F423957

General Info

Members Datasets Scaffolds Average Seq Length
366 190 359 206

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100411150|Ga0068856_1004111503
Length 204
Sequence MGLTAEQINAGLDVIAAREPAIARALSLAGYPPPRVRARGYITLLRTIVGQQVSVAAANSVWNKLETALGEITPEAVLAADFDTLRACGLSRQKQGYARSLSELVTSGEVMLEHLPEDDEEAIAQLTRIKGIGRWSAEIYLLFAEGRPDIFPAGDLAVQAGMGRILGLAERPSEKAIREVAEPWRPHRGAVTLLTWHCYNTAAL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
3 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
4 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
5 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
6 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
7 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
8 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
130 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
133 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
139 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
140 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
141 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
142 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
143 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
144 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
149 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
153 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
174 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
175 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
176 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
179 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
183 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
184 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
185 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
186 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
187 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
188 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
189 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
190 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.09
Metatranscriptomes 0
Isolates 1.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.11
Nodule 0
Rhizoplane 0.82
Rhizosphere 87.16
Stem 0
Stem Tuber 0.27
Unclassified 1.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3634486 2162886007 Bacteria 25034
2 JGI24033J26618_1005801 3300002155 Bacteria 1372
3 Ga0055536_1012486 3300003781 Bacteria 3148
4 Ga0055536_1035442 3300003781 Bacteria 1248
5 Ga0055530_10005876 3300003791 Bacteria 5670
6 Ga0055531_10007926 3300003794 Bacteria 5697
7 Ga0055531_10008542 3300003794 Bacteria 5377
8 Ga0065704_10070176 3300005289 Bacteria 138803
9 Ga0065712_10161903 3300005290 Bacteria 1280
10 Ga0065715_10003368 3300005293 Bacteria 5532
11 Ga0070658_10007991 3300005327 Bacteria 8509
12 Ga0070676_10001015 3300005328 Bacteria 13927
13 Ga0070670_100001290 3300005331 Bacteria 19979
14 Ga0070670_100009958 3300005331 Bacteria 8113
15 Ga0070670_100488648 3300005331 Bacteria 1094
16 Ga0070677_10004500 3300005333 Bacteria 4556
17 Ga0070666_10124304 3300005335 Bacteria 1790
18 Ga0070680_100346532 3300005336 Bacteria 1263
19 Ga0070682_100178876 3300005337 Bacteria 1480
20 Ga0070689_100159213 3300005340 Bacteria 1824
21 Ga0070661_100148175 3300005344 Bacteria 1773
22 Ga0070668_100028004 3300005347 Bacteria 4277
23 Ga0070668_100238328 3300005347 Bacteria 1506
24 Ga0070669_100015209 3300005353 Bacteria 5480
25 Ga0070669_100017295 3300005353 Bacteria 5143
26 Ga0070669_100941745 3300005353 Bacteria 739
27 Ga0070671_100002289 3300005355 Bacteria 14780
28 Ga0070671_100013854 3300005355 Bacteria 6505
29 Ga0070671_100037249 3300005355 Bacteria 4033
30 Ga0070674_100014313 3300005356 Bacteria 4931
31 Ga0070674_100018281 3300005356 Bacteria 4428
32 Ga0070674_100060786 3300005356 Bacteria 2635
33 Ga0070673_100004100 3300005364 Bacteria 9176
34 Ga0070659_100073017 3300005366 Bacteria 2731
35 Ga0070659_100153589 3300005366 Bacteria 1879
36 Ga0070667_100012450 3300005367 Bacteria 7037
37 Ga0070667_101210747 3300005367 Bacteria 707
38 Ga0070714_100123332 3300005435 Bacteria 2307
39 Ga0070663_100021228 3300005455 Bacteria 4315
40 Ga0070663_100039247 3300005455 Bacteria 3308
41 Ga0070678_100015300 3300005456 Bacteria 4872
42 Ga0070662_100002657 3300005457 Bacteria 11026
43 Ga0070662_100012125 3300005457 Bacteria 5706
44 Ga0070681_10138566 3300005458 Bacteria 2363
45 Ga0068867_100017416 3300005459 Bacteria 5104
46 Ga0070679_100240050 3300005530 Bacteria 1770
47 Ga0070672_100018503 3300005543 Bacteria 5038
48 Ga0070672_100223050 3300005543 Bacteria 1581
49 Ga0070695_100065956 3300005545 Bacteria 2359
50 Ga0070664_100188001 3300005564 Bacteria 1839
51 Ga0068854_100006061 3300005578 Bacteria 7667
52 Ga0068854_100114353 3300005578 Bacteria 2040
53 Ga0068856_100411150 3300005614 Bacteria 1373
54 Ga0068852_100455142 3300005616 Bacteria 1268
55 Ga0068859_100044147 3300005617 Bacteria 4479
56 Ga0068859_100189373 3300005617 Bacteria 2142
57 Ga0068864_100062663 3300005618 Bacteria 3222
58 Ga0068863_100016476 3300005841 Bacteria 7090
59 Ga0068858_100078607 3300005842 Bacteria 3065
60 Ga0068860_100119683 3300005843 Bacteria 2521
61 Ga0068860_100219471 3300005843 Bacteria 1846
62 Ga0068862_100013226 3300005844 Bacteria 6825
63 Ga0068862_100023489 3300005844 Bacteria 5167
64 Ga0068862_100455120 3300005844 Bacteria 1207
65 Ga0075368_10004233 3300006042 Bacteria 4845
66 Ga0075363_100024303 3300006048 Bacteria 3079
