413_100104956 | 205 |
| 190 | 3300031824 | Ga0307413_10014206 | Ga0307413_100142062 | 205 |
| 191 | 3300031824 | Ga0307413_10146976 | Ga0307413_101469762 | 205 |
| 192 | 3300031824 | Ga0307413_10358996 | Ga0307413_103589962 | 205 |
| 193 | 3300031824 | Ga0307413_10386767 | Ga0307413_103867671 | 205 |
| 194 | 3300031824 | Ga0307413_10482449 | Ga0307413_104824492 | 205 |
| 195 | 3300031824 | Ga0307413_10719509 | Ga0307413_107195091 | 205 |
| 196 | 3300031852 | Ga0307410_10034244 | Ga0307410_100342444 | 205 |
| 197 | 3300031852 | Ga0307410_10050626 | Ga0307410_100506265 | 205 |
| 198 | 3300031852 | Ga0307410_10065471 | Ga0307410_100654713 | 205 |
| 199 | 3300031852 | Ga0307410_10109718 | Ga0307410_101097182 | 205 |
| 200 | 3300031852 | Ga0307410_10137034 | Ga0307410_101370342 | 205 |
| 201 | 3300031852 | Ga0307410_10259106 | Ga0307410_102591062 | 205 |
| 202 | 3300031852 | Ga0307410_10344391 | Ga0307410_103443912 | 205 |
| 203 | 3300031852 | Ga0307410_10735202 | Ga0307410_107352022 | 205 |
| 204 | 3300031901 | Ga0307406_10035278 | Ga0307406_100352781 | 205 |
| 205 | 3300031901 | Ga0307406_10070664 | Ga0307406_100706642 | 205 |
| 206 | 3300031901 | Ga0307406_10146969 | Ga0307406_101469692 | 205 |
| 207 | 3300031901 | Ga0307406_10179918 | Ga0307406_101799182 | 205 |
| 208 | 3300031901 | Ga0307406_10181387 | Ga0307406_101813872 | 205 |
| 209 | 3300031903 | Ga0307407_10015031 | Ga0307407_100150314 | 205 |
| 210 | 3300031903 | Ga0307407_10062444 | Ga0307407_100624442 | 205 |
| 211 | 3300031903 | Ga0307407_10068151 | Ga0307407_100681512 | 205 |
| 212 | 3300031903 | Ga0307407_10084812 | Ga0307407_100848123 | 205 |
| 213 | 3300031903 | Ga0307407_10132194 | Ga0307407_101321942 | 205 |
| 214 | 3300031903 | Ga0307407_10140501 | Ga0307407_101405012 | 205 |
| 215 | 3300031903 | Ga0307407_10457949 | Ga0307407_104579492 | 205 |
| 216 | 3300031903 | Ga0307407_10519923 | Ga0307407_105199232 | 205 |
| 217 | 3300031911 | Ga0307412_10044005 | Ga0307412_100440052 | 205 |
| 218 | 3300031911 | Ga0307412_10110541 | Ga0307412_101105411 | 205 |
| 219 | 3300031911 | Ga0307412_10118745 | Ga0307412_101187452 | 205 |
| 220 | 3300031911 | Ga0307412_10123197 | Ga0307412_101231972 | 205 |
| 221 | 3300031911 | Ga0307412_10146392 | Ga0307412_101463922 | 205 |
| 222 | 3300031911 | Ga0307412_10148598 | Ga0307412_101485982 | 205 |
| 223 | 3300031911 | Ga0307412_10238513 | Ga0307412_102385133 | 205 |
| 224 | 3300031911 | Ga0307412_10329247 | Ga0307412_103292471 | 205 |
| 225 | 3300031911 | Ga0307412_10339244 | Ga0307412_103392442 | 205 |
| 226 | 3300031911 | Ga0307412_10342365 | Ga0307412_103423652 | 205 |
| 227 | 3300031995 | Ga0307409_100013350 | Ga0307409_1000133504 | 205 |
| 228 | 3300031995 | Ga0307409_100028852 | Ga0307409_1000288522 | 205 |
| 229 | 3300031995 | Ga0307409_100037285 | Ga0307409_1000372855 | 205 |
| 230 | 3300031995 | Ga0307409_100103523 | Ga0307409_1001035232 | 205 |
| 231 | 3300031995 | Ga0307409_100176109 | Ga0307409_1001761092 | 205 |
| 232 | 3300031995 | Ga0307409_100589676 | Ga0307409_1005896762 | 205 |
