F423940

General Info

Members Datasets Scaffolds Average Seq Length
366 183 732 116

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_101535629|Ga0070706_1015356292
Length 117
Sequence MSVQIEQVMAFETRTEPPGLEIQVNFGVFAGRDVTPAEIDELGGLLVPEVGDVSIVAEERHELGAGHEAAVHLVRIEVPAEELPDDGLPEFTQKLIGLAEIWARHCIAERHADVGDL

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
73 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
74 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
77 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
78 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
85 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
86 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
87 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
88 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
99 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
100 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
105 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
116 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
119 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
120 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
133 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
134 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
135 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
136 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
148 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
179 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
180 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
183 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.63
Metatranscriptomes 4.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.84
Rhizosphere 86.61
Stem 0
Stem Tuber 0
Unclassified 12.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_101535629 3300005467 Unclassified 608
2 Ga0070658_10016947 3300005327 Bacteria 5831
3 Ga0070658_10058517 3300005327 Bacteria 3137
4 Ga0070658_10302066 3300005327 Bacteria 1365
5 Ga0070658_11116114 3300005327 Bacteria 686
6 Ga0070683_100022148 3300005329 Bacteria 5677
7 Ga0070683_100025658 3300005329 Bacteria 5296
8 Ga0070683_100044879 3300005329 Bacteria 4078
9 Ga0070683_100258514 3300005329 Bacteria 1656
10 Ga0070683_100646133 3300005329 Bacteria 1013
11 Ga0070680_100001821 3300005336 Bacteria 15662
12 Ga0070680_100255906 3300005336 Unclassified 1481
13 Ga0070660_100024163 3300005339 Bacteria 4507
14 Ga0070660_100035061 3300005339 Bacteria 3795
15 Ga0070661_100027349 3300005344 Bacteria 4106
16 Ga0070661_100383678 3300005344 Bacteria 1108
17 Ga0070671_100105483 3300005355 Bacteria 2365
18 Ga0070673_101167413 3300005364 Bacteria 721
19 Ga0070659_101473366 3300005366 Bacteria 606
20 Ga0070713_100071431 3300005436 Bacteria 2933
21 Ga0070710_10433978 3300005437 Bacteria 887
22 Ga0070711_100087252 3300005439 Bacteria 2239
23 Ga0070708_100130143 3300005445 Bacteria 2328
24 Ga0070663_100602261 3300005455 Bacteria 924
25 Ga0070678_100488151 3300005456 Bacteria 1085
26 Ga0070681_10021526 3300005458 Bacteria 6462
27 Ga0070681_10038655 3300005458 Bacteria 4784
28 Ga0070681_10116726 3300005458 Bacteria 2606
29 Ga0070681_10260916 3300005458 Bacteria 1645
30 Ga0070679_100048412 3300005530 Bacteria 4235
31 Ga0070679_100051234 3300005530 Bacteria 4111
32 Ga0070679_100091009 3300005530 Bacteria 3038
33 Ga0070679_101353497 3300005530 Bacteria 658
34 Ga0070684_100022447 3300005535 Bacteria 5263
35 Ga0070684_100036481 3300005535 Bacteria 4212
36 Ga0070684_100089110 3300005535 Bacteria 2742
37 Ga0070686_100304622 3300005544 Bacteria 1183
38 Ga0070696_101024032 3300005546 Bacteria 691
39 Ga0068855_100058058 3300005563 Bacteria 4533