67 Ga0075364_10253386 3300006051 Bacteria 1196
68 Ga0075432_10001883 3300006058 Bacteria 6952
69 Ga0075362_10001164 3300006177 Bacteria 8227
70 Ga0075367_10001794 3300006178 Bacteria 9449
71 Ga0075369_10020819 3300006186 Bacteria 2688
72 Ga0075366_10181826 3300006195 Bacteria 1277
73 Ga0075370_10095838 3300006353 Bacteria 1714
74 Ga0075431_100012663 3300006847 Bacteria 8519
75 Ga0097620_100044149 3300006931 Bacteria 4479
76 Ga0097620_100189351 3300006931 Bacteria 2142
77 Ga0111539_10699742 3300009094 Bacteria 1180
78 Ga0105243_10139246 3300009148 Bacteria 2068
79 Ga0105241_10043202 3300009174 Bacteria 3413
80 Ga0105242_10272843 3300009176 Bacteria 1533
81 Ga0105248_10016423 3300009177 Bacteria 8147
82 Ga0105249_10013707 3300009553 Bacteria 7159
83 Ga0105249_10015106 3300009553 Bacteria 6831
84 Ga0105246_10021827 3300011119 Bacteria 4125
85 Ga0157371_10413660 3300013102 Bacteria 988
86 Ga0157378_11290063 3300013297 Bacteria 771
87 Ga0157375_10675630 3300013308 Bacteria 1188
88 Ga0157380_10007408 3300014326 Bacteria 7791
89 Ga0157380_10044825 3300014326 Bacteria 3468
90 Ga0157380_10334581 3300014326 Bacteria 1409
91 Ga0163161_10006677 3300017792 Bacteria 7985
92 Ga0209675_1000126 3300025291 Bacteria 104792
93 Ga0209676_1000060 3300025292 Bacteria 338238
94 Ga0209676_1000148 3300025292 Bacteria 172161
95 Ga0209025_1006023 3300025294 Bacteria 9612
96 Ga0209050_1000047 3300025298 Bacteria 380561
97 Ga0209050_1008397 3300025298 Bacteria 5531
98 Ga0209050_1014877 3300025298 Bacteria 3313
99 Ga0209257_1005238 3300025304 Bacteria 9274
100 Ga0209257_1006164 3300025304 Bacteria 7910
101 Ga0207697_10003320 3300025315 Bacteria 8009
102 Ga0207682_10002133 3300025893 Bacteria 8972
103 Ga0207680_10301116 3300025903 Bacteria 1118
104 Ga0207645_10002195 3300025907 Bacteria 15584
105 Ga0207645_10027578 3300025907 Bacteria 3667
106 Ga0207707_10034762 3300025912 Bacteria 4409
107 Ga0207657_10575175 3300025919 Bacteria 880
108 Ga0207652_10056943 3300025921 Bacteria 3366
109 Ga0207652_10275055 3300025921 Bacteria 1519
110 Ga0207681_10052686 3300025923 Bacteria 2760
111 Ga0207681_10481787 3300025923 Bacteria 1013
112 Ga0207681_10625715 3300025923 Bacteria 891
113 Ga0207650_10013803 3300025925 Bacteria 5601
114 Ga0207659_10000660 3300025926 Bacteria 20395
115 Ga0207659_10530343 3300025926 Bacteria 999
116 Ga0207644_10004854 3300025931 Bacteria 8752
117 Ga0207644_10015544 3300025931 Bacteria 5112
118 Ga0207690_10213043 3300025932 Bacteria 1474
119 Ga0207706_10006280 3300025933 Bacteria 11042
120 Ga0207706_10010084 3300025933 Bacteria 8653
121 Ga0207706_10675577 3300025933 Bacteria 883
122 Ga0207709_10120541 3300025935 Bacteria 1770
123 Ga0207670_10060765 3300025936 Bacteria 2576
124 Ga0207670_10435228 3300025936 Bacteria 1055
125 Ga0207669_10091271 3300025937 Bacteria 1984
126 Ga0207691_10019054 3300025940 Bacteria 6498
127 Ga0207691_10064907 3300025940 Bacteria 3306
128 Ga0207691_10545715 3300025940 Bacteria 983
129 Ga0207689_10025472 3300025942 Bacteria 4957
130 Ga0207661_10195378 3300025944 Bacteria 1776
131 Ga0207651_10023590 3300025960 Bacteria 3789
132 Ga0207668_10015916 3300025972 Bacteria 4682
133 Ga0207668_10024980 3300025972 Bacteria 3862
134 Ga0207668_10150033 3300025972 Bacteria 1803
135 Ga0207668_10270091 3300025972 Bacteria 1390
136 Ga0207640_10027521 3300025981 Bacteria 3465
137 Ga0207640_10082064 3300025981 Bacteria 2206
138 Ga0207640_10151290 3300025981 Bacteria 1705
139 Ga0207678_10017396 3300026067 Bacteria 6312
140 Ga0207678_10029358 3300026067 Bacteria 4799
141 Ga0207678_10050957 3300026067 Bacteria 3575
142 Ga0207648_10042523 3300026089 Bacteria 3988
143 Ga0207676_10043027 3300026095 Bacteria 3475
144 Ga0207674_10047499 3300026116 Bacteria 4399
145 Ga0207675_100017757 3300026118 Bacteria 6636
146 Ga0207683_10005512 3300026121 Bacteria 10848
147 Ga0207698_10402379 3300026142 Bacteria 1309
148 Ga0209983_1027859 3300027665 Bacteria 1197
149 Ga0209813_10000330 3300027866 Bacteria 12446
150 Ga0268265_10006294 3300028380 Bacteria 8040
151 Ga0268265_10165245 3300028380 Bacteria 1885
152 Ga0268264_10100870 3300028381 Bacteria 2508
153 Ga0268264_10103647 3300028381 Bacteria 2478
154 Ga0268264_10694490 3300028381 Bacteria 1010
155 Ga0307408_100030175 3300031548 Bacteria 3763
156 Ga0307408_100210696 3300031548 Bacteria 1579
157 Ga0307408_100313094 3300031548 Bacteria 1320
158 Ga0307408_100808375 3300031548 Bacteria 851
159 Ga0307405_10008034 3300031731 Bacteria 5320
160 Ga0307405_10012974 3300031731 Bacteria 4432
161 Ga0307405_10075045 3300031731 Bacteria 2189
162 Ga0307405_10085056 3300031731 Bacteria 2078
163 Ga0307405_10102298 3300031731 Bacteria 1924
164 Ga0307405_10116314 3300031731 Bacteria 1821
165 Ga0307405_10142586 3300031731 Bacteria 1673
166 Ga0307405_10599709 3300031731 Bacteria 898
167 Ga0307413_10010495 3300031824 Bacteria 4498
168 Ga0307413_10014206 3300031824 Bacteria 4034
169 Ga0307413_10146976 3300031824 Bacteria 1637
170 Ga0307413_10358996 3300031824 Bacteria 1127
171 Ga0307413_10386767 3300031824 Bacteria 1092
172 Ga0307413_10482449 3300031824 Bacteria 991
173 Ga0307413_10719509 3300031824 Bacteria 831
174 Ga0307410_10034244 3300031852 Bacteria 3287
175 Ga0307410_10050626 3300031852 Bacteria 2794
176 Ga0307410_10065471 3300031852 Bacteria 2500
177 Ga0307410_10109718 3300031852 Bacteria 1994
178 Ga0307410_10137034 3300031852 Bacteria 1805
179 Ga0307410_10259106 3300031852 Bacteria 1355
180 Ga0307410_10344391 3300031852 Bacteria 1189