| 233 | 3300031995 | Ga0307409_100659528 | Ga0307409_1006595282 | 205 |
| 234 | 3300031995 | Ga0307409_100748896 | Ga0307409_1007488962 | 205 |
| 235 | 3300031995 | Ga0307409_101029238 | Ga0307409_1010292382 | 205 |
| 236 | 3300032002 | Ga0307416_100000337 | Ga0307416_1000003376 | 205 |
| 237 | 3300032002 | Ga0307416_100032798 | Ga0307416_1000327983 | 205 |
| 238 | 3300032002 | Ga0307416_100262578 | Ga0307416_1002625782 | 205 |
| 239 | 3300032002 | Ga0307416_100289407 | Ga0307416_1002894072 | 205 |
| 240 | 3300032002 | Ga0307416_100488787 | Ga0307416_1004887872 | 205 |
| 241 | 3300032002 | Ga0307416_100641972 | Ga0307416_1006419722 | 205 |
| 242 | 3300032002 | Ga0307416_100656040 | Ga0307416_1006560402 | 205 |
| 243 | 3300032002 | Ga0307416_100717029 | Ga0307416_1007170292 | 205 |
| 244 | 3300032002 | Ga0307416_100723005 | Ga0307416_1007230052 | 205 |
| 245 | 3300032002 | Ga0307416_100822709 | Ga0307416_1008227092 | 205 |
| 246 | 3300032002 | Ga0307416_100879250 | Ga0307416_1008792502 | 205 |
| 247 | 3300032004 | Ga0307414_10008399 | Ga0307414_100083998 | 205 |
| 248 | 3300032004 | Ga0307414_10020774 | Ga0307414_100207743 | 205 |
| 249 | 3300032004 | Ga0307414_10022464 | Ga0307414_100224642 | 205 |
| 250 | 3300032004 | Ga0307414_10023337 | Ga0307414_100233373 | 205 |
| 251 | 3300032004 | Ga0307414_10051414 | Ga0307414_100514142 | 205 |
| 252 | 3300032004 | Ga0307414_10059601 | Ga0307414_100596012 | 205 |
| 253 | 3300032004 | Ga0307414_10061541 | Ga0307414_100615413 | 205 |
| 254 | 3300032004 | Ga0307414_10087113 | Ga0307414_100871134 | 205 |
| 255 | 3300032004 | Ga0307414_10107446 | Ga0307414_101074462 | 205 |
| 256 | 3300032004 | Ga0307414_10179245 | Ga0307414_101792451 | 205 |
| 257 | 3300032004 | Ga0307414_10180463 | Ga0307414_101804632 | 205 |
| 258 | 3300032004 | Ga0307414_10246351 | Ga0307414_102463512 | 205 |
| 259 | 3300032004 | Ga0307414_10533127 | Ga0307414_105331272 | 205 |
| 260 | 3300032004 | Ga0307414_10882230 | Ga0307414_108822301 | 205 |
| 261 | 3300032005 | Ga0307411_10029388 | Ga0307411_100293881 | 205 |
| 262 | 3300032005 | Ga0307411_10073056 | Ga0307411_100730562 | 205 |
| 263 | 3300032005 | Ga0307411_10080535 | Ga0307411_100805353 | 205 |
| 264 | 3300032005 | Ga0307411_10095718 | Ga0307411_100957183 | 205 |
| 265 | 3300032005 | Ga0307411_10137217 | Ga0307411_101372172 | 205 |
| 266 | 3300032005 | Ga0307411_10263466 | Ga0307411_102634663 | 205 |
| 267 | 3300032005 | Ga0307411_10288110 | Ga0307411_102881102 | 205 |
| 268 | 3300032126 | Ga0307415_100048339 | Ga0307415_1000483393 | 205 |
| 269 | 3300032126 | Ga0307415_100082752 | Ga0307415_1000827524 | 205 |
| 270 | 3300032126 | Ga0307415_100158289 | Ga0307415_1001582891 | 205 |
| 271 | 3300032126 | Ga0307415_100165840 | Ga0307415_1001658402 | 205 |
| 272 | 3300032126 | Ga0307415_100176094 | Ga0307415_1001760941 | 205 |
| 273 | 3300032126 | Ga0307415_100241462 | Ga0307415_1002414622 | 205 |
| 274 | 3300032126 | Ga0307415_100329175 | Ga0307415_1003291752 | 205 |
| 275 | 3300032126 | Ga0307415_100427595 | Ga0307415_1004275952 | 205 |