40 Ga0068855_100157088 3300005563 Unclassified 2583
41 Ga0068855_100189014 3300005563 Bacteria 2324
42 Ga0068855_100585363 3300005563 Bacteria 1205
43 Ga0070664_100793256 3300005564 Bacteria 885
44 Ga0068857_100153099 3300005577 Unclassified 2090
45 Ga0068856_100806656 3300005614 Bacteria 958
46 Ga0068856_100968028 3300005614 Bacteria 869
47 Ga0068856_101673878 3300005614 Bacteria 649
48 Ga0081455_10106188 3300005937 Bacteria 2242
49 Ga0081539_10393515 3300005985 Bacteria 577
50 Ga0070717_10014833 3300006028 Bacteria 5996
51 Ga0070717_10705200 3300006028 Bacteria 917
52 Ga0070712_100137205 3300006175 Bacteria 1861
53 Ga0070712_101775870 3300006175 Unclassified 540
54 Ga0097621_100256223 3300006237 Bacteria 1534
55 Ga0097621_100490314 3300006237 Bacteria 1112
56 Ga0075428_100097682 3300006844 Bacteria 3202
57 Ga0075433_10459332 3300006852 Unclassified 1122
58 Ga0075429_100857092 3300006880 Bacteria 795
59 Ga0075436_101034372 3300006914 Bacteria 617
60 Ga0075435_101657158 3300007076 Bacteria 561
61 Ga0105240_10122496 3300009093 Bacteria 3129
62 Ga0105240_10263794 3300009093 Bacteria 1986
63 Ga0111539_10286650 3300009094 Bacteria 1916
64 Ga0105245_10415412 3300009098 Bacteria 1347
65 Ga0105245_10430974 3300009098 Bacteria 1323
66 Ga0114129_10134295 3300009147 Unclassified 3396
67 Ga0105241_10807922 3300009174 Unclassified 864
68 Ga0105241_11406980 3300009174 Bacteria 668
69 Ga0105242_12107374 3300009176 Unclassified 608
70 Ga0157370_10020634 3300013104 Bacteria 6578
71 Ga0157370_10508701 3300013104 Unclassified 1106
72 Ga0157370_11648907 3300013104 Bacteria 576
73 Ga0157369_10003204 3300013105 Bacteria 19516
74 Ga0157369_10210927 3300013105 Bacteria 2036
75 Ga0157369_10265250 3300013105 Bacteria 1790
76 Ga0157369_10909077 3300013105 Bacteria 902
77 Ga0157369_11995854 3300013105 Unclassified 589
78 Ga0157374_11237657 3300013296 Bacteria 768
79 Ga0157372_10685649 3300013307 Bacteria 1193
80 Ga0157372_12059900 3300013307 Bacteria 656
81 Ga0157375_10539912 3300013308 Bacteria 1328
82 Ga0157376_10115513 3300014969 Bacteria 2370
83 Ga0157376_11687768 3300014969 Bacteria 669
84 Ga0182007_10164900 3300015262 Bacteria 759
85 Ga0197907_10568281 3300020069 Bacteria 831
86 Ga0206356_10351967 3300020070 Unclassified 953
87 Ga0206356_11665061 3300020070 Bacteria 1318
88 Ga0206356_11737688 3300020070 Bacteria 931
89 Ga0206356_11881609 3300020070 Bacteria 583
90 Ga0206349_1769807 3300020075 Bacteria 928
91 Ga0206350_11042906 3300020080 Bacteria 698
92 Ga0206354_10150461 3300020081 Unclassified 595
93 Ga0206354_10535781 3300020081 Bacteria 2018
94 Ga0206354_11117690 3300020081 Bacteria 2091
95 Ga0206353_10136701 3300020082 Bacteria 4288
96 Ga0206353_10329695 3300020082 Bacteria 6673
97 Ga0206353_10806529 3300020082 Bacteria 988
98 Ga0206353_11154255 3300020082 Bacteria 587
99 Ga0206353_11655849 3300020082 Bacteria 2551
100 Ga0224712_10090031 3300022467 Unclassified 1283
101 Ga0207705_10018516 3300025909 Bacteria 4979
102 Ga0207705_10054160 3300025909 Bacteria 2891
103 Ga0207707_10183480 3300025912 Bacteria 1826
104 Ga0207707_11153544 3300025912 Bacteria 629
105 Ga0207695_10175846 3300025913 Bacteria 2063
106 Ga0207695_10224296 3300025913 Bacteria 1786
107 Ga0207693_10065388 3300025915 Bacteria 2848
108 Ga0207693_10555219 3300025915 Bacteria 895
109 Ga0207693_11225582 3300025915 Unclassified 565
110 Ga0207693_11349891 3300025915 Unclassified 531
111 Ga0207660_10030805 3300025917 Bacteria 3689
112 Ga0207660_10124237 3300025917 Bacteria 1958
113 Ga0207660_10383976 3300025917 Unclassified 1129
114 Ga0207657_10001102 3300025919 Bacteria 28705
115 Ga0207657_10044083 3300025919 Bacteria 3924