181 Ga0307410_10735202 3300031852 Bacteria 834
182 Ga0307406_10035278 3300031901 Bacteria 3075
183 Ga0307406_10070664 3300031901 Bacteria 2286
184 Ga0307406_10146969 3300031901 Bacteria 1676
185 Ga0307406_10179918 3300031901 Bacteria 1538
186 Ga0307406_10181387 3300031901 Bacteria 1533
187 Ga0307407_10015031 3300031903 Bacteria 3810
188 Ga0307407_10062444 3300031903 Bacteria 2181
189 Ga0307407_10068151 3300031903 Bacteria 2106
190 Ga0307407_10084812 3300031903 Bacteria 1926
191 Ga0307407_10132194 3300031903 Bacteria 1598
192 Ga0307407_10140501 3300031903 Bacteria 1557
193 Ga0307407_10457949 3300031903 Bacteria 927
194 Ga0307407_10519923 3300031903 Bacteria 875
195 Ga0307412_10044005 3300031911 Bacteria 2911
196 Ga0307412_10110541 3300031911 Bacteria 1961
197 Ga0307412_10118745 3300031911 Bacteria 1900
198 Ga0307412_10123197 3300031911 Bacteria 1870
199 Ga0307412_10146392 3300031911 Bacteria 1737
200 Ga0307412_10148598 3300031911 Bacteria 1726
201 Ga0307412_10238513 3300031911 Bacteria 1405
202 Ga0307412_10329247 3300031911 Bacteria 1218
203 Ga0307412_10339244 3300031911 Bacteria 1202
204 Ga0307412_10342365 3300031911 Bacteria 1197
205 Ga0307409_100013350 3300031995 Bacteria 5282
206 Ga0307409_100028852 3300031995 Bacteria 3961
207 Ga0307409_100037285 3300031995 Bacteria 3583
208 Ga0307409_100103523 3300031995 Bacteria 2368
209 Ga0307409_100176109 3300031995 Bacteria 1888
210 Ga0307409_100589676 3300031995 Bacteria 1097
211 Ga0307409_100659528 3300031995 Bacteria 1041
212 Ga0307409_100748896 3300031995 Bacteria 980
213 Ga0307409_101029238 3300031995 Bacteria 842
214 Ga0307416_100000337 3300032002 Bacteria 24339
215 Ga0307416_100032798 3300032002 Bacteria 3930
216 Ga0307416_100262578 3300032002 Bacteria 1689
217 Ga0307416_100289407 3300032002 Bacteria 1621
218 Ga0307416_100488787 3300032002 Bacteria 1292
219 Ga0307416_100641972 3300032002 Bacteria 1145
220 Ga0307416_100656040 3300032002 Bacteria 1134
221 Ga0307416_100717029 3300032002 Bacteria 1090
222 Ga0307416_100723005 3300032002 Bacteria 1086
223 Ga0307416_100822709 3300032002 Bacteria 1025
224 Ga0307416_100879250 3300032002 Bacteria 995
225 Ga0307416_101799192 3300032002 Bacteria 716
226 Ga0307414_10008399 3300032004 Bacteria 5854
227 Ga0307414_10020774 3300032004 Bacteria 4101
228 Ga0307414_10022464 3300032004 Bacteria 3979
229 Ga0307414_10023337 3300032004 Bacteria 3922
230 Ga0307414_10051414 3300032004 Bacteria 2861
231 Ga0307414_10059601 3300032004 Bacteria 2696
232 Ga0307414_10061541 3300032004 Bacteria 2659
233 Ga0307414_10087113 3300032004 Bacteria 2306
234 Ga0307414_10107446 3300032004 Bacteria 2114
235 Ga0307414_10179245 3300032004 Bacteria 1702
236 Ga0307414_10180463 3300032004 Bacteria 1697
237 Ga0307414_10246351 3300032004 Bacteria 1482
238 Ga0307414_10533127 3300032004 Bacteria 1044
239 Ga0307414_10882230 3300032004 Bacteria 819
240 Ga0307411_10029388 3300032005 Bacteria 3355
241 Ga0307411_10073056 3300032005 Bacteria 2331
242 Ga0307411_10080535 3300032005 Bacteria 2239
243 Ga0307411_10095718 3300032005 Bacteria 2085
244 Ga0307411_10137217 3300032005 Bacteria 1798
245 Ga0307411_10263466 3300032005 Bacteria 1362
246 Ga0307411_10288110 3300032005 Bacteria 1311
247 Ga0307415_100048339 3300032126 Bacteria 2870
248 Ga0307415_100082752 3300032126 Bacteria 2297
249 Ga0307415_100158289 3300032126 Bacteria 1752
250 Ga0307415_100165840 3300032126 Bacteria 1717
251 Ga0307415_100176094 3300032126 Bacteria 1673
252 Ga0307415_100241462 3300032126 Bacteria 1461
253 Ga0307415_100329175 3300032126 Bacteria 1277
254 Ga0307415_100427595 3300032126 Bacteria 1138
255 Ga0307415_100513022 3300032126 Bacteria 1050
256 Ga0307415_100517450 3300032126 Bacteria 1046
257 Ga0307415_100582545 3300032126 Bacteria 993
258 Ga0307415_100780287 3300032126 Bacteria 870
259 Ga0307415_100810194 3300032126 Bacteria 856
260 Ga0395899_0011901 3300037312 Bacteria 6662
261 Ga0395899_0033927 3300037312 Bacteria 3832
262 Ga0395900_0001169 3300037418 Bacteria 32753
263 Ga0395900_0035553 3300037418 Bacteria 5131
264 Ga0395900_0089282 3300037418 Bacteria 3168
265 Ga0395900_0155944 3300037418 Bacteria 2332
266 Ga0395898_0071186 3300037466 Bacteria 3360
267 Ga0395898_0147998 3300037466 Bacteria 2247
268 Ga0395905_0000818 3300037471 Bacteria 40874
269 Ga0395905_0002628 3300037471 Bacteria 19724
270 Ga0395905_0192401 3300037471 Bacteria 1913
271 Ga0395905_0551634 3300037471 Bacteria 1054
272 Ga0395905_0671599 3300037471 Bacteria 938
273 Ga0395901_0002349 3300038443 Bacteria 19233
274 Ga0395901_0033788 3300038443 Bacteria 5281
275 Ga0395901_0037352 3300038443 Bacteria 5023
276 Ga0395901_0113667 3300038443 Bacteria 2843
277 Ga0395901_0129106 3300038443 Bacteria 2657
278 Ga0436365_1315168 3300039437 Bacteria 940
279 Ga0439445_0005947 3300042004 Bacteria 2795
280 Ga0439462_0000170 3300042015 Bacteria 10898
281 Ga0451577_0268277 3300042876 Bacteria 1546
282 Ga0466969_0059563 3300044656 Bacteria 1857
283 Ga0453684_0115264 3300044712 Bacteria 3256
284 Ga0466970_0076298 3300044765 Bacteria 1806
285 Ga0466957_0151725 3300044842 Bacteria 1499
286 Ga0466967_0866353 3300045976 Bacteria 898
287 Ga0495638_0012558 3300046460 Bacteria 5798
288 Ga0495596_0054551 3300046500 Bacteria 1563
289 Ga0495583_0000248 3300046506 Bacteria 89173
290 Ga0495583_0004867 3300046506 Bacteria 9380
291 Ga0495643_0059771 3300046522 Bacteria 2025
292 Ga0495663_0002307 3300046525 Bacteria 5768
293 Ga0495663_0031795 3300046525 Bacteria 1569
294 Ga0495642_0006249 3300046528 Bacteria 4571
295 Ga0495598_0016247 3300046537 Bacteria 1896
296 Ga0495621_0000162 3300046539 Bacteria 14957
297 Ga0495621_0006043 3300046539 Bacteria 3515
298 Ga0495621_0025677 3300046539 Bacteria 1981
299 Ga0495668_0000024 3300046616 Bacteria 359469
300 Ga0495668_0013175 3300046616 Bacteria 4889
301 Ga0495611_0145838 3300046648 Bacteria 1105
302 Ga0495625_0009967 3300046660 Bacteria 7903
303 Ga0495625_0018105 3300046660 Bacteria 5507
304 Ga0495625_0292191 3300046660 Bacteria 1045
305 Ga0495625_0365959 3300046660 Bacteria 908
306 Ga0495625_0406142 3300046660 Bacteria 850
307 Ga0495659_0005610 3300046664 Bacteria 3952
308 Ga0495659_0109862 3300046664 Bacteria 1076
309 Ga0495661_0036795 3300046665 Bacteria 3061
310 Ga0495669_0008652 3300046684 Bacteria 4283
311 Ga0495669_0163507 3300046684 Bacteria 1057
312 Ga0495670_0013454 3300046691 Bacteria 4025
313 Ga0495670_0015655 3300046691 Bacteria 3727
314 Ga0495670_0038953 3300046691 Bacteria 2370
315 Ga0495670_0046715 3300046691 Bacteria 2163
316 Ga0495670_0131577 3300046691 Bacteria 1304
317 Ga0495671_0011227 3300046692 Bacteria 4940
318 Ga0495677_0009974 3300047445 Bacteria 3495
319 Ga0495686_0000986 3300047472 Bacteria 34762
320 Ga0495615_0002923 3300048090 Bacteria 2806
321 Ga0496101_0740210 3300048904 Bacteria 776
322 Ga0496102_0170144 3300048905 Bacteria 2051
323 Ga0496103_0169920 3300048906 Bacteria 1400
324 Ga0496125_0207012 3300048928 Bacteria 1278
325 Ga0496126_0508850 3300048929 Bacteria 961
326 Ga0495682_0070177 3300049460 Bacteria 1261
327 Ga0495682_0138415 3300049460 Bacteria 870
328 Ga0501031_0289261 3300049568 Bacteria 1063
329 Ga0501033_0058789 3300049570 Bacteria 2839
330 Ga0501038_0082142 3300049574 Bacteria 2713
331 Ga0501039_0014310 3300049575 Bacteria 6075
332 Ga0501043_0022505 3300049579 Bacteria 4941
333 Ga0501047_0131027 3300049581 Bacteria 2388
334 Ga0501047_0281176 3300049581 Bacteria 1509
335 Ga0501047_0315486 3300049581 Bacteria 1404
336 Ga0501048_0312378 3300049582 Bacteria 1119
337 Ga0501068_0268368 3300049584 Bacteria 1089
338 Ga0501224_019023 3300049664 Bacteria 1023
339 Ga0501035_0070196 3300049822 Bacteria 3103
340 Ga0501044_0003561 3300049823 Bacteria 17529
341 Ga0501044_0415910 3300049823 Bacteria 1255
342 Ga0501045_0083884 3300049824 Bacteria 2351
343 nmdc:mga03683_567_c1 3300050489 Bacteria 10622
344 nmdc:mga03n38_68377_c1 3300050490 Bacteria 1638
345 nmdc:mga0k408_55974_c1 3300050493 Bacteria 2288
346 nmdc:mga06z11_107_c1 3300050494 Bacteria 34558
347 nmdc:mga04h51_127_c1 3300050495 Bacteria 22206
348 nmdc:mga07m45_90_c1 3300050496 Bacteria 34935
349 nmdc:mga06r32_5150_c1 3300050510 Bacteria 11753
350 nmdc:mga08y16_573471_c1 3300050511 Bacteria 1140
351 nmdc:mga08y16_603301_c1 3300050511 Bacteria 1106
352 nmdc:mga0sz30_960_c1 3300050516 Bacteria 10339
353 Ga0500555_000466 3300053103 Bacteria 16783
354 Ga0500592_002611 3300053116 Bacteria 2894
355 Ga0500594_0004500 3300053118 Bacteria 3073
356 Ga0500658_0118904 3300053134 Bacteria 1170
357 Ga0500568_0055417 3300053139 Bacteria 1547
358 Ga0500604_0014245 3300053151 Bacteria 2164
359 Ga0500627_0000068 3300053158 Bacteria 44198

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0671599 Ga0395905_0671599_399_917 170
2 3300050489 nmdc:mga03683_567_c1 nmdc:mga03683_567_c1_361_945 194
3 3300050490 nmdc:mga03n38_68377_c1 nmdc:mga03n38_68377_c1_222_806 194
4 3300050493 nmdc:mga0k408_55974_c1 nmdc:mga0k408_55974_c1_855_1439 194
5 3300050494 nmdc:mga06z11_107_c1 nmdc:mga06z11_107_c1_16206_16790 194
6 3300050495 nmdc:mga04h51_127_c1 nmdc:mga04h51_127_c1_13198_13782 194
7 3300050496 nmdc:mga07m45_90_c1 nmdc:mga07m45_90_c1_29036_29620 194
8 3300050516 nmdc:mga0sz30_960_c1 nmdc:mga0sz30_960_c1_7874_8458 194
9 3300037418 Ga0395900_0155944 Ga0395900_0155944_1671_2288 196
10 3300037471 Ga0395905_0192401 Ga0395905_0192401_829_1446 196
11 3300032002 Ga0307416_101799192 Ga0307416_1017991921 197
12 3300005356 Ga0070674_100060786 Ga0070674_1000607864 200
13 3300014326 Ga0157380_10044825 Ga0157380_100448251 200
14 3300025926 Ga0207659_10530343 Ga0207659_105303431 200
15 3300025933 Ga0207706_10675577 Ga0207706_106755771 200
16 3300025937 Ga0207669_10091271 Ga0207669_100912714 200
17 3300050511 nmdc:mga08y16_573471_c1 nmdc:mga08y16_573471_c1_50_667 200
18 iso_pu_bacteria 2643221560 2643822476 201
19 iso_pu_bacteria 2643221563 2643833508 201
20 iso_pu_bacteria 2643221608 2644054435 201
21 iso_pu_bacteria 2852653556 2852656782 201
22 iso_pu_bacteria 2852680915 2852682017 201
23 iso_pu_bacteria 2885427238 2885427413 201
24 iso_pu_bacteria 8054302542 8054304982 201
25 3300005327 Ga0070658_10007991 Ga0070658_100079919 204
26 3300005435 Ga0070714_100123332 Ga0070714_1001233323 204
27 3300005614 Ga0068856_100411150 Ga0068856_1004111503 204
28 3300046660 Ga0495625_0365959 Ga0495625_0365959_11_625 204
29 3300046692 Ga0495671_0011227 Ga0495671_0011227_3347_3961 204
30 3300053118 Ga0500594_0004500 Ga0500594_0004500_2341_2955 204
31 2162886007 SwRhRL2b_contig_3634486 SwRhRL2b_0227.00006650 205
32 3300002155 JGI24033J26618_1005801 JGI24033J26618_10058012 205
33 3300003781 Ga0055536_1012486 Ga0055536_10124865 205
34 3300003781 Ga0055536_1035442 Ga0055536_10354421 205
35 3300003791 Ga0055530_10005876 Ga0055530_100058764 205
36 3300003794 Ga0055531_10007926 Ga0055531_100079265 205
37 3300003794 Ga0055531_10008542 Ga0055531_100085423 205
38 3300005289 Ga0065704_10070176 Ga0065704_1007017613 205
39 3300005290 Ga0065712_10161903 Ga0065712_101619032 205
40 3300005293 Ga0065715_10003368 Ga0065715_100033686 205
41 3300005328 Ga0070676_10001015 Ga0070676_1000101514 205
42 3300005331 Ga0070670_100001290 Ga0070670_10000129013 205
43 3300005331 Ga0070670_100009958 Ga0070670_1000099585 205
44 3300005331 Ga0070670_100488648 Ga0070670_1004886482 205
45 3300005333 Ga0070677_10004500 Ga0070677_100045003 205
46 3300005335 Ga0070666_10124304 Ga0070666_101243042 205
47 3300005336 Ga0070680_100346532 Ga0070680_1003465321 205
48 3300005337 Ga0070682_100178876 Ga0070682_1001788761 205
49 3300005340 Ga0070689_100159213 Ga0070689_1001592132 205
50 3300005344 Ga0070661_100148175 Ga0070661_1001481752 205
51 3300005347 Ga0070668_100028004 Ga0070668_1000280042 205
52 3300005347 Ga0070668_100238328 Ga0070668_1002383282 205
53 3300005353 Ga0070669_100015209 Ga0070669_1000152094 205
54 3300005353 Ga0070669_100017295 Ga0070669_1000172952 205
55 3300005353 Ga0070669_100941745 Ga0070669_1009417451 205
56 3300005355 Ga0070671_100002289 Ga0070671_10000228910 205
57 3300005355 Ga0070671_100013854 Ga0070671_1000138544 205
58 3300005355 Ga0070671_100037249 Ga0070671_1000372494 205
59 3300005356 Ga0070674_100014313 Ga0070674_1000143135 205
60 3300005356 Ga0070674_100018281 Ga0070674_1000182812 205
61 3300005364 Ga0070673_100004100 Ga0070673_1000041009 205
62 3300005366 Ga0070659_100073017 Ga0070659_1000730173 205
63 3300005366 Ga0070659_100153589 Ga0070659_1001535892 205
64 3300005367 Ga0070667_100012450 Ga0070667_1000124505 205
65 3300005367 Ga0070667_101210747 Ga0070667_1012107471 205
66 3300005455 Ga0070663_100021228 Ga0070663_1000212281 205
67 3300005455 Ga0070663_100039247 Ga0070663_1000392476 205
68 3300005456 Ga0070678_100015300 Ga0070678_1000153002 205
69 3300005457 Ga0070662_100002657 Ga0070662_1000026575 205
70 3300005457 Ga0070662_100012125 Ga0070662_1000121253 205
71 3300005458 Ga0070681_10138566 Ga0070681_101385662 205
72 3300005459 Ga0068867_100017416 Ga0068867_1000174164 205
73 3300005530 Ga0070679_100240050 Ga0070679_1002400502 205
74 3300005543 Ga0070672_100018503 Ga0070672_1000185035 205
75 3300005543 Ga0070672_100223050 Ga0070672_1002230502 205
76 3300005545 Ga0070695_100065956 Ga0070695_1000659562 205
77 3300005564 Ga0070664_100188001 Ga0070664_1001880012 205
78 3300005578 Ga0068854_100006061 Ga0068854_1000060614 205
79 3300005578 Ga0068854_100114353 Ga0068854_1001143532 205
80 3300005616 Ga0068852_100455142 Ga0068852_1004551422 205
81 3300005617 Ga0068859_100044147 Ga0068859_1000441471 205
82 3300005617 Ga0068859_100189373 Ga0068859_1001893733 205
83 3300005618 Ga0068864_100062663 Ga0068864_1000626636 205
84 3300005841 Ga0068863_100016476 Ga0068863_10001647611 205
85 3300005842 Ga0068858_100078607 Ga0068858_1000786073 205
86 3300005843 Ga0068860_100119683 Ga0068860_1001196832 205
87 3300005843 Ga0068860_100219471 Ga0068860_1002194712 205
88 3300005844 Ga0068862_100013226 Ga0068862_1000132267 205
89 3300005844 Ga0068862_100023489 Ga0068862_1000234899 205
90 3300005844 Ga0068862_100455120 Ga0068862_1004551201 205
91 3300006042 Ga0075368_10004233 Ga0075368_100042333 205
92 3300006048 Ga0075363_100024303 Ga0075363_1000243033 205
93 3300006051 Ga0075364_10253386 Ga0075364_102533862 205
94 3300006058 Ga0075432_10001883 Ga0075432_100018837 205
95 3300006177 Ga0075362_10001164 Ga0075362_100011642 205
96 3300006178 Ga0075367_10001794 Ga0075367_100017948 205
97 3300006186 Ga0075369_10020819 Ga0075369_100208192 205
98 3300006195 Ga0075366_10181826 Ga0075366_101818262 205
99 3300006353 Ga0075370_10095838 Ga0075370_100958382 205
100 3300006847 Ga0075431_100012663 Ga0075431_1000126639 205
101 3300006931 Ga0097620_100044149 Ga0097620_1000441491 205
102 3300006931 Ga0097620_100189351 Ga0097620_1001893513 205
103 3300009094 Ga0111539_10699742 Ga0111539_106997422 205
104 3300009148 Ga0105243_10139246 Ga0105243_101392463 205
105 3300009174 Ga0105241_10043202 Ga0105241_100432022 205
106 3300009176 Ga0105242_10272843 Ga0105242_102728432 205
107 3300009177 Ga0105248_10016423 Ga0105248_100164234 205
108 3300009553 Ga0105249_10013707 Ga0105249_100137079 205
109 3300009553 Ga0105249_10015106 Ga0105249_100151065 205
110 3300011119 Ga0105246_10021827 Ga0105246_100218278 205
111 3300013102 Ga0157371_10413660 Ga0157371_104136602 205
112 3300013297 Ga0157378_11290063 Ga0157378_112900631 205
113 3300013308 Ga0157375_10675630 Ga0157375_106756302 205
114 3300014326 Ga0157380_10007408 Ga0157380_100074085 205
115 3300014326 Ga0157380_10334581 Ga0157380_103345812 205
116 3300017792 Ga0163161_10006677 Ga0163161_100066773 205
117 3300025291 Ga0209675_1000126 Ga0209675_100012637 205
118 3300025292 Ga0209676_1000060 Ga0209676_1000060285 205
119 3300025292 Ga0209676_1000148 Ga0209676_1000148147 205
120 3300025294 Ga0209025_1006023 Ga0209025_10060235 205
121 3300025298 Ga0209050_1000047 Ga0209050_100004740 205
122 3300025298 Ga0209050_1008397 Ga0209050_10083974 205
123 3300025298 Ga0209050_1014877 Ga0209050_10148774 205
124 3300025304 Ga0209257_1005238 Ga0209257_10052385 205
125 3300025304 Ga0209257_1006164 Ga0209257_10061647 205
126 3300025315 Ga0207697_10003320 Ga0207697_100033206 205
127 3300025893 Ga0207682_10002133 Ga0207682_1000213310 205
128 3300025903 Ga0207680_10301116 Ga0207680_103011162 205
129 3300025907 Ga0207645_10002195 Ga0207645_100021956 205
130 3300025907 Ga0207645_10027578 Ga0207645_100275783 205
131 3300025912 Ga0207707_10034762 Ga0207707_100347624 205