| 276 | 3300032126 | Ga0307415_100513022 | Ga0307415_1005130222 | 205 |
| 277 | 3300032126 | Ga0307415_100517450 | Ga0307415_1005174501 | 205 |
| 278 | 3300032126 | Ga0307415_100582545 | Ga0307415_1005825452 | 205 |
| 279 | 3300032126 | Ga0307415_100780287 | Ga0307415_1007802872 | 205 |
| 280 | 3300032126 | Ga0307415_100810194 | Ga0307415_1008101942 | 205 |
| 281 | 3300037312 | Ga0395899_0011901 | Ga0395899_0011901_3610_4227 | 205 |
| 282 | 3300037312 | Ga0395899_0033927 | Ga0395899_0033927_3060_3683 | 205 |
| 283 | 3300037418 | Ga0395900_0001169 | Ga0395900_0001169_25239_25862 | 205 |
| 284 | 3300037418 | Ga0395900_0035553 | Ga0395900_0035553_2133_2750 | 205 |
| 285 | 3300037418 | Ga0395900_0089282 | Ga0395900_0089282_745_1362 | 205 |
| 286 | 3300037466 | Ga0395898_0071186 | Ga0395898_0071186_2466_3083 | 205 |
| 287 | 3300037466 | Ga0395898_0147998 | Ga0395898_0147998_1324_1947 | 205 |
| 288 | 3300037471 | Ga0395905_0000818 | Ga0395905_0000818_17107_17730 | 205 |
| 289 | 3300037471 | Ga0395905_0002628 | Ga0395905_0002628_9498_10115 | 205 |
| 290 | 3300037471 | Ga0395905_0551634 | Ga0395905_0551634_421_1038 | 205 |
| 291 | 3300038443 | Ga0395901_0002349 | Ga0395901_0002349_13380_14003 | 205 |
| 292 | 3300038443 | Ga0395901_0033788 | Ga0395901_0033788_3433_4050 | 205 |
| 293 | 3300038443 | Ga0395901_0037352 | Ga0395901_0037352_3589_4206 | 205 |
| 294 | 3300038443 | Ga0395901_0113667 | Ga0395901_0113667_616_1233 | 205 |
| 295 | 3300038443 | Ga0395901_0129106 | Ga0395901_0129106_920_1537 | 205 |
| 296 | 3300039437 | Ga0436365_1315168 | Ga0436365_1315168_66_689 | 205 |
| 297 | 3300042004 | Ga0439445_0005947 | Ga0439445_0005947_288_908 | 205 |
| 298 | 3300042015 | Ga0439462_0000170 | Ga0439462_0000170_10143_10760 | 205 |
| 299 | 3300042876 | Ga0451577_0268277 | Ga0451577_0268277_40_657 | 205 |
| 300 | 3300044656 | Ga0466969_0059563 | Ga0466969_0059563_907_1524 | 205 |
| 301 | 3300044712 | Ga0453684_0115264 | Ga0453684_0115264_912_1529 | 205 |
| 302 | 3300044765 | Ga0466970_0076298 | Ga0466970_0076298_871_1488 | 205 |
| 303 | 3300044842 | Ga0466957_0151725 | Ga0466957_0151725_802_1419 | 205 |
| 304 | 3300045976 | Ga0466967_0866353 | Ga0466967_0866353_54_671 | 205 |
| 305 | 3300046460 | Ga0495638_0012558 | Ga0495638_0012558_1159_1803 | 205 |
| 306 | 3300046500 | Ga0495596_0054551 | Ga0495596_0054551_495_1115 | 205 |
| 307 | 3300046506 | Ga0495583_0000248 | Ga0495583_0000248_20003_20647 | 205 |
| 308 | 3300046506 | Ga0495583_0004867 | Ga0495583_0004867_2907_3530 | 205 |
| 309 | 3300046522 | Ga0495643_0059771 | Ga0495643_0059771_384_1001 | 205 |
| 310 | 3300046525 | Ga0495663_0002307 | Ga0495663_0002307_940_1560 | 205 |
| 311 | 3300046525 | Ga0495663_0031795 | Ga0495663_0031795_531_1151 | 205 |
| 312 | 3300046528 | Ga0495642_0006249 | Ga0495642_0006249_2854_3474 | 205 |
| 313 | 3300046537 | Ga0495598_0016247 | Ga0495598_0016247_21_644 | 205 |
| 314 | 3300046539 | Ga0495621_0000162 | Ga0495621_0000162_8481_9104 | 205 |
| 315 | 3300046539 | Ga0495621_0006043 | Ga0495621_0006043_1469_2089 | 205 |