116 Ga0207657_10233818 3300025919 Unclassified 1469
117 Ga0207649_10086877 3300025920 Bacteria 2039
118 Ga0207652_10063408 3300025921 Bacteria 3196
119 Ga0207652_10158786 3300025921 Bacteria 2026
120 Ga0207652_10334989 3300025921 Bacteria 1366
121 Ga0207644_10093747 3300025931 Bacteria 2242
122 Ga0207686_10082041 3300025934 Bacteria 2107
123 Ga0207686_10927686 3300025934 Bacteria 704
124 Ga0207665_10579945 3300025939 Bacteria 874
125 Ga0207661_10057916 3300025944 Bacteria 3117
126 Ga0207661_10243018 3300025944 Bacteria 1598
127 Ga0207661_10244981 3300025944 Bacteria 1591
128 Ga0207667_10055927 3300025949 Bacteria 4147
129 Ga0207667_10082238 3300025949 Bacteria 3336
130 Ga0207667_10164470 3300025949 Bacteria 2281
131 Ga0207667_10345107 3300025949 Unclassified 1519
132 Ga0207677_10860391 3300026023 Bacteria 815
133 Ga0207678_10923396 3300026067 Bacteria 772
134 Ga0207702_10739401 3300026078 Bacteria 971
135 Ga0207674_10078481 3300026116 Bacteria 3307
136 Ga0265334_10020740 3300028573 Bacteria 2689
137 Ga0265318_10067922 3300028577 Bacteria 1323
138 Ga0265322_10006813 3300028654 Bacteria 3353
139 Ga0265338_10030628 3300028800 Bacteria 5294
140 Ga0265332_10308290 3300031238 Bacteria 654
141 Ga0265325_10030497 3300031241 Bacteria 2891
142 Ga0265329_10094114 3300031242 Unclassified 952
143 Ga0265339_10022029 3300031249 Bacteria 3697
144 Ga0265331_10055885 3300031250 Bacteria 1876
145 Ga0265327_10021719 3300031251 Bacteria 3864
146 Ga0265327_10113862 3300031251 Bacteria 1289
147 Ga0265327_10240296 3300031251 Bacteria 809
148 Ga0265313_10017982 3300031595 Bacteria 3989
149 Ga0265314_10012772 3300031711 Bacteria 6827
150 Ga0373944_0087584 3300035089 Bacteria 1037
151 Ga0373936_0021258 3300035113 Bacteria 2523
152 Ga0373945_0000408 3300035116 Bacteria 12344
153 Ga0373945_0017530 3300035116 Bacteria 2425
154 Ga0373943_0017004 3300035170 Bacteria 3325
155 Ga0373946_0033747 3300035171 Unclassified 2062
156 Ga0373935_0005562 3300035692 Bacteria 7427
157 Ga0373927_0020989 3300035695 Bacteria 4281
158 Ga0373947_0001236 3300035725 Bacteria 15715
159 Ga0373925_0092663 3300037068 Bacteria 2311
160 Ga0395899_0119648 3300037312 Bacteria 1888
161 Ga0395899_0126113 3300037312 Bacteria 1831
162 Ga0395899_0160265 3300037312 Bacteria 1590
163 Ga0395899_0165165 3300037312 Bacteria 1562
164 Ga0395900_0123448 3300037418 Bacteria 2656
165 Ga0395900_0180547 3300037418 Unclassified 2145
166 Ga0395900_0431247 3300037418 Bacteria 1277
167 Ga0395900_0570155 3300037418 Bacteria 1075
168 Ga0395898_0002551 3300037466 Bacteria 21372
169 Ga0395898_0002750 3300037466 Bacteria 20274
170 Ga0395898_0051893 3300037466 Bacteria 4008
171 Ga0395898_0451401 3300037466 Bacteria 1224
172 Ga0395905_0009194 3300037471 Bacteria 9675
173 Ga0395905_0058841 3300037471 Bacteria 3593
174 Ga0395905_0141107 3300037471 Unclassified 2266
175 Ga0395905_0193545 3300037471 Bacteria 1907
176 Ga0395905_0262110 3300037471 Bacteria 1614
177 Ga0395905_0275554 3300037471 Bacteria 1568
178 Ga0395905_1805711 3300037471 Bacteria 517
179 Ga0395901_0007364 3300038443 Bacteria 11106
180 Ga0395901_0013761 3300038443 Bacteria 8223
181 Ga0395901_0030141 3300038443 Bacteria 5588
182 Ga0395901_0071723 3300038443 Bacteria 3610
183 Ga0395901_0098348 3300038443 Bacteria 3068
184 Ga0395901_0168786 3300038443 Bacteria 2296
185 Ga0395901_0259544 3300038443 Bacteria 1809
186 Ga0395901_0434578 3300038443 Bacteria 1344
187 Ga0395901_0868813 3300038443 Bacteria 886
188 Ga0451800_0301456 3300041459 Bacteria 989
189 Ga0451807_1318405 3300041486 Unclassified 1082
190 Ga0451853_0805954 3300041512 Unclassified 1109
191 Ga0451853_3120488 3300041512 Bacteria 1018
192 Ga0466966_0049444 3300044684 Bacteria 2678
193 Ga0466966_0301486 3300044684 Bacteria 963
194 Ga0466961_0024469 3300044693 Bacteria 3884
195 Ga0466961_0049962 3300044693 Bacteria 2672
196 Ga0466963_0076457 3300044694 Bacteria 2261
197 Ga0466964_0002151 3300044706 Bacteria 6954
198 Ga0466964_0129037 3300044706 Bacteria 1149
199 Ga0466964_0644907 3300044706 Bacteria 585
200 Ga0466970_0966375 3300044765 Bacteria 502
201 Ga0466959_0178805 3300045049 Bacteria 1485
202 Ga0466959_0429490 3300045049 Bacteria 896
203 Ga0451576_1336820 3300045051 Bacteria 747
204 Ga0466958_0039957 3300045836 Bacteria 2819
205 Ga0466958_0681587 3300045836 Bacteria 669
206 Ga0466958_1045592 3300045836 Bacteria 533
207 Ga0466967_0006542 3300045976 Bacteria 8266
208 Ga0466967_0023616 3300045976 Bacteria 5043
209 Ga0466967_0063895 3300045976 Bacteria 3272
210 Ga0466967_0341876 3300045976 Unclassified 1447
211 Ga0466967_0402048 3300045976 Bacteria 1333
212 Ga0466967_0497556 3300045976 Bacteria 1196
213 Ga0466967_1023658 3300045976 Bacteria 822
214 Ga0466967_1128857 3300045976 Unclassified 781
215 Ga0466967_2377269 3300045976 Unclassified 525
216 Ga0495603_0079944 3300046455 Bacteria 1916
217 Ga0495603_0482841 3300046455 Unclassified 710
218 Ga0495603_0684263 3300046455 Unclassified 587
219 Ga0495629_0108752 3300046459 Bacteria 1933
220 Ga0495629_0141682 3300046459 Bacteria 1673
221 Ga0495641_0005768 3300046461 Bacteria 8226
222 Ga0495641_0096819 3300046461 Bacteria 1317
223 Ga0495641_0207426 3300046461 Bacteria 878
224 Ga0495651_0020803 3300046462 Bacteria 5093
225 Ga0495651_0037660 3300046462 Bacteria 3766
226 Ga0495582_0000028 3300046473 Bacteria 79694
227 Ga0495582_0181071 3300046473 Bacteria 1201
228 Ga0495582_0840265 3300046473 Bacteria 531
229 Ga0495639_0000718 3300046475 Bacteria 15165
230 Ga0495639_0380928 3300046475 Unclassified 711
231 Ga0495662_0000448 3300046476 Bacteria 18533
232 Ga0495662_0057259 3300046476 Bacteria 1882
233 Ga0495664_0032688 3300046477 Bacteria 3054
234 Ga0495594_0099629 3300046499 Bacteria 1634
235 Ga0495608_0068386 3300046511 Bacteria 2322
236 Ga0495608_0079383 3300046511 Bacteria 2134
237 Ga0495608_0170149 3300046511 Bacteria 1382
238 Ga0495618_0024565 3300046514 Unclassified 3733
239 Ga0495618_0622915 3300046514 Bacteria 640
240 Ga0495628_0020342 3300046516 Bacteria 5477
241 Ga0495628_0067729 3300046516 Bacteria 2787
242 Ga0495630_0006834 3300046517 Bacteria 8134
243 Ga0495630_0222709 3300046517 Bacteria 1440
244 Ga0495630_0892901 3300046517 Bacteria 677
245 Ga0495630_0973560 3300046517 Unclassified 645
246 Ga0495666_0017436 3300046526 Unclassified 3577
247 Ga0495652_0054441 3300046529 Bacteria 3407
248 Ga0495652_0109670 3300046529 Bacteria 2221
249 Ga0495652_0214276 3300046529 Bacteria 1451
250 Ga0495665_0000510 3300046531 Bacteria 19612
251 Ga0495640_0009055 3300046533 Bacteria 7767
252 Ga0495640_0036319 3300046533 Bacteria 3482
253 Ga0495640_0346452 3300046533 Bacteria 917
254 Ga0495586_0489547 3300046535 Bacteria 710
255 Ga0495587_0139627 3300046536 Bacteria 1383
256 Ga0495587_0583469 3300046536 Bacteria 616
257 Ga0495587_0790837 3300046536 Bacteria 518
258 Ga0495667_0008351 3300046559 Bacteria 7024
259 Ga0495667_0015879 3300046559 Bacteria 5091
260 Ga0495667_0037093 3300046559 Bacteria 3250
261 Ga0495667_0260816 3300046559 Bacteria 1102
262 Ga0495667_0619218 3300046559 Bacteria 674
263 Ga0495634_0010792 3300046642 Bacteria 6683
264 Ga0495634_0054306 3300046642 Bacteria 2682
265 Ga0495635_0003733 3300046663 Bacteria 10569
266 Ga0495635_0073122 3300046663 Bacteria 2348
267 Ga0495657_0124099 3300046675 Bacteria 1624
268 Ga0495599_0057317 3300046678 Bacteria 2438
269 Ga0495623_0222595 3300046679 Bacteria 1074
270 Ga0495646_0075133 3300046680 Unclassified 1982
271 Ga0495647_0006272 3300046681 Bacteria 3931
272 Ga0495658_0000356 3300046683 Bacteria 25845
273 Ga0495613_0006132 3300046689 Bacteria 8997
274 Ga0495624_0012550 3300046690 Bacteria 5786
275 Ga0495600_0012918 3300046809 Bacteria 5234
276 Ga0495600_0307265 3300046809 Bacteria 999
277 Ga0495581_0000589 3300047315 Bacteria 18974
278 Ga0495581_0178660 3300047315 Bacteria 1241
279 Ga0495604_0105685 3300047317 Bacteria 2060
280 Ga0495604_0109354 3300047317 Bacteria 2018
281 Ga0495674_0002574 3300047319 Bacteria 17681
282 Ga0495674_0011910 3300047319 Bacteria 8198
283 Ga0495674_0049811 3300047319 Bacteria 3698
284 Ga0495674_0099305 3300047319 Unclassified 2478
285 Ga0495676_0002194 3300047321 Bacteria 17296
286 Ga0495676_0138803 3300047321 Bacteria 1744
287 Ga0495680_0007839 3300047322 Bacteria 9747
288 Ga0495680_0012591 3300047322 Bacteria 7434
289 Ga0495680_0022784 3300047322 Bacteria 5215
290 Ga0495684_0002226 3300047471 Bacteria 15534
291 Ga0495684_0115168 3300047471 Bacteria 2027
292 Ga0495593_0022860 3300047673 Bacteria 3479
293 Ga0495614_0013655 3300048089 Unclassified 3562
294 Ga0496100_0213619 3300048903 Bacteria 1412
295 Ga0496100_0494443 3300048903 Bacteria 942
296 Ga0496100_0906098 3300048903 Bacteria 692
297 Ga0496101_0064993 3300048904 Bacteria 2659
298 Ga0496101_0730536 3300048904 Bacteria 781
299 Ga0496102_0017031 3300048905 Bacteria 6360
300 Ga0496102_0233114 3300048905 Bacteria 1735
301 Ga0496102_1274312 3300048905 Unclassified 654
302 Ga0496103_0159288 3300048906 Bacteria 1447
303 Ga0496103_0369753 3300048906 Bacteria 921
304 Ga0496103_0887959 3300048906 Bacteria 559
305 Ga0496104_1092074 3300048907 Bacteria 701
306 Ga0496105_0035167 3300048908 Bacteria 4122
307 Ga0496105_1157625 3300048908 Bacteria 571
308 Ga0496106_1243608 3300048909 Bacteria 579
309 Ga0496107_0140112 3300048910 Bacteria 1787
310 Ga0496107_0155397 3300048910 Bacteria 1693
311 Ga0496108_0082617 3300048911 Bacteria 2724
312 Ga0496108_0128354 3300048911 Bacteria 2178
313 Ga0496108_0358429 3300048911 Bacteria 1273
314 Ga0496108_0562091 3300048911 Bacteria 995
315 Ga0496108_0871506 3300048911 Unclassified 774
316 Ga0496109_0083082 3300048912 Bacteria 2953
317 Ga0496109_0337613 3300048912 Bacteria 1423
318 Ga0496109_1651617 3300048912 Bacteria 575
319 Ga0496110_0375299 3300048913 Bacteria 1296
320 Ga0496110_0498148 3300048913 Unclassified 1109
321 Ga0496110_0640370 3300048913 Bacteria 962
322 Ga0496110_0898199 3300048913 Bacteria 792
323 Ga0496111_0040824 3300048914 Bacteria 3329
324 Ga0496111_0510738 3300048914 Unclassified 884
325 Ga0496111_0569781 3300048914 Bacteria 830
326 Ga0496112_0004745 3300048915 Bacteria 11585
327 Ga0496112_0008949 3300048915 Bacteria 8990
328 Ga0496112_0028006 3300048915 Bacteria 5435
329 Ga0496112_0318608 3300048915 Bacteria 1499
330 Ga0496113_0408690 3300048916 Bacteria 1090
331 Ga0496114_0004135 3300048917 Bacteria 11226
332 Ga0496114_0036083 3300048917 Bacteria 4086
333 Ga0496114_0074341 3300048917 Bacteria 2860
334 Ga0496114_0225653 3300048917 Bacteria 1645
335 Ga0496115_0012193 3300048918 Bacteria 6464
336 Ga0496115_0046722 3300048918 Bacteria 3461
337 Ga0496115_1018814 3300048918 Unclassified 632
338 Ga0496115_1353930 3300048918 Unclassified 528
339 Ga0501034_0456611 3300049571 Bacteria 1195
340 Ga0501038_0338768 3300049574 Bacteria 1173
341 Ga0501047_0143025 3300049581 Bacteria 2270
342 Ga0501047_0490672 3300049581 Bacteria 1055
343 Ga0501047_1336388 3300049581 Bacteria 531
344 Ga0501067_0001419 3300049583 Bacteria 12995
345 Ga0501069_0002078 3300049585 Bacteria 10076
346 Ga0501069_0047317 3300049585 Bacteria 2387
347 Ga0501070_0161501 3300049586 Bacteria 1847
348 Ga0501070_0264728 3300049586 Bacteria 1405
349 Ga0501070_0707127 3300049586 Unclassified 796
350 Ga0501074_0188561 3300049590 Bacteria 1470
351 Ga0501080_0924243 3300049742 Bacteria 759
352 Ga0501081_0695628 3300049743 Bacteria 763
353 Ga0501035_0247528 3300049822 Bacteria 1515
354 Ga0501044_0303540 3300049823 Bacteria 1525
355 nmdc:mga05p37_141395_c1 3300050507 Bacteria 2949
356 Ga0495601_0030786 3300053077 Bacteria 3333
357 Ga0495601_0716311 3300053077 Bacteria 638
358 Ga0495612_0076593 3300053078 Bacteria 1401
359 Ga0495612_0511355 3300053078 Bacteria 551
360 Ga0495655_0002183 3300053083 Bacteria 3087
361 Ga0495595_0006442 3300053084 Bacteria 4788
362 Ga0495619_0001192 3300053085 Bacteria 17116
363 Ga0495619_0007709 3300053085 Bacteria 6814
364 Ga0495619_0936051 3300053085 Bacteria 582
365 Ga0501082_1169448 3300060353 Bacteria 672
366 Ga0530510_0328225 3300061734 Unclassified 1147
367 Ga0070706_101535629
368 Ga0070658_10016947
369 Ga0070658_10058517
370 Ga0070658_10302066
371 Ga0070658_11116114
372 Ga0070683_100022148
373 Ga0070683_100025658
374 Ga0070683_100044879
375 Ga0070683_100258514
376 Ga0070683_100646133
377 Ga0070680_100001821
378 Ga0070680_100255906
379 Ga0070660_100024163
380 Ga0070660_100035061
381 Ga0070661_100027349
382 Ga0070661_100383678
383 Ga0070671_100105483
384 Ga0070673_101167413
385 Ga0070659_101473366
386 Ga0070713_100071431
387 Ga0070710_10433978
388 Ga0070711_100087252
389 Ga0070708_100130143
390 Ga0070663_100602261
391 Ga0070678_100488151
392 Ga0070681_10021526
393 Ga0070681_10038655
394 Ga0070681_10116726
395 Ga0070681_10260916
396 Ga0070679_100048412
397 Ga0070679_100051234
398 Ga0070679_100091009
399 Ga0070679_101353497
400 Ga0070684_100022447
401 Ga0070684_100036481
402 Ga0070684_100089110
403 Ga0070686_100304622
404 Ga0070696_101024032
405 Ga0068855_100058058
406 Ga0068855_100157088
407 Ga0068855_100189014
408 Ga0068855_100585363
409 Ga0070664_100793256
410 Ga0068857_100153099
411 Ga0068856_100806656
412 Ga0068856_100968028
413 Ga0068856_101673878
414 Ga0081455_10106188
415 Ga0081539_10393515
416 Ga0070717_10014833
417 Ga0070717_10705200
418 Ga0070712_100137205
419 Ga0070712_101775870
420 Ga0097621_100256223
421 Ga0097621_100490314
422 Ga0075428_100097682
423 Ga0075433_10459332
424 Ga0075429_100857092
425 Ga0075436_101034372
426 Ga0075435_101657158
427 Ga0105240_10122496
428 Ga0105240_10263794
429 Ga0111539_10286650
430 Ga0105245_10415412
431 Ga0105245_10430974
432 Ga0114129_10134295
433 Ga0105241_10807922
434 Ga0105241_11406980
435 Ga0105242_12107374
436 Ga0157370_10020634
437 Ga0157370_10508701
438 Ga0157370_11648907
439 Ga0157369_10003204
440 Ga0157369_10210927
441 Ga0157369_10265250
442 Ga0157369_10909077
443 Ga0157369_11995854
444 Ga0157374_11237657
445 Ga0157372_10685649
446 Ga0157372_12059900
447 Ga0157375_10539912
448 Ga0157376_10115513
449 Ga0157376_11687768
450 Ga0182007_10164900
451 Ga0197907_10568281
452 Ga0206356_10351967
453 Ga0206356_11665061
454 Ga0206356_11737688
455 Ga0206356_11881609
456 Ga0206349_1769807
457 Ga0206350_11042906
458 Ga0206354_10150461
459 Ga0206354_10535781
460 Ga0206354_11117690
461 Ga0206353_10136701
462 Ga0206353_10329695
463 Ga0206353_10806529
464 Ga0206353_11154255
465 Ga0206353_11655849
466 Ga0224712_10090031
467 Ga0207705_10018516
468 Ga0207705_10054160
469 Ga0207707_10183480
470 Ga0207707_11153544
471 Ga0207695_10175846
472 Ga0207695_10224296
473 Ga0207693_10065388
474 Ga0207693_10555219
475 Ga0207693_11225582
476 Ga0207693_11349891
477 Ga0207660_10030805
478 Ga0207660_10124237
479 Ga0207660_10383976
480 Ga0207657_10001102
481 Ga0207657_10044083
482 Ga0207657_10233818
483 Ga0207649_10086877
484 Ga0207652_10063408
485 Ga0207652_10158786
486 Ga0207652_10334989
487 Ga0207644_10093747
488 Ga0207686_10082041
489 Ga0207686_10927686
490 Ga0207665_10579945
491 Ga0207661_10057916
492 Ga0207661_10243018
493 Ga0207661_10244981
494 Ga0207667_10055927
495 Ga0207667_10082238
496 Ga0207667_10164470
497 Ga0207667_10345107
498 Ga0207677_10860391
499 Ga0207678_10923396
500 Ga0207702_10739401
501 Ga0207674_10078481
502 Ga0265334_10020740
503 Ga0265318_10067922
504 Ga0265322_10006813
505 Ga0265338_10030628
506 Ga0265332_10308290
507 Ga0265325_10030497
508 Ga0265329_10094114
509 Ga0265339_10022029
510 Ga0265331_10055885
511 Ga0265327_10021719
512 Ga0265327_10113862
513 Ga0265327_10240296
514 Ga0265313_10017982
515 Ga0265314_10012772
516 Ga0373944_0087584
517 Ga0373936_0021258
518 Ga0373945_0000408
519 Ga0373945_0017530
520 Ga0373943_0017004
521 Ga0373946_0033747
522 Ga0373935_0005562
523 Ga0373927_0020989
524 Ga0373947_0001236
525 Ga0373925_0092663
526 Ga0395899_0119648
527 Ga0395899_0126113
528 Ga0395899_0160265
529 Ga0395899_0165165
530 Ga0395900_0123448
531 Ga0395900_0180547
532 Ga0395900_0431247
533 Ga0395900_0570155
534 Ga0395898_0002551
535 Ga0395898_0002750
536 Ga0395898_0051893
537 Ga0395898_0451401
538 Ga0395905_0009194
539 Ga0395905_0058841
540 Ga0395905_0141107
541 Ga0395905_0193545
542 Ga0395905_0262110
543 Ga0395905_0275554
544 Ga0395905_1805711
545 Ga0395901_0007364
546 Ga0395901_0013761
547 Ga0395901_0030141
548 Ga0395901_0071723
549 Ga0395901_0098348
550 Ga0395901_0168786
551 Ga0395901_0259544
552 Ga0395901_0434578
553 Ga0395901_0868813
554 Ga0451800_0301456
555 Ga0451807_1318405
556 Ga0451853_0805954
557 Ga0451853_3120488
558 Ga0466966_0049444
559 Ga0466966_0301486
560 Ga0466961_0024469
561 Ga0466961_0049962
562 Ga0466963_0076457
563 Ga0466964_0002151
564 Ga0466964_0129037
565 Ga0466964_0644907
566 Ga0466970_0966375
567 Ga0466959_0178805
568 Ga0466959_0429490
569 Ga0451576_1336820
570 Ga0466958_0039957
571 Ga0466958_0681587
572 Ga0466958_1045592
573 Ga0466967_0006542
574 Ga0466967_0023616
575 Ga0466967_0063895
576 Ga0466967_0341876
577 Ga0466967_0402048
578 Ga0466967_0497556
579 Ga0466967_1023658
580 Ga0466967_1128857
581 Ga0466967_2377269
582 Ga0495603_0079944
583 Ga0495603_0482841
584 Ga0495603_0684263
585 Ga0495629_0108752
586 Ga0495629_0141682
587 Ga0495641_0005768
588 Ga0495641_0096819
589 Ga0495641_0207426
590 Ga0495651_0020803
591 Ga0495651_0037660
592 Ga0495582_0000028
593 Ga0495582_0181071
594 Ga0495582_0840265
595 Ga0495639_0000718
596 Ga0495639_0380928
597 Ga0495662_0000448
598 Ga0495662_0057259
599 Ga0495664_0032688
600 Ga0495594_0099629
601 Ga0495608_0068386
602 Ga0495608_0079383
603 Ga0495608_0170149
604 Ga0495618_0024565
605 Ga0495618_0622915
606 Ga0495628_0020342
607 Ga0495628_0067729
608 Ga0495630_0006834
609 Ga0495630_0222709
610 Ga0495630_0892901
611 Ga0495630_0973560
612 Ga0495666_0017436
613 Ga0495652_0054441
614 Ga0495652_0109670
615 Ga0495652_0214276
616 Ga0495665_0000510
617 Ga0495640_0009055
618 Ga0495640_0036319
619 Ga0495640_0346452
620 Ga0495586_0489547
621 Ga0495587_0139627
622 Ga0495587_0583469
623 Ga0495587_0790837
624 Ga0495667_0008351
625 Ga0495667_0015879
626 Ga0495667_0037093
627 Ga0495667_0260816
628 Ga0495667_0619218
629 Ga0495634_0010792
630 Ga0495634_0054306
631 Ga0495635_0003733
632 Ga0495635_0073122
633 Ga0495657_0124099
634 Ga0495599_0057317
635 Ga0495623_0222595
636 Ga0495646_0075133
637 Ga0495647_0006272
638 Ga0495658_0000356
639 Ga0495613_0006132
640 Ga0495624_0012550
641 Ga0495600_0012918
642 Ga0495600_0307265
643 Ga0495581_0000589
644 Ga0495581_0178660
645 Ga0495604_0105685
646 Ga0495604_0109354
647 Ga0495674_0002574
648 Ga0495674_0011910
649 Ga0495674_0049811
650 Ga0495674_0099305
651 Ga0495676_0002194
652 Ga0495676_0138803
653 Ga0495680_0007839
654 Ga0495680_0012591
655 Ga0495680_0022784
656 Ga0495684_0002226
657 Ga0495684_0115168
658 Ga0495593_0022860
659 Ga0495614_0013655
660 Ga0496100_0213619
661 Ga0496100_0494443
662 Ga0496100_0906098
663 Ga0496101_0064993
664 Ga0496101_0730536
665 Ga0496102_0017031
666 Ga0496102_0233114
667 Ga0496102_1274312
668 Ga0496103_0159288
669 Ga0496103_0369753
670 Ga0496103_0887959
671 Ga0496104_1092074
672 Ga0496105_0035167
673 Ga0496105_1157625
674 Ga0496106_1243608
675 Ga0496107_0140112
676 Ga0496107_0155397
677 Ga0496108_0082617
678 Ga0496108_0128354
679 Ga0496108_0358429
680 Ga0496108_0562091
681 Ga0496108_0871506
682 Ga0496109_0083082
683 Ga0496109_0337613
684 Ga0496109_1651617
685 Ga0496110_0375299
686 Ga0496110_0498148
687 Ga0496110_0640370
688 Ga0496110_0898199
689 Ga0496111_0040824
690 Ga0496111_0510738
691 Ga0496111_0569781
692 Ga0496112_0004745
693 Ga0496112_0008949
694 Ga0496112_0028006
695 Ga0496112_0318608
696 Ga0496113_0408690
697 Ga0496114_0004135
698 Ga0496114_0036083
699 Ga0496114_0074341
700 Ga0496114_0225653
701 Ga0496115_0012193
702 Ga0496115_0046722
703 Ga0496115_1018814
704 Ga0496115_1353930
705 Ga0501034_0456611
706 Ga0501038_0338768
707 Ga0501047_0143025
708 Ga0501047_0490672
709 Ga0501047_1336388
710 Ga0501067_0001419
711 Ga0501069_0002078
712 Ga0501069_0047317
713 Ga0501070_0161501
714 Ga0501070_0264728
715 Ga0501070_0707127
716 Ga0501074_0188561
717 Ga0501080_0924243
718 Ga0501081_0695628
719 Ga0501035_0247528
720 Ga0501044_0303540
721 nmdc:mga05p37_141395_c1
722 Ga0495601_0030786
723 Ga0495601_0716311
724 Ga0495612_0076593
725 Ga0495612_0511355
726 Ga0495655_0002183
727 Ga0495595_0006442
728 Ga0495619_0001192
729 Ga0495619_0007709
730 Ga0495619_0936051
731 Ga0501082_1169448
732 Ga0530510_0328225

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8i8y-assembly1.cif.gz_B a mutant of the c-terminal complex of proteins 4.1g and numa 0.6565 13 78
8i8y-assembly1.cif.gz_B a mutant of the c-terminal complex of proteins 4.1g and numa 0.6202 13 78
8e6z-assembly1.cif.gz_C escherichia coli rho-dependent transcription pre-termination complex containing 18 nt long rna spacer, dc75 rut mimic rna, mg-adp-bef3, and nusg; tec part 0.6185 47 112
6x7f-assembly1.cif.gz_AC cryo-em structure of an escherichia coli coupled transcription-translation complex b2 (ttc-b2) containing an mrna with a 24 nt long spacer, transcription factors nusa and nusg, and fmet-trnas at p-site and e-site 0.6185 47 112
3l7p-assembly1.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.5907 26 92
ID Description Score Start End Superfamily
af_Q9NSE4_711_1011_1.10.730.20 Mainly Alpha;Orthogonal Bundle;Isoleucyl-tRNA Synthetase; Domain 1; 0.6886 43 75 1.10.730.20
af_A0A1D8PSB2_23_158_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.6697 46 76 2.60.40.150
af_Q54NJ5_358_522_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.5978 30 73 3.30.428.10
af_Q4DX40_61_278_2.40.320.10 Mainly Beta;Beta Barrel;Hypothetical Protein Pfu-838710-001;Hypothetical Protein Pfu-838710-001 0.5957 42 75 2.40.320.10
af_A0A0R0GL98_84_281_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.5916 27 71 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A7W1GML8-F1-model_v4 Uncharacterized protein 0.933 1 107
AF-A0A538F0H5-F1-model_v4 Uncharacterized protein 0.9207 1 108
AF-A0A538DSM5-F1-model_v4 Uncharacterized protein 0.917 17 110
AF-A0A538KX80-F1-model_v4 Uncharacterized protein 0.8981 1 93
AF-A0A538DIV0-F1-model_v4 Uncharacterized protein 0.8972 1 110

Map