132 3300025919 Ga0207657_10575175 Ga0207657_105751752 205
133 3300025921 Ga0207652_10056943 Ga0207652_100569435 205
134 3300025921 Ga0207652_10275055 Ga0207652_102750551 205
135 3300025923 Ga0207681_10052686 Ga0207681_100526862 205
136 3300025923 Ga0207681_10481787 Ga0207681_104817872 205
137 3300025923 Ga0207681_10625715 Ga0207681_106257151 205
138 3300025925 Ga0207650_10013803 Ga0207650_100138034 205
139 3300025926 Ga0207659_10000660 Ga0207659_100006604 205
140 3300025931 Ga0207644_10004854 Ga0207644_100048546 205
141 3300025931 Ga0207644_10015544 Ga0207644_100155444 205
142 3300025932 Ga0207690_10213043 Ga0207690_102130432 205
143 3300025933 Ga0207706_10006280 Ga0207706_100062806 205
144 3300025933 Ga0207706_10010084 Ga0207706_100100844 205
145 3300025935 Ga0207709_10120541 Ga0207709_101205412 205
146 3300025936 Ga0207670_10060765 Ga0207670_100607653 205
147 3300025936 Ga0207670_10435228 Ga0207670_104352282 205
148 3300025940 Ga0207691_10019054 Ga0207691_100190544 205
149 3300025940 Ga0207691_10064907 Ga0207691_100649076 205
150 3300025940 Ga0207691_10545715 Ga0207691_105457152 205
151 3300025942 Ga0207689_10025472 Ga0207689_100254722 205
152 3300025944 Ga0207661_10195378 Ga0207661_101953782 205
153 3300025960 Ga0207651_10023590 Ga0207651_100235904 205
154 3300025972 Ga0207668_10015916 Ga0207668_100159165 205
155 3300025972 Ga0207668_10024980 Ga0207668_100249802 205
156 3300025972 Ga0207668_10150033 Ga0207668_101500332 205
157 3300025972 Ga0207668_10270091 Ga0207668_102700912 205
158 3300025981 Ga0207640_10027521 Ga0207640_100275213 205
159 3300025981 Ga0207640_10082064 Ga0207640_100820643 205
160 3300025981 Ga0207640_10151290 Ga0207640_101512902 205
161 3300026067 Ga0207678_10017396 Ga0207678_100173967 205
162 3300026067 Ga0207678_10029358 Ga0207678_100293582 205
163 3300026067 Ga0207678_10050957 Ga0207678_100509572 205
164 3300026089 Ga0207648_10042523 Ga0207648_100425233 205
165 3300026095 Ga0207676_10043027 Ga0207676_100430272 205
166 3300026116 Ga0207674_10047499 Ga0207674_100474994 205
167 3300026118 Ga0207675_100017757 Ga0207675_1000177575 205
168 3300026121 Ga0207683_10005512 Ga0207683_100055128 205
169 3300026142 Ga0207698_10402379 Ga0207698_104023792 205
170 3300027665 Ga0209983_1027859 Ga0209983_10278591 205
171 3300027866 Ga0209813_10000330 Ga0209813_100003305 205
172 3300028380 Ga0268265_10006294 Ga0268265_100062946 205
173 3300028380 Ga0268265_10165245 Ga0268265_101652452 205
174 3300028381 Ga0268264_10100870 Ga0268264_101008703 205
175 3300028381 Ga0268264_10103647 Ga0268264_101036472 205
176 3300028381 Ga0268264_10694490 Ga0268264_106944902 205
177 3300031548 Ga0307408_100030175 Ga0307408_1000301752 205
178 3300031548 Ga0307408_100210696 Ga0307408_1002106962 205
179 3300031548 Ga0307408_100313094 Ga0307408_1003130942 205
180 3300031548 Ga0307408_100808375 Ga0307408_1008083752 205
181 3300031731 Ga0307405_10008034 Ga0307405_100080344 205
182 3300031731 Ga0307405_10012974 Ga0307405_100129746 205
183 3300031731 Ga0307405_10075045 Ga0307405_100750451 205
184 3300031731 Ga0307405_10085056 Ga0307405_100850562 205
185 3300031731 Ga0307405_10102298 Ga0307405_101022981 205
186 3300031731 Ga0307405_10116314 Ga0307405_101163142 205
187 3300031731 Ga0307405_10142586 Ga0307405_101425862 205
188 3300031731 Ga0307405_10599709 Ga0307405_105997091 205
189 3300031824 Ga0307413_10010495 Ga0307413_100104956 205
190 3300031824 Ga0307413_10014206 Ga0307413_100142062 205
191 3300031824 Ga0307413_10146976 Ga0307413_101469762 205
192 3300031824 Ga0307413_10358996 Ga0307413_103589962 205
193 3300031824 Ga0307413_10386767 Ga0307413_103867671 205
194 3300031824 Ga0307413_10482449 Ga0307413_104824492 205
195 3300031824 Ga0307413_10719509 Ga0307413_107195091 205
196 3300031852 Ga0307410_10034244 Ga0307410_100342444 205
197 3300031852 Ga0307410_10050626 Ga0307410_100506265 205
198 3300031852 Ga0307410_10065471 Ga0307410_100654713 205
199 3300031852 Ga0307410_10109718 Ga0307410_101097182 205
200 3300031852 Ga0307410_10137034 Ga0307410_101370342 205
201 3300031852 Ga0307410_10259106 Ga0307410_102591062 205
202 3300031852 Ga0307410_10344391 Ga0307410_103443912 205
203 3300031852 Ga0307410_10735202 Ga0307410_107352022 205
204 3300031901 Ga0307406_10035278 Ga0307406_100352781 205
205 3300031901 Ga0307406_10070664 Ga0307406_100706642 205
206 3300031901 Ga0307406_10146969 Ga0307406_101469692 205
207 3300031901 Ga0307406_10179918 Ga0307406_101799182 205
208 3300031901 Ga0307406_10181387 Ga0307406_101813872 205
209 3300031903 Ga0307407_10015031 Ga0307407_100150314 205
210 3300031903 Ga0307407_10062444 Ga0307407_100624442 205
211 3300031903 Ga0307407_10068151 Ga0307407_100681512 205
212 3300031903 Ga0307407_10084812 Ga0307407_100848123 205
213 3300031903 Ga0307407_10132194 Ga0307407_101321942 205
214 3300031903 Ga0307407_10140501 Ga0307407_101405012 205
215 3300031903 Ga0307407_10457949 Ga0307407_104579492 205
216 3300031903 Ga0307407_10519923 Ga0307407_105199232 205
217 3300031911 Ga0307412_10044005 Ga0307412_100440052 205
218 3300031911 Ga0307412_10110541 Ga0307412_101105411 205
219 3300031911 Ga0307412_10118745 Ga0307412_101187452 205
220 3300031911 Ga0307412_10123197 Ga0307412_101231972 205
221 3300031911 Ga0307412_10146392 Ga0307412_101463922 205
222 3300031911 Ga0307412_10148598 Ga0307412_101485982 205
223 3300031911 Ga0307412_10238513 Ga0307412_102385133 205
224 3300031911 Ga0307412_10329247 Ga0307412_103292471 205
225 3300031911 Ga0307412_10339244 Ga0307412_103392442 205
226 3300031911 Ga0307412_10342365 Ga0307412_103423652 205
227 3300031995 Ga0307409_100013350 Ga0307409_1000133504 205
228 3300031995 Ga0307409_100028852 Ga0307409_1000288522 205
229 3300031995 Ga0307409_100037285 Ga0307409_1000372855 205
230 3300031995 Ga0307409_100103523 Ga0307409_1001035232 205
231 3300031995 Ga0307409_100176109 Ga0307409_1001761092 205
232 3300031995 Ga0307409_100589676 Ga0307409_1005896762 205
233 3300031995 Ga0307409_100659528 Ga0307409_1006595282 205
234 3300031995 Ga0307409_100748896 Ga0307409_1007488962 205
235 3300031995 Ga0307409_101029238 Ga0307409_1010292382 205
236 3300032002 Ga0307416_100000337 Ga0307416_1000003376 205
237 3300032002 Ga0307416_100032798 Ga0307416_1000327983 205
238 3300032002 Ga0307416_100262578 Ga0307416_1002625782 205
239 3300032002 Ga0307416_100289407 Ga0307416_1002894072 205
240 3300032002 Ga0307416_100488787 Ga0307416_1004887872 205
241 3300032002 Ga0307416_100641972 Ga0307416_1006419722 205
242 3300032002 Ga0307416_100656040 Ga0307416_1006560402 205
243 3300032002 Ga0307416_100717029 Ga0307416_1007170292 205
244 3300032002 Ga0307416_100723005 Ga0307416_1007230052 205
245 3300032002 Ga0307416_100822709 Ga0307416_1008227092 205
246 3300032002 Ga0307416_100879250 Ga0307416_1008792502 205
247 3300032004 Ga0307414_10008399 Ga0307414_100083998 205
248 3300032004 Ga0307414_10020774 Ga0307414_100207743 205
249 3300032004 Ga0307414_10022464 Ga0307414_100224642 205
250 3300032004 Ga0307414_10023337 Ga0307414_100233373 205
251 3300032004 Ga0307414_10051414 Ga0307414_100514142 205
252 3300032004 Ga0307414_10059601 Ga0307414_100596012 205
253 3300032004 Ga0307414_10061541 Ga0307414_100615413 205
254 3300032004 Ga0307414_10087113 Ga0307414_100871134 205
255 3300032004 Ga0307414_10107446 Ga0307414_101074462 205
256 3300032004 Ga0307414_10179245 Ga0307414_101792451 205
257 3300032004 Ga0307414_10180463 Ga0307414_101804632 205
258 3300032004 Ga0307414_10246351 Ga0307414_102463512 205
259 3300032004 Ga0307414_10533127 Ga0307414_105331272 205
260 3300032004 Ga0307414_10882230 Ga0307414_108822301 205
261 3300032005 Ga0307411_10029388 Ga0307411_100293881 205
262 3300032005 Ga0307411_10073056 Ga0307411_100730562 205
263 3300032005 Ga0307411_10080535 Ga0307411_100805353 205
264 3300032005 Ga0307411_10095718 Ga0307411_100957183 205
265 3300032005 Ga0307411_10137217 Ga0307411_101372172 205
266 3300032005 Ga0307411_10263466 Ga0307411_102634663 205
267 3300032005 Ga0307411_10288110 Ga0307411_102881102 205
268 3300032126 Ga0307415_100048339 Ga0307415_1000483393 205
269 3300032126 Ga0307415_100082752 Ga0307415_1000827524 205
270 3300032126 Ga0307415_100158289 Ga0307415_1001582891 205
271 3300032126 Ga0307415_100165840 Ga0307415_1001658402 205
272 3300032126 Ga0307415_100176094 Ga0307415_1001760941 205
273 3300032126 Ga0307415_100241462 Ga0307415_1002414622 205
274 3300032126 Ga0307415_100329175 Ga0307415_1003291752 205
275 3300032126 Ga0307415_100427595 Ga0307415_1004275952 205
276 3300032126 Ga0307415_100513022 Ga0307415_1005130222 205
277 3300032126 Ga0307415_100517450 Ga0307415_1005174501 205
278 3300032126 Ga0307415_100582545 Ga0307415_1005825452 205
279 3300032126 Ga0307415_100780287 Ga0307415_1007802872 205
280 3300032126 Ga0307415_100810194 Ga0307415_1008101942 205
281 3300037312 Ga0395899_0011901 Ga0395899_0011901_3610_4227 205
282 3300037312 Ga0395899_0033927 Ga0395899_0033927_3060_3683 205
283 3300037418 Ga0395900_0001169 Ga0395900_0001169_25239_25862 205
284 3300037418 Ga0395900_0035553 Ga0395900_0035553_2133_2750 205
285 3300037418 Ga0395900_0089282 Ga0395900_0089282_745_1362 205
286 3300037466 Ga0395898_0071186 Ga0395898_0071186_2466_3083 205
287 3300037466 Ga0395898_0147998 Ga0395898_0147998_1324_1947 205
288 3300037471 Ga0395905_0000818 Ga0395905_0000818_17107_17730 205
289 3300037471 Ga0395905_0002628 Ga0395905_0002628_9498_10115 205
290 3300037471 Ga0395905_0551634 Ga0395905_0551634_421_1038 205
291 3300038443 Ga0395901_0002349 Ga0395901_0002349_13380_14003 205
292 3300038443 Ga0395901_0033788 Ga0395901_0033788_3433_4050 205
293 3300038443 Ga0395901_0037352 Ga0395901_0037352_3589_4206 205
294 3300038443 Ga0395901_0113667 Ga0395901_0113667_616_1233 205
295 3300038443 Ga0395901_0129106 Ga0395901_0129106_920_1537 205
296 3300039437 Ga0436365_1315168 Ga0436365_1315168_66_689 205
297 3300042004 Ga0439445_0005947 Ga0439445_0005947_288_908 205
298 3300042015 Ga0439462_0000170 Ga0439462_0000170_10143_10760 205
299 3300042876 Ga0451577_0268277 Ga0451577_0268277_40_657 205
300 3300044656 Ga0466969_0059563 Ga0466969_0059563_907_1524 205
301 3300044712 Ga0453684_0115264 Ga0453684_0115264_912_1529 205
302 3300044765 Ga0466970_0076298 Ga0466970_0076298_871_1488 205
303 3300044842 Ga0466957_0151725 Ga0466957_0151725_802_1419 205
304 3300045976 Ga0466967_0866353 Ga0466967_0866353_54_671 205
305 3300046460 Ga0495638_0012558 Ga0495638_0012558_1159_1803 205
306 3300046500 Ga0495596_0054551 Ga0495596_0054551_495_1115 205
307 3300046506 Ga0495583_0000248 Ga0495583_0000248_20003_20647 205
308 3300046506 Ga0495583_0004867 Ga0495583_0004867_2907_3530 205
309 3300046522 Ga0495643_0059771 Ga0495643_0059771_384_1001 205
310 3300046525 Ga0495663_0002307 Ga0495663_0002307_940_1560 205
311 3300046525 Ga0495663_0031795 Ga0495663_0031795_531_1151 205
312 3300046528 Ga0495642_0006249 Ga0495642_0006249_2854_3474 205
313 3300046537 Ga0495598_0016247 Ga0495598_0016247_21_644 205
314 3300046539 Ga0495621_0000162 Ga0495621_0000162_8481_9104 205
315 3300046539 Ga0495621_0006043 Ga0495621_0006043_1469_2089 205
316 3300046539 Ga0495621_0025677 Ga0495621_0025677_927_1544 205
317 3300046616 Ga0495668_0000024 Ga0495668_0000024_92242_92859 205
318 3300046616 Ga0495668_0013175 Ga0495668_0013175_4240_4863 205
319 3300046648 Ga0495611_0145838 Ga0495611_0145838_387_1031 205
320 3300046660 Ga0495625_0009967 Ga0495625_0009967_5586_6203 205
321 3300046660 Ga0495625_0018105 Ga0495625_0018105_4469_5092 205
322 3300046660 Ga0495625_0292191 Ga0495625_0292191_262_879 205
323 3300046660 Ga0495625_0406142 Ga0495625_0406142_196_816 205
324 3300046664 Ga0495659_0005610 Ga0495659_0005610_1454_2074 205
325 3300046664 Ga0495659_0109862 Ga0495659_0109862_70_690 205
326 3300046665 Ga0495661_0036795 Ga0495661_0036795_2096_2740 205
327 3300046684 Ga0495669_0008652 Ga0495669_0008652_388_1008 205
328 3300046684 Ga0495669_0163507 Ga0495669_0163507_230_853 205
329 3300046691 Ga0495670_0013454 Ga0495670_0013454_3105_3725 205
330 3300046691 Ga0495670_0015655 Ga0495670_0015655_1468_2091 205
331 3300046691 Ga0495670_0038953 Ga0495670_0038953_1630_2250 205
332 3300046691 Ga0495670_0046715 Ga0495670_0046715_284_904 205
333 3300046691 Ga0495670_0131577 Ga0495670_0131577_616_1236 205
334 3300047445 Ga0495677_0009974 Ga0495677_0009974_2318_2938 205
335 3300047472 Ga0495686_0000986 Ga0495686_0000986_8822_9472 205
336 3300048090 Ga0495615_0002923 Ga0495615_0002923_1611_2228 205
337 3300048904 Ga0496101_0740210 Ga0496101_0740210_121_738 205
338 3300048905 Ga0496102_0170144 Ga0496102_0170144_1098_1721 205
339 3300048906 Ga0496103_0169920 Ga0496103_0169920_76_699 205
340 3300048928 Ga0496125_0207012 Ga0496125_0207012_119_736 205
341 3300048929 Ga0496126_0508850 Ga0496126_0508850_73_726 205
342 3300049460 Ga0495682_0070177 Ga0495682_0070177_538_1182 205
343 3300049460 Ga0495682_0138415 Ga0495682_0138415_78_695 205
344 3300049568 Ga0501031_0289261 Ga0501031_0289261_184_876 205
345 3300049570 Ga0501033_0058789 Ga0501033_0058789_969_1661 205
346 3300049574 Ga0501038_0082142 Ga0501038_0082142_698_1390 205
347 3300049575 Ga0501039_0014310 Ga0501039_0014310_496_1188 205
348 3300049579 Ga0501043_0022505 Ga0501043_0022505_733_1425 205
349 3300049581 Ga0501047_0131027 Ga0501047_0131027_608_1300 205
350 3300049581 Ga0501047_0281176 Ga0501047_0281176_141_758 205
351 3300049581 Ga0501047_0315486 Ga0501047_0315486_524_1165 205
352 3300049582 Ga0501048_0312378 Ga0501048_0312378_370_1062 205
353 3300049584 Ga0501068_0268368 Ga0501068_0268368_345_962 205
354 3300049664 Ga0501224_019023 Ga0501224_019023_195_818 205
355 3300049822 Ga0501035_0070196 Ga0501035_0070196_42_734 205
356 3300049823 Ga0501044_0003561 Ga0501044_0003561_8682_9299 205
357 3300049823 Ga0501044_0415910 Ga0501044_0415910_556_1179 205
358 3300049824 Ga0501045_0083884 Ga0501045_0083884_309_1001 205
359 3300050510 nmdc:mga06r32_5150_c1 nmdc:mga06r32_5150_c1_9348_9968 205
360 3300050511 nmdc:mga08y16_603301_c1 nmdc:mga08y16_603301_c1_399_1016 205
361 3300053103 Ga0500555_000466 Ga0500555_000466_7022_7666 205
362 3300053116 Ga0500592_002611 Ga0500592_002611_1066_1683 205
363 3300053134 Ga0500658_0118904 Ga0500658_0118904_85_702 205
364 3300053139 Ga0500568_0055417 Ga0500568_0055417_794_1411 205
365 3300053151 Ga0500604_0014245 Ga0500604_0014245_661_1278 205
366 3300053158 Ga0500627_0000068 Ga0500627_0000068_20104_20721 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00730

HhH-GPD

HhH-GPD superfamily base excision DNA repair protein

45

186

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h56-assembly2.cif.gz_B crystal structure of dna-3-methyladenine glycosidase (10174367) from bacillus halodurans at 2.55 a resolution 0.9297 11 204
2h56-assembly2.cif.gz_B crystal structure of dna-3-methyladenine glycosidase (10174367) from bacillus halodurans at 2.55 a resolution 0.8781 11 204
2yg9-assembly2.cif.gz_B structure of an unusual 3-methyladenine dna glycosylase ii (alka) from deinococcus radiodurans 0.8622 11 198
3s6i-assembly1.cif.gz_A schizosaccaromyces pombe 3-methyladenine dna glycosylase (mag1) in complex with abasic-dna. 0.8307 21 197
4ejz-assembly2.cif.gz_B structure of mbogg1 in complex with low affinity dna ligand 0.8036 9 205
ID Description Score Start End Superfamily
3s6iA01 Mainly Alpha;Orthogonal Bundle;Endonuclease Iii, domain 2; 0.9472 149 197 1.10.1670.40
af_B4FZ58_120_231_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9456 40 144 1.10.340.30
2h56B02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9158 37 143 1.10.340.30
af_A0A1D8PI96_136_252_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9119 41 144 1.10.340.30
af_P22134_82_201_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8964 40 142 1.10.340.30
ID Description Score Start End GO Terms
AF-J2ZN98-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9965 1 205 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A1Y6E944-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9957 1 201 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A2E4CRL8-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.994 1 205 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A3N2QDX5-F1-model_v4 deleted 0.9935 1 195
AF-A0A5S3P6Z8-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9933 1 205 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916

Feature Viewer

pLDDT pTM Quality
96.34 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map