F423941

General Info

Members Datasets Scaffolds Average Seq Length
366 186 732 316

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100003171|Ga0070707_10000317110
Length 343
Sequence MAASLCSSEAAALYMLSRFLDKEHLKMFKMTTTRLILIALAGTALLAARAAAPIRVMLLDGESAGPYHQWKLVTPVLKKELDDTGLFQVDVVTAPSAGADFGGFKPDFGKYQVVVFNYDAPDERWPAELKTSFERYIQGGGGLVSVHAADNAFPGWTAFNEMIGVGGWRERTEKAGPFWYYKDNKLVSDNTRGPAGSHGRRVPFRLTVRQNHPITNGLPMTWMHQGDELYARLRGPGKNMSVLATAYSDPTNAGSGHDEPMLMTLSYGKGRIFHTTLGHDINALSSVDFVVTFQRGVEWAATGTVSQKVPADFPTANVVSYRADLAAMDPAYKNGLNPLDTGR

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
141 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.82
Rhizosphere 99.18
Stem 0
Stem Tuber 0
Unclassified 15.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100003171 3300005468 Bacteria 15563
2 JGI25406J46586_10000661 3300003203 Bacteria 16045
3 Ga0065712_10001369 3300005290 Bacteria 6790
4 Ga0065715_10038127 3300005293 Bacteria 1274
5 Ga0065707_10280742 3300005295 Bacteria 1048
6 Ga0070683_100001354 3300005329 Bacteria 18721
7 Ga0070683_100005826 3300005329 Bacteria 10309
8 Ga0070670_100047447 3300005331 Bacteria 3696
9 Ga0068869_100111576 3300005334 Bacteria 2081
10 Ga0068869_100174211 3300005334 Unclassified 1683
11 Ga0070666_10012739 3300005335 Bacteria 5315
12 Ga0070666_10025580 3300005335 Bacteria 3849
13 Ga0070666_10126873 3300005335 Bacteria 1771
14 Ga0070660_100016512 3300005339 Bacteria 5360
15 Ga0070689_100044472 3300005340 Bacteria 3416
16 Ga0070691_10012676 3300005341 Unclassified 3861
17 Ga0070691_10076052 3300005341 Viruses 1636
18 Ga0070687_100187639 3300005343 Unclassified 1243
19 Ga0070661_100056378 3300005344 Bacteria 2879
20 Ga0070661_100091410 3300005344 Bacteria 2254
21 Ga0070661_100100088 3300005344 Bacteria 2155
22 Ga0070669_100079977 3300005353 Bacteria 2432
23 Ga0070669_100229831 3300005353 Bacteria 1470
24 Ga0070675_100004384 3300005354 Bacteria 10768
25 Ga0070675_100005342 3300005354 Bacteria 9822
26 Ga0070675_100048121 3300005354 Unclassified 3495
27 Ga0070671_100088418 3300005355 Bacteria 2593
28 Ga0070674_100218683 3300005356 Bacteria 1481
29 Ga0070674_100308990 3300005356 Unclassified 1263
30 Ga0070673_100004846 3300005364 Bacteria 8561
31 Ga0070673_100067086 3300005364 Bacteria 2868
32 Ga0070673_100107389 3300005364 Unclassified 2309
33 Ga0070688_100271721 3300005365 Bacteria 1215
34 Ga0070659_100019310 3300005366 Bacteria 5162
35 Ga0070659_100107266 3300005366 Unclassified 2252
36 Ga0070667_100003314 3300005367 Bacteria 13764
37 Ga0070667_100122856 3300005367 Viruses 2260
38 Ga0070667_100541751 3300005367 Unclassified 1069
39 Ga0070713_100132460 3300005436 Bacteria 2200
40 Ga0070701_10174307 3300005438 Unclassified 1255
41 Ga0070694_100069785 3300005444 Bacteria 2418
42 Ga0070678_100050653 3300005456 Bacteria 3006
43 Ga0070662_100236550 3300005457 Viruses 1463
44 Ga0070681_10003717 3300005458 Bacteria 14316
45 Ga0070681_10240567 3300005458 Bacteria 1724
46 Ga0070685_10004756 3300005466 Bacteria 6871
47 Ga0070685_10037400 3300005466 Bacteria 2749
48 Ga0070707_100032343 3300005468 Bacteria 4984
49 Ga0070699_100009876 3300005518 Bacteria 8265
50 Ga0070679_100001792 3300005530 Bacteria 19371
51 Ga0070684_100005277 3300005535 Bacteria 9889
52 Ga0068853_100047220 3300005539 Unclassified 3695
53 Ga0070672_100230260 3300005543 Bacteria 1556
54 Ga0070686_100027552 3300005544 Bacteria 3439
55 Ga0070693_100012987 3300005547 Bacteria 4230
56 Ga0068855_100004072 3300005563 Bacteria 17834
57 Ga0068855_100024838 3300005563 Bacteria 7169
58 Ga0068855_100029202 3300005563 Bacteria 6595
59 Ga0070664_100056795 3300005564 Bacteria 3326