| 316 | 3300046539 | Ga0495621_0025677 | Ga0495621_0025677_927_1544 | 205 |
| 317 | 3300046616 | Ga0495668_0000024 | Ga0495668_0000024_92242_92859 | 205 |
| 318 | 3300046616 | Ga0495668_0013175 | Ga0495668_0013175_4240_4863 | 205 |
| 319 | 3300046648 | Ga0495611_0145838 | Ga0495611_0145838_387_1031 | 205 |
| 320 | 3300046660 | Ga0495625_0009967 | Ga0495625_0009967_5586_6203 | 205 |
| 321 | 3300046660 | Ga0495625_0018105 | Ga0495625_0018105_4469_5092 | 205 |
| 322 | 3300046660 | Ga0495625_0292191 | Ga0495625_0292191_262_879 | 205 |
| 323 | 3300046660 | Ga0495625_0406142 | Ga0495625_0406142_196_816 | 205 |
| 324 | 3300046664 | Ga0495659_0005610 | Ga0495659_0005610_1454_2074 | 205 |
| 325 | 3300046664 | Ga0495659_0109862 | Ga0495659_0109862_70_690 | 205 |
| 326 | 3300046665 | Ga0495661_0036795 | Ga0495661_0036795_2096_2740 | 205 |
| 327 | 3300046684 | Ga0495669_0008652 | Ga0495669_0008652_388_1008 | 205 |
| 328 | 3300046684 | Ga0495669_0163507 | Ga0495669_0163507_230_853 | 205 |
| 329 | 3300046691 | Ga0495670_0013454 | Ga0495670_0013454_3105_3725 | 205 |
| 330 | 3300046691 | Ga0495670_0015655 | Ga0495670_0015655_1468_2091 | 205 |
| 331 | 3300046691 | Ga0495670_0038953 | Ga0495670_0038953_1630_2250 | 205 |
| 332 | 3300046691 | Ga0495670_0046715 | Ga0495670_0046715_284_904 | 205 |
| 333 | 3300046691 | Ga0495670_0131577 | Ga0495670_0131577_616_1236 | 205 |
| 334 | 3300047445 | Ga0495677_0009974 | Ga0495677_0009974_2318_2938 | 205 |
| 335 | 3300047472 | Ga0495686_0000986 | Ga0495686_0000986_8822_9472 | 205 |
| 336 | 3300048090 | Ga0495615_0002923 | Ga0495615_0002923_1611_2228 | 205 |
| 337 | 3300048904 | Ga0496101_0740210 | Ga0496101_0740210_121_738 | 205 |
| 338 | 3300048905 | Ga0496102_0170144 | Ga0496102_0170144_1098_1721 | 205 |
| 339 | 3300048906 | Ga0496103_0169920 | Ga0496103_0169920_76_699 | 205 |
| 340 | 3300048928 | Ga0496125_0207012 | Ga0496125_0207012_119_736 | 205 |
| 341 | 3300048929 | Ga0496126_0508850 | Ga0496126_0508850_73_726 | 205 |
| 342 | 3300049460 | Ga0495682_0070177 | Ga0495682_0070177_538_1182 | 205 |
| 343 | 3300049460 | Ga0495682_0138415 | Ga0495682_0138415_78_695 | 205 |
| 344 | 3300049568 | Ga0501031_0289261 | Ga0501031_0289261_184_876 | 205 |
| 345 | 3300049570 | Ga0501033_0058789 | Ga0501033_0058789_969_1661 | 205 |
| 346 | 3300049574 | Ga0501038_0082142 | Ga0501038_0082142_698_1390 | 205 |
| 347 | 3300049575 | Ga0501039_0014310 | Ga0501039_0014310_496_1188 | 205 |
| 348 | 3300049579 | Ga0501043_0022505 | Ga0501043_0022505_733_1425 | 205 |
| 349 | 3300049581 | Ga0501047_0131027 | Ga0501047_0131027_608_1300 | 205 |
| 350 | 3300049581 | Ga0501047_0281176 | Ga0501047_0281176_141_758 | 205 |
| 351 | 3300049581 | Ga0501047_0315486 | Ga0501047_0315486_524_1165 | 205 |
| 352 | 3300049582 | Ga0501048_0312378 | Ga0501048_0312378_370_1062 | 205 |
| 353 | 3300049584 | Ga0501068_0268368 | Ga0501068_0268368_345_962 | 205 |
| 354 | 3300049664 | Ga0501224_019023 | Ga0501224_019023_195_818 | 205 |
| 355 | 3300049822 | Ga0501035_0070196 | Ga0501035_0070196_42_734 | 205 |