60 Ga0070664_100560466 3300005564 Bacteria 1057
61 Ga0068857_100000649 3300005577 Bacteria 25619
62 Ga0068857_100010359 3300005577 Bacteria 8100
63 Ga0068857_100128898 3300005577 Bacteria 2281
64 Ga0068857_100246029 3300005577 Bacteria 1638
65 Ga0068854_100030815 3300005578 Bacteria 3723
66 Ga0068856_100003011 3300005614 Bacteria 17249
67 Ga0068856_100006846 3300005614 Bacteria 11148
68 Ga0068856_100026053 3300005614 Bacteria 5703
69 Ga0068856_100126682 3300005614 Unclassified 2557
70 Ga0068856_100207325 3300005614 Unclassified 1975
71 Ga0068852_100130602 3300005616 Bacteria 2313
72 Ga0068859_100003955 3300005617 Bacteria 15123
73 Ga0068859_100028328 3300005617 Bacteria 5615
74 Ga0068864_100351205 3300005618 Unclassified 1391
75 Ga0068863_100002403 3300005841 Bacteria 18599
76 Ga0068863_100408835 3300005841 Unclassified 1328
77 Ga0068858_100105099 3300005842 Bacteria 2635
78 Ga0068858_100108751 3300005842 Bacteria 2588
79 Ga0068860_100003764 3300005843 Bacteria 15598
80 Ga0068862_100374167 3300005844 Bacteria 1327
81 Ga0081539_10000071 3300005985 Bacteria 233094
82 Ga0081539_10000644 3300005985 Bacteria 70362
83 Ga0097621_100000337 3300006237 Bacteria 32009
84 Ga0097621_100003458 3300006237 Bacteria 10883
85 Ga0097621_100007828 3300006237 Bacteria 7663
86 Ga0097621_100283406 3300006237 Viruses 1459
87 Ga0068871_100002426 3300006358 Bacteria 12730
88 Ga0068871_100002861 3300006358 Bacteria 11824
89 Ga0068871_100007916 3300006358 Bacteria 7620
90 Ga0068871_100162980 3300006358 Bacteria 1908
91 Ga0068871_100317431 3300006358 Viruses 1371
92 Ga0075428_100015205 3300006844 Bacteria 8538
93 Ga0075428_100418704 3300006844 Bacteria 1435
94 Ga0075430_100000640 3300006846 Bacteria 26659
95 Ga0075430_100038310 3300006846 Bacteria 4061
96 Ga0075430_100136894 3300006846 Bacteria 2040
97 Ga0075431_100005637 3300006847 Bacteria 12370
98 Ga0075431_100031195 3300006847 Bacteria 5490
99 Ga0075431_100036746 3300006847 Bacteria 5045
100 Ga0075431_100186697 3300006847 Bacteria 2126
101 Ga0075431_100552815 3300006847 Bacteria 1138
102 Ga0075433_10086472 3300006852 Bacteria 2768
103 Ga0075434_100000056 3300006871 Bacteria 55889
104 Ga0075434_100006278 3300006871 Bacteria 10888
105 Ga0075434_100017269 3300006871 Bacteria 6950
106 Ga0075434_100263462 3300006871 Unclassified 1743
107 Ga0075434_100574182 3300006871 Unclassified 1147
108 Ga0075429_100000690 3300006880 Bacteria 26282
109 Ga0075429_100232079 3300006880 Bacteria 1616
110 Ga0068865_100003256 3300006881 Bacteria 9730
111 Ga0068865_100369680 3300006881 Bacteria 1166
112 Ga0075436_100003185 3300006914 Bacteria 11255
113 Ga0097620_100003955 3300006931 Bacteria 15123
114 Ga0097620_100028329 3300006931 Bacteria 5615
115 Ga0075435_100000083 3300007076 Bacteria 49520
116 Ga0075435_100016839 3300007076 Bacteria 5518
117 Ga0105240_10000963 3300009093 Bacteria 51309
118 Ga0105240_10031048 3300009093 Bacteria 6934
119 Ga0105240_10057859 3300009093 Bacteria 4840
120 Ga0105240_10119557 3300009093 Bacteria 3173
121 Ga0105240_10163275 3300009093 Bacteria 2644
122 Ga0111539_10000523 3300009094 Bacteria 48534
123 Ga0111539_10003992 3300009094 Bacteria 19383
124 Ga0111539_10027813 3300009094 Bacteria 6905
125 Ga0111539_10097195 3300009094 Unclassified 3459
126 Ga0111539_10151429 3300009094 Bacteria 2715
127 Ga0111539_10320863 3300009094 Bacteria 1803
128 Ga0111539_10390620 3300009094 Bacteria 1620
129 Ga0111539_10565317 3300009094 Unclassified 1324
130 Ga0105245_10009184 3300009098 Bacteria 8619
131 Ga0105245_10025976 3300009098 Bacteria 5153
132 Ga0105245_10258312 3300009098 Bacteria 1695
133 Ga0105245_10258313 3300009098 Bacteria 1695
134 Ga0105245_10422883 3300009098 Bacteria 1336
135 Ga0114129_10056694 3300009147 Bacteria 5486
136 Ga0114129_10613991 3300009147 Bacteria 1407
137 Ga0105241_10025996 3300009174 Bacteria 4354
138 Ga0105242_10003792 3300009176 Bacteria 11748
139 Ga0105242_10004777 3300009176 Bacteria 10489
140 Ga0105242_10098434 3300009176 Bacteria 2474
141 Ga0105242_10345052 3300009176 Bacteria 1373
142 Ga0105248_10000355 3300009177 Bacteria 53533
143 Ga0105248_10004859 3300009177 Bacteria 14883
144 Ga0105248_10014785 3300009177 Bacteria 8594
145 Ga0105248_10121677 3300009177 Bacteria 2944
146 Ga0105248_10122524 3300009177 Bacteria 2933
147 Ga0105248_10220732 3300009177 Bacteria 2134
148 Ga0105248_10307219 3300009177 Bacteria 1786
149 Ga0105237_10007613 3300009545 Bacteria 11835
150 Ga0105237_10014118 3300009545 Bacteria 8358
151 Ga0105238_10001039 3300009551 Bacteria 28171
152 Ga0105238_10007410 3300009551 Bacteria 10991
153 Ga0105249_10210071 3300009553 Bacteria 1910
154 Ga0105249_10499522 3300009553 Bacteria 1261
155 Ga0105239_10005935 3300010375 Bacteria 14211
156 Ga0105239_10007346 3300010375 Bacteria 12657
157 Ga0105246_10157691 3300011119 Unclassified 1726
158 Ga0157370_10011333 3300013104 Bacteria 9337
159 Ga0157370_10015136 3300013104 Bacteria 7857
160 Ga0157369_10002021 3300013105 Bacteria 24465
161 Ga0157369_10002722 3300013105 Bacteria 21103
162 Ga0157374_10094182 3300013296 Bacteria 2862
163 Ga0157374_10236897 3300013296 Viruses 1794
164 Ga0157374_10291809 3300013296 Bacteria 1612
165 Ga0157378_10087648 3300013297 Bacteria 2823
166 Ga0157378_10108873 3300013297 Bacteria 2538
167 Ga0163162_10071470 3300013306 Bacteria 3523
168 Ga0157372_10011786 3300013307 Bacteria 9314
169 Ga0157372_10026591 3300013307 Bacteria 6296
170 Ga0157372_10168124 3300013307 Bacteria 2536
171 Ga0157372_10482723 3300013307 Unclassified 1445
172 Ga0157375_10001832 3300013308 Bacteria 18254
173 Ga0157375_10004664 3300013308 Bacteria 11918
174 Ga0157375_10121743 3300013308 Bacteria 2719
175 Ga0163163_10056785 3300014325 Bacteria 3869
176 Ga0163163_10061777 3300014325 Bacteria 3712
177 Ga0163163_10066246 3300014325 Bacteria 3587
178 Ga0163163_10106846 3300014325 Bacteria 2825
179 Ga0163163_10488401 3300014325 Viruses 1293
180 Ga0157380_10090269 3300014326 Bacteria 2527
181 Ga0157380_10237551 3300014326 Bacteria 1641
182 Ga0157379_10002588 3300014968 Bacteria 15196
183 Ga0157379_10054522 3300014968 Bacteria 3572
184 Ga0157379_10197662 3300014968 Unclassified 1818
185 Ga0157376_10002785 3300014969 Bacteria 11941
186 Ga0157376_10023262 3300014969 Bacteria 4847
187 Ga0157376_10208914 3300014969 Bacteria 1801
188 Ga0157376_10588170 3300014969 Bacteria 1106
189 Ga0207680_10016917 3300025903 Bacteria 3842
190 Ga0207680_10018204 3300025903 Bacteria 3728
191 Ga0207645_10134753 3300025907 Bacteria 1608
192 Ga0207643_10013369 3300025908 Unclassified 4445
193 Ga0207643_10016828 3300025908 Bacteria 3989
194 Ga0207654_10005443 3300025911 Bacteria 6440
195 Ga0207707_10000239 3300025912 Bacteria 59651
196 Ga0207707_10180546 3300025912 Bacteria 1843
197 Ga0207695_10001394 3300025913 Bacteria 40823
198 Ga0207695_10004776 3300025913 Bacteria 18327
199 Ga0207695_10166408 3300025913 Bacteria 2133
200 Ga0207671_10009995 3300025914 Bacteria 7881
201 Ga0207671_10027047 3300025914 Bacteria 4291
202 Ga0207660_10005284 3300025917 Bacteria 8400
203 Ga0207657_10024195 3300025919 Bacteria 5635
204 Ga0207657_10040857 3300025919 Bacteria 4106
205 Ga0207657_10245844 3300025919 Bacteria 1427
206 Ga0207649_10074708 3300025920 Bacteria 2176
207 Ga0207649_10115011 3300025920 Viruses 1804
208 Ga0207652_10012699 3300025921 Bacteria 6811
209 Ga0207646_10006895 3300025922 Bacteria 11668
210 Ga0207681_10221454 3300025923 Bacteria 1464
211 Ga0207694_10001414 3300025924 Bacteria 20570
212 Ga0207650_10031701 3300025925 Bacteria 3819
213 Ga0207650_10395109 3300025925 Bacteria 1144
214 Ga0207659_10000559 3300025926 Bacteria 22351
215 Ga0207659_10019950 3300025926 Bacteria 4423
216 Ga0207659_10060432 3300025926 Bacteria 2728
217 Ga0207687_10001984 3300025927 Bacteria 14060
218 Ga0207687_10004374 3300025927 Bacteria 9426
219 Ga0207687_10014097 3300025927 Bacteria 5227
220 Ga0207644_10316334 3300025931 Unclassified 1261
221 Ga0207690_10014209 3300025932 Bacteria 4805
222 Ga0207706_10286830 3300025933 Viruses 1435
223 Ga0207686_10002001 3300025934 Bacteria 11245
224 Ga0207686_10019536 3300025934 Bacteria 3856
225 Ga0207670_10271048 3300025936 Unclassified 1319
226 Ga0207669_10269371 3300025937 Unclassified 1278
227 Ga0207704_10004173 3300025938 Bacteria 6594
228 Ga0207704_10222860 3300025938 Bacteria 1397
229 Ga0207704_10347175 3300025938 Bacteria 1154
230 Ga0207691_10013218 3300025940 Bacteria 7906
231 Ga0207691_10093131 3300025940 Bacteria 2698
232 Ga0207691_10186813 3300025940 Bacteria 1809
233 Ga0207711_10002193 3300025941 Bacteria 17534
234 Ga0207711_10007323 3300025941 Bacteria 9238
235 Ga0207711_10011776 3300025941 Bacteria 7265
236 Ga0207711_10019017 3300025941 Bacteria 5716
237 Ga0207711_10056529 3300025941 Bacteria 3372
238 Ga0207711_10422572 3300025941 Unclassified 1240
239 Ga0207689_10019906 3300025942 Bacteria 5652
240 Ga0207689_10127858 3300025942 Bacteria 2090
241 Ga0207661_10005264 3300025944 Bacteria 9103
242 Ga0207679_10088100 3300025945 Bacteria 2392
243 Ga0207667_10006442 3300025949 Bacteria 14212
244 Ga0207667_10009474 3300025949 Bacteria 11467
245 Ga0207667_10024064 3300025949 Bacteria 6697
246 Ga0207651_10094727 3300025960 Bacteria 2196
247 Ga0207651_10106541 3300025960 Bacteria 2093
248 Ga0207651_10331118 3300025960 Unclassified 1276
249 Ga0207712_10062914 3300025961 Bacteria 2640
250 Ga0207640_10088088 3300025981 Bacteria 2142
251 Ga0207658_10056880 3300025986 Bacteria 2904
252 Ga0207639_10312537 3300026041 Unclassified 1392
253 Ga0207702_10004164 3300026078 Bacteria 12953
254 Ga0207702_10021437 3300026078 Bacteria 5350
255 Ga0207702_10047826 3300026078 Bacteria 3605
256 Ga0207702_10130627 3300026078 Unclassified 2260
257 Ga0207641_10008280 3300026088 Bacteria 8594
258 Ga0207641_10290779 3300026088 Unclassified 1540
259 Ga0207648_10019346 3300026089 Bacteria 6146
260 Ga0207648_10186657 3300026089 Bacteria 1837
261 Ga0207648_10577087 3300026089 Unclassified 1035
262 Ga0207674_10000035 3300026116 Bacteria 136262
263 Ga0207674_10016507 3300026116 Bacteria 8079
264 Ga0207674_10141180 3300026116 Bacteria 2368
265 Ga0207674_10288823 3300026116 Bacteria 1589
266 Ga0207675_100244113 3300026118 Bacteria 1736
267 Ga0207683_10013664 3300026121 Bacteria 6924
268 Ga0207683_10079066 3300026121 Bacteria 2915
269 Ga0207698_10026786 3300026142 Bacteria 4083
270 Ga0207698_10338889 3300026142 Bacteria 1415
271 Ga0209966_1017707 3300027695 Bacteria 1360
272 Ga0207428_10004574 3300027907 Bacteria 13114
273 Ga0207428_10004996 3300027907 Bacteria 12470
274 Ga0207428_10254812 3300027907 Bacteria 1308
275 Ga0268264_10006172 3300028381 Bacteria 10120
276 Ga0268264_10032883 3300028381 Bacteria 4257
277 Ga0265338_10027475 3300028800 Bacteria 5709
278 Ga0265340_10034568 3300031247 Unclassified 2513
279 Ga0307408_100011220 3300031548 Bacteria 5918
280 Ga0265313_10020119 3300031595 Bacteria 3690
281 Ga0265314_10001933 3300031711 Bacteria 22126
282 Ga0307410_10078705 3300031852 Bacteria 2308
283 Ga0307409_100312688 3300031995 Unclassified 1467
284 Ga0307416_100021709 3300032002 Bacteria 4616
285 Ga0307414_10079262 3300032004 Bacteria 2397
286 Ga0307414_10247352 3300032004 Bacteria 1480
287 Ga0307411_10022380 3300032005 Bacteria 3720
288 Ga0373934_0025593 3300035086 Bacteria 2287
289 Ga0373949_0007021 3300035090 Bacteria 2470
290 Ga0373936_0009493 3300035113 Bacteria 3669
291 Ga0373954_0001076 3300035118 Bacteria 10910
292 Ga0373935_0275233 3300035692 Bacteria 1184
293 Ga0373937_0002654 3300036401 Bacteria 14905
294 Ga0373937_0004958 3300036401 Bacteria 11319
295 Ga0373937_0186410 3300036401 Bacteria 1949
296 Ga0373925_0308382 3300037068 Bacteria 1279
297 Ga0439464_0027088 3300042439 Bacteria 1593
298 Ga0451576_0442819 3300045051 Bacteria 1364
299 Ga0451576_0850385 3300045051 Unclassified 958
300 Ga0495629_0084467 3300046459 Unclassified 2215
301 Ga0495653_0274197 3300046463 Unclassified 1110
302 Ga0495582_0028577 3300046473 Unclassified 3060
303 Ga0495639_0034418 3300046475 Bacteria 2266
304 Ga0495594_0046338 3300046499 Unclassified 2388
305 Ga0495608_0010217 3300046511 Bacteria 6552
306 Ga0495618_0122696 3300046514 Bacteria 1664
307 Ga0495628_0093667 3300046516 Bacteria 2323
308 Ga0495630_0018137 3300046517 Bacteria 5167
309 Ga0495586_0013480 3300046535 Bacteria 4336
310 Ga0495586_0034474 3300046535 Bacteria 2719
311 Ga0495586_0169697 3300046535 Bacteria 1233
312 Ga0495587_0019880 3300046536 Unclassified 4150
313 Ga0495645_0185113 3300046543 Bacteria 1423
314 Ga0495645_0304849 3300046543 Bacteria 1039
315 Ga0495635_0232961 3300046663 Unclassified 1244
316 Ga0495588_0074812 3300046674 Bacteria 1764
317 Ga0495623_0040551 3300046679 Bacteria 2973
318 Ga0495647_0031455 3300046681 Unclassified 1974
319 Ga0495658_0063116 3300046683 Unclassified 2131
320 Ga0495658_0099863 3300046683 Unclassified 1731
321 Ga0495669_0002234 3300046684 Bacteria 7943
322 Ga0495669_0016410 3300046684 Unclassified 3172
323 Ga0495613_0006810 3300046689 Bacteria 8535
324 Ga0495613_0256210 3300046689 Unclassified 1220
325 Ga0495600_0018794 3300046809 Bacteria 4408
326 Ga0495604_0064794 3300047317 Bacteria 2783
327 Ga0495674_0014808 3300047319 Bacteria 7296
328 Ga0495674_0150636 3300047319 Unclassified 1951
329 Ga0495675_0160526 3300047444 Unclassified 1384
330 Ga0495684_0000200 3300047471 Bacteria 46110
331 Ga0495684_0250066 3300047471 Viruses 1290
332 Ga0495602_0002316 3300048088 Bacteria 19251
333 Ga0495602_0117086 3300048088 Unclassified 2152
334 Ga0496104_0384961 3300048907 Bacteria 1315
335 Ga0496112_0196381 3300048915 Viruses 1978
336 Ga0496115_0171393 3300048918 Bacteria 1795
337 nmdc:mga05p37_148910_c1 3300050507 Bacteria 2865
338 nmdc:mga05p37_204139_c1 3300050507 Unclassified 2392
339 nmdc:mga05p37_253048_c1 3300050507 Unclassified 2112
340 nmdc:mga05p37_495292_c1 3300050507 Bacteria 1404
341 nmdc:mga09592_19728_c1 3300050508 Bacteria 5537
342 nmdc:mga0qj67_2760_c1 3300050509 Bacteria 12598
343 nmdc:mga0qj67_455830_c1 3300050509 Bacteria 1030
344 nmdc:mga0qj67_61382_c1 3300050509 Bacteria 2985
345 nmdc:mga06r32_185672_c1 3300050510 Bacteria 2066
346 nmdc:mga06r32_62477_c1 3300050510 Unclassified 3588
347 nmdc:mga06r32_6704_c1 3300050510 Bacteria 10348
348 nmdc:mga08y16_148090_c1 3300050511 Unclassified 2440
349 nmdc:mga08y16_172355_c1 3300050511 Bacteria 2248
350 nmdc:mga08y16_415325_c1 3300050511 Bacteria 1376
351 nmdc:mga08y16_9570_c1 3300050511 Bacteria 10172
352 nmdc:mga0n895_10234_c1 3300050512 Bacteria 8263
353 nmdc:mga0n895_11904_c1 3300050512 Bacteria 7784
354 nmdc:mga0n895_353991_c1 3300050512 Unclassified 1487
355 nmdc:mga0n895_54407_c1 3300050512 Bacteria 3937
356 nmdc:mga0n895_554748_c1 3300050512 Bacteria 1154
357 nmdc:mga0n895_704063_c1 3300050512 Unclassified 1006
358 nmdc:mga0n895_7_c1 3300050512 Bacteria 121855
359 nmdc:mga0rr50_225661_c1 3300050513 Bacteria 1548
360 nmdc:mga0rr50_35367_c1 3300050513 Bacteria 3587
361 nmdc:mga0rr50_3_c1 3300050513 Bacteria 353622
362 nmdc:mga08x19_443159_c1 3300050514 Unclassified 914
363 nmdc:mga08x19_853_c1 3300050514 Bacteria 19357
364 nmdc:mga0a205_167130_c1 3300050515 Unclassified 2095
365 nmdc:mga0a205_1812_c1 3300050515 Bacteria 18495
366 Ga0495619_0008785 3300053085 Bacteria 6389
367 Ga0070707_100003171
368 JGI25406J46586_10000661
369 Ga0065712_10001369
370 Ga0065715_10038127
371 Ga0065707_10280742
372 Ga0070683_100001354
373 Ga0070683_100005826
374 Ga0070670_100047447
375 Ga0068869_100111576
376 Ga0068869_100174211
377 Ga0070666_10012739
378 Ga0070666_10025580
379 Ga0070666_10126873
380 Ga0070660_100016512
381 Ga0070689_100044472
382 Ga0070691_10012676
383 Ga0070691_10076052
384 Ga0070687_100187639
385 Ga0070661_100056378
386 Ga0070661_100091410
387 Ga0070661_100100088
388 Ga0070669_100079977
389 Ga0070669_100229831
390 Ga0070675_100004384
391 Ga0070675_100005342
392 Ga0070675_100048121
393 Ga0070671_100088418
394 Ga0070674_100218683
395 Ga0070674_100308990
396 Ga0070673_100004846
397 Ga0070673_100067086
398 Ga0070673_100107389
399 Ga0070688_100271721
400 Ga0070659_100019310
401 Ga0070659_100107266
402 Ga0070667_100003314
403 Ga0070667_100122856
404 Ga0070667_100541751
405 Ga0070713_100132460
406 Ga0070701_10174307
407 Ga0070694_100069785
408 Ga0070678_100050653
409 Ga0070662_100236550
410 Ga0070681_10003717
411 Ga0070681_10240567
412 Ga0070685_10004756
413 Ga0070685_10037400
414 Ga0070707_100032343
415 Ga0070699_100009876
416 Ga0070679_100001792
417 Ga0070684_100005277
418 Ga0068853_100047220
419 Ga0070672_100230260
420 Ga0070686_100027552
421 Ga0070693_100012987
422 Ga0068855_100004072
423 Ga0068855_100024838
424 Ga0068855_100029202
425 Ga0070664_100056795
426 Ga0070664_100560466
427 Ga0068857_100000649
428 Ga0068857_100010359
429 Ga0068857_100128898
430 Ga0068857_100246029
431 Ga0068854_100030815
432 Ga0068856_100003011
433 Ga0068856_100006846
434 Ga0068856_100026053
435 Ga0068856_100126682
436 Ga0068856_100207325
437 Ga0068852_100130602
438 Ga0068859_100003955
439 Ga0068859_100028328
440 Ga0068864_100351205
441 Ga0068863_100002403
442 Ga0068863_100408835
443 Ga0068858_100105099
444 Ga0068858_100108751
445 Ga0068860_100003764
446 Ga0068862_100374167
447 Ga0081539_10000071
448 Ga0081539_10000644
449 Ga0097621_100000337
450 Ga0097621_100003458
451 Ga0097621_100007828
452 Ga0097621_100283406
453 Ga0068871_100002426
454 Ga0068871_100002861
455 Ga0068871_100007916
456 Ga0068871_100162980
457 Ga0068871_100317431
458 Ga0075428_100015205
459 Ga0075428_100418704
460 Ga0075430_100000640
461 Ga0075430_100038310
462 Ga0075430_100136894
463 Ga0075431_100005637
464 Ga0075431_100031195
465 Ga0075431_100036746
466 Ga0075431_100186697
467 Ga0075431_100552815
468 Ga0075433_10086472
469 Ga0075434_100000056
470 Ga0075434_100006278
471 Ga0075434_100017269
472 Ga0075434_100263462
473 Ga0075434_100574182
474 Ga0075429_100000690
475 Ga0075429_100232079
476 Ga0068865_100003256
477 Ga0068865_100369680
478 Ga0075436_100003185
479 Ga0097620_100003955
480 Ga0097620_100028329
481 Ga0075435_100000083
482 Ga0075435_100016839
483 Ga0105240_10000963
484 Ga0105240_10031048
485 Ga0105240_10057859
486 Ga0105240_10119557
487 Ga0105240_10163275
488 Ga0111539_10000523
489 Ga0111539_10003992
490 Ga0111539_10027813
491 Ga0111539_10097195
492 Ga0111539_10151429
493 Ga0111539_10320863
494 Ga0111539_10390620
495 Ga0111539_10565317
496 Ga0105245_10009184
497 Ga0105245_10025976
498 Ga0105245_10258312
499 Ga0105245_10258313
500 Ga0105245_10422883
501 Ga0114129_10056694
502 Ga0114129_10613991
503 Ga0105241_10025996
504 Ga0105242_10003792
505 Ga0105242_10004777
506 Ga0105242_10098434
507 Ga0105242_10345052
508 Ga0105248_10000355
509 Ga0105248_10004859
510 Ga0105248_10014785
511 Ga0105248_10121677
512 Ga0105248_10122524
513 Ga0105248_10220732
514 Ga0105248_10307219
515 Ga0105237_10007613
516 Ga0105237_10014118
517 Ga0105238_10001039
518 Ga0105238_10007410
519 Ga0105249_10210071
520 Ga0105249_10499522
521 Ga0105239_10005935
522 Ga0105239_10007346
523 Ga0105246_10157691
524 Ga0157370_10011333
525 Ga0157370_10015136
526 Ga0157369_10002021
527 Ga0157369_10002722
528 Ga0157374_10094182
529 Ga0157374_10236897
530 Ga0157374_10291809
531 Ga0157378_10087648
532 Ga0157378_10108873
533 Ga0163162_10071470
534 Ga0157372_10011786
535 Ga0157372_10026591
536 Ga0157372_10168124
537 Ga0157372_10482723
538 Ga0157375_10001832
539 Ga0157375_10004664
540 Ga0157375_10121743
541 Ga0163163_10056785
542 Ga0163163_10061777
543 Ga0163163_10066246
544 Ga0163163_10106846
545 Ga0163163_10488401
546 Ga0157380_10090269
547 Ga0157380_10237551
548 Ga0157379_10002588
549 Ga0157379_10054522
550 Ga0157379_10197662
551 Ga0157376_10002785
552 Ga0157376_10023262
553 Ga0157376_10208914
554 Ga0157376_10588170
555 Ga0207680_10016917
556 Ga0207680_10018204
557 Ga0207645_10134753
558 Ga0207643_10013369
559 Ga0207643_10016828
560 Ga0207654_10005443
561 Ga0207707_10000239
562 Ga0207707_10180546
563 Ga0207695_10001394
564 Ga0207695_10004776
565 Ga0207695_10166408
566 Ga0207671_10009995
567 Ga0207671_10027047
568 Ga0207660_10005284
569 Ga0207657_10024195
570 Ga0207657_10040857
571 Ga0207657_10245844
572 Ga0207649_10074708
573 Ga0207649_10115011
574 Ga0207652_10012699
575 Ga0207646_10006895
576 Ga0207681_10221454
577 Ga0207694_10001414
578 Ga0207650_10031701
579 Ga0207650_10395109
580 Ga0207659_10000559
581 Ga0207659_10019950
582 Ga0207659_10060432
583 Ga0207687_10001984
584 Ga0207687_10004374
585 Ga0207687_10014097
586 Ga0207644_10316334
587 Ga0207690_10014209
588 Ga0207706_10286830
589 Ga0207686_10002001
590 Ga0207686_10019536
591 Ga0207670_10271048
592 Ga0207669_10269371
593 Ga0207704_10004173
594 Ga0207704_10222860
595 Ga0207704_10347175
596 Ga0207691_10013218
597 Ga0207691_10093131
598 Ga0207691_10186813
599 Ga0207711_10002193
600 Ga0207711_10007323
601 Ga0207711_10011776
602 Ga0207711_10019017
603 Ga0207711_10056529
604 Ga0207711_10422572
605 Ga0207689_10019906
606 Ga0207689_10127858
607 Ga0207661_10005264
608 Ga0207679_10088100
609 Ga0207667_10006442
610 Ga0207667_10009474
611 Ga0207667_10024064
612 Ga0207651_10094727
613 Ga0207651_10106541
614 Ga0207651_10331118
615 Ga0207712_10062914
616 Ga0207640_10088088
617 Ga0207658_10056880
618 Ga0207639_10312537
619 Ga0207702_10004164
620 Ga0207702_10021437
621 Ga0207702_10047826
622 Ga0207702_10130627
623 Ga0207641_10008280
624 Ga0207641_10290779
625 Ga0207648_10019346
626 Ga0207648_10186657
627 Ga0207648_10577087
628 Ga0207674_10000035
629 Ga0207674_10016507
630 Ga0207674_10141180
631 Ga0207674_10288823
632 Ga0207675_100244113
633 Ga0207683_10013664
634 Ga0207683_10079066
635 Ga0207698_10026786
636 Ga0207698_10338889
637 Ga0209966_1017707
638 Ga0207428_10004574
639 Ga0207428_10004996
640 Ga0207428_10254812
641 Ga0268264_10006172
642 Ga0268264_10032883
643 Ga0265338_10027475
644 Ga0265340_10034568
645 Ga0307408_100011220
646 Ga0265313_10020119
647 Ga0265314_10001933
648 Ga0307410_10078705
649 Ga0307409_100312688
650 Ga0307416_100021709
651 Ga0307414_10079262
652 Ga0307414_10247352
653 Ga0307411_10022380
654 Ga0373934_0025593
655 Ga0373949_0007021
656 Ga0373936_0009493
657 Ga0373954_0001076
658 Ga0373935_0275233
659 Ga0373937_0002654
660 Ga0373937_0004958
661 Ga0373937_0186410
662 Ga0373925_0308382
663 Ga0439464_0027088
664 Ga0451576_0442819
665 Ga0451576_0850385
666 Ga0495629_0084467
667 Ga0495653_0274197
668 Ga0495582_0028577
669 Ga0495639_0034418
670 Ga0495594_0046338
671 Ga0495608_0010217
672 Ga0495618_0122696
673 Ga0495628_0093667
674 Ga0495630_0018137
675 Ga0495586_0013480
676 Ga0495586_0034474
677 Ga0495586_0169697
678 Ga0495587_0019880
679 Ga0495645_0185113
680 Ga0495645_0304849
681 Ga0495635_0232961
682 Ga0495588_0074812
683 Ga0495623_0040551
684 Ga0495647_0031455
685 Ga0495658_0063116
686 Ga0495658_0099863
687 Ga0495669_0002234
688 Ga0495669_0016410
689 Ga0495613_0006810
690 Ga0495613_0256210
691 Ga0495600_0018794
692 Ga0495604_0064794
693 Ga0495674_0014808
694 Ga0495674_0150636
695 Ga0495675_0160526
696 Ga0495684_0000200
697 Ga0495684_0250066
698 Ga0495602_0002316
699 Ga0495602_0117086
700 Ga0496104_0384961
701 Ga0496112_0196381
702 Ga0496115_0171393
703 nmdc:mga05p37_148910_c1
704 nmdc:mga05p37_204139_c1
705 nmdc:mga05p37_253048_c1
706 nmdc:mga05p37_495292_c1
707 nmdc:mga09592_19728_c1
708 nmdc:mga0qj67_2760_c1
709 nmdc:mga0qj67_455830_c1
710 nmdc:mga0qj67_61382_c1
711 nmdc:mga06r32_185672_c1
712 nmdc:mga06r32_62477_c1
713 nmdc:mga06r32_6704_c1
714 nmdc:mga08y16_148090_c1
715 nmdc:mga08y16_172355_c1
716 nmdc:mga08y16_415325_c1
717 nmdc:mga08y16_9570_c1
718 nmdc:mga0n895_10234_c1
719 nmdc:mga0n895_11904_c1
720 nmdc:mga0n895_353991_c1
721 nmdc:mga0n895_54407_c1
722 nmdc:mga0n895_554748_c1
723 nmdc:mga0n895_704063_c1
724 nmdc:mga0n895_7_c1
725 nmdc:mga0rr50_225661_c1
726 nmdc:mga0rr50_35367_c1
727 nmdc:mga0rr50_3_c1
728 nmdc:mga08x19_443159_c1
729 nmdc:mga08x19_853_c1
730 nmdc:mga0a205_167130_c1
731 nmdc:mga0a205_1812_c1
732 Ga0495619_0008785

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06283

ThuA

Trehalose utilisation

55

300

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e5v-assembly2.cif.gz_B crystal structure of a putative thua-like protein (parmer_02418) from parabacteroides merdae atcc 43184 at 1.75 a resolution 0.9525 28 302
4e5v-assembly2.cif.gz_B crystal structure of a putative thua-like protein (parmer_02418) from parabacteroides merdae atcc 43184 at 1.75 a resolution 0.9359 28 302
1t0b-assembly2.cif.gz_E structure of thua-like protein from bacillus stearothermophilus 0.7321 28 297
1t0b-assembly2.cif.gz_E structure of thua-like protein from bacillus stearothermophilus 0.7266 28 297
4pxy-assembly1.cif.gz_A crystal structure of a putative thua-like protein (bacuni_01602) from bacteroides uniformis atcc 8492 at 1.50 a resolution 0.7137 27 282
ID Description Score Start End Superfamily
4e5vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9442 29 302 3.40.50.880
4e5vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9242 29 302 3.40.50.880
1t0bA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7409 28 297 3.40.50.880
1t0bA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7353 28 297 3.40.50.880
af_Q9VDS9_1_73_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6992 30 69 3.40.50.450
ID Description Score Start End GO Terms
AF-A0A369QND9-F1-model_v4 ThuA-like domain-containing protein 0.9917 24 307
AF-X1CIA7-F1-model_v4 ThuA-like domain-containing protein 0.9873 173 299
AF-A0A5B9Q8X0-F1-model_v4 Trehalose utilization 0.9852 26 299
AF-A0A286RIQ4-F1-model_v4 ThuA-like domain-containing protein 0.9847 24 299
AF-A0A3A0DA30-F1-model_v4 Trehalose utilization 0.9835 27 299

Map