| 356 | 3300049823 | Ga0501044_0003561 | Ga0501044_0003561_8682_9299 | 205 |
| 357 | 3300049823 | Ga0501044_0415910 | Ga0501044_0415910_556_1179 | 205 |
| 358 | 3300049824 | Ga0501045_0083884 | Ga0501045_0083884_309_1001 | 205 |
| 359 | 3300050510 | nmdc:mga06r32_5150_c1 | nmdc:mga06r32_5150_c1_9348_9968 | 205 |
| 360 | 3300050511 | nmdc:mga08y16_603301_c1 | nmdc:mga08y16_603301_c1_399_1016 | 205 |
| 361 | 3300053103 | Ga0500555_000466 | Ga0500555_000466_7022_7666 | 205 |
| 362 | 3300053116 | Ga0500592_002611 | Ga0500592_002611_1066_1683 | 205 |
| 363 | 3300053134 | Ga0500658_0118904 | Ga0500658_0118904_85_702 | 205 |
| 364 | 3300053139 | Ga0500568_0055417 | Ga0500568_0055417_794_1411 | 205 |
| 365 | 3300053151 | Ga0500604_0014245 | Ga0500604_0014245_661_1278 | 205 |
| 366 | 3300053158 | Ga0500627_0000068 | Ga0500627_0000068_20104_20721 | 205 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2h56-assembly2.cif.gz_B | crystal structure of dna-3-methyladenine glycosidase (10174367) from bacillus halodurans at 2.55 a resolution | 0.9297 | 11 | 204 |
| 2h56-assembly2.cif.gz_B | crystal structure of dna-3-methyladenine glycosidase (10174367) from bacillus halodurans at 2.55 a resolution | 0.8781 | 11 | 204 |
| 2yg9-assembly2.cif.gz_B | structure of an unusual 3-methyladenine dna glycosylase ii (alka) from deinococcus radiodurans | 0.8622 | 11 | 198 |
| 3s6i-assembly1.cif.gz_A | schizosaccaromyces pombe 3-methyladenine dna glycosylase (mag1) in complex with abasic-dna. | 0.8307 | 21 | 197 |
| 4ejz-assembly2.cif.gz_B | structure of mbogg1 in complex with low affinity dna ligand | 0.8036 | 9 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3s6iA01 | Mainly Alpha;Orthogonal Bundle;Endonuclease Iii, domain 2; | 0.9472 | 149 | 197 | 1.10.1670.40 |
| af_B4FZ58_120_231_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9456 | 40 | 144 | 1.10.340.30 |
| 2h56B02 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9158 | 37 | 143 | 1.10.340.30 |
| af_A0A1D8PI96_136_252_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9119 | 41 | 144 | 1.10.340.30 |
| af_P22134_82_201_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.8964 | 40 | 142 | 1.10.340.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-J2ZN98-F1-model_v4 | DNA-3-methyladenine glycosylase II (EC 3.2.2.21) | 0.9965 | 1 | 205 |
GO:0005737
GO:0006285 GO:0006307 GO:0008725 GO:0032131 GO:0032993 GO:0043916 |
| AF-A0A1Y6E944-F1-model_v4 | DNA-3-methyladenine glycosylase II (EC 3.2.2.21) | 0.9957 | 1 | 201 |
GO:0005737
GO:0006285 GO:0006307 GO:0008725 GO:0032131 GO:0032993 GO:0043916 |
| AF-A0A2E4CRL8-F1-model_v4 | DNA-3-methyladenine glycosylase II (EC 3.2.2.21) | 0.994 | 1 | 205 |
GO:0005737
GO:0006285 GO:0006307 GO:0008725 GO:0032131 GO:0032993 GO:0043916 |
| AF-A0A3N2QDX5-F1-model_v4 | deleted | 0.9935 | 1 | 195 |
|
| AF-A0A5S3P6Z8-F1-model_v4 | DNA-3-methyladenine glycosylase II (EC 3.2.2.21) | 0.9933 | 1 | 205 |
GO:0005737
GO:0006285 GO:0006307 GO:0008725 GO:0032131 GO:0032993 GO:0043916 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar