F423931

General Info

Members Datasets Scaffolds Average Seq Length
366 199 732 236

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100095289|Ga0070713_1000952893
Length 274
Sequence MRRVLGSPARLFNLHFDSSMPLLRVHCLITGGFPMQAKLQGTTMPVLEIQLDPNESVFSESGELSWMTASIQMATHTQMGGGGGLFGILKRVMTEYRAFGMPGEVAFATKVPGHIVPVEVTSGQEFMVHRHGFLCATPQVTIGVGFQQSLGAGIFGGDGFVLQRLGGQGTAWLELSGELVIKDLAPGEVLRVHPGHVGAFQASVGFQITTVPGIRNVVFGGDGLFLAMLQGPGRVWLQTLPISRLAHKIYEYIPHGESSRSNVAAGVQILNGDK

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
66 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
67 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
72 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
73 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
109 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
110 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
123 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
127 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
128 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
150 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
162 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 1.91
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.55
Nodule 0
Rhizoplane 4.92
Rhizosphere 85.79
Stem 0
Stem Tuber 0
Unclassified 14.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100095289 3300005436 Bacteria 2567
2 JGI25162J39368_1001548 3300002737 Bacteria 11826
3 JGI25154J39366_1006082 3300002738 Bacteria 1818
4 JGI25157J39369_1002430 3300002741 Bacteria 4661
5 JGI25164J39214_1000088 3300002772 Bacteria 91375
6 JGI25165J46597_1000088 3300003214 Bacteria 169821
7 rootH2_10009379 3300003320 Bacteria 6004
8 rootH2_10309098 3300003320 Unclassified 1341
9 Ga0055535_1000175 3300003761 Bacteria 68715
10 Ga0055542_1000155 3300003762 Bacteria 86663
11 Ga0055529_1000182 3300003763 Bacteria 86667
12 Ga0070658_10000004 3300005327 Bacteria 402230
13 Ga0070658_10062516 3300005327 Unclassified 3034
14 Ga0070680_100031603 3300005336 Bacteria 4257
15 Ga0068868_100183442 3300005338 Bacteria 1737
16 Ga0070660_100002582 3300005339 Bacteria 12430
17 Ga0070660_100004609 3300005339 Bacteria 9540
18 Ga0070671_100067340 3300005355 Bacteria 2985
19 Ga0070659_100002809 3300005366 Bacteria 12406
20 Ga0070709_10140064 3300005434 Bacteria 1661
21 Ga0070709_10201307 3300005434 Bacteria 1410
22 Ga0070714_100147823 3300005435 Bacteria 2115
23 Ga0070713_100039287 3300005436 Bacteria 3840
24 Ga0070713_100123430 3300005436 Bacteria 2274
25 Ga0070713_100243711 3300005436 Bacteria 1638
26 Ga0070711_100047672 3300005439 Bacteria 2927
27 Ga0070711_100152477 3300005439 Bacteria 1744
28 Ga0070663_100003138 3300005455 Bacteria 9472
29 Ga0070681_10003669 3300005458 Bacteria 14396
30 Ga0070681_10009498 3300005458 Bacteria 9575
31 Ga0070681_10422603 3300005458 Bacteria 1245
32 Ga0070681_10552127 3300005458 Bacteria 1066
33 Ga0070679_100000090 3300005530 Bacteria 69112
34 Ga0070679_100001400 3300005530 Bacteria 21270
35 Ga0070679_100177484 3300005530 Bacteria 2103
36 Ga0070684_100525980 3300005535 Bacteria 1096
37 Ga0068853_100000125 3300005539 Bacteria 51505
38 Ga0068853_100188197 3300005539 Bacteria 1874
39 Ga0070693_100312993 3300005547 Bacteria 1062
40 Ga0070665_100171673 3300005548 Bacteria 2169
41 Ga0068855_100003840 3300005563 Bacteria 18367
42 Ga0068855_100008039 3300005563 Bacteria 12745
43 Ga0068855_100013805 3300005563 Bacteria 9738
44 Ga0068855_100131151 3300005563 Bacteria 2862
45 Ga0070664_100097685 3300005564 Bacteria 2550
46 Ga0068857_100120866 3300005577 Unclassified 2358
47 Ga0068854_100000108 3300005578 Bacteria 57718
48 Ga0068854_100047256 3300005578 Bacteria 3067
49 Ga0068854_100247597 3300005578 Bacteria 1422
50 Ga0068856_100001261 3300005614 Bacteria 26639
51 Ga0068856_100018754 3300005614 Bacteria 6707
52 Ga0068856_100056395 3300005614 Bacteria 3876
53 Ga0068852_100019773 3300005616 Bacteria 5339
54 Ga0068859_100447823 3300005617 Bacteria 1387
55 Ga0068851_10063890 3300005834 Unclassified 1891
56 Ga0081540_1009626 3300005983 Bacteria 6645
57 Ga0070717_10000597 3300006028 Bacteria 23173
58 Ga0070717_10003349 3300006028 Bacteria 11446
59 Ga0070717_10109773 3300006028 Bacteria 2352
60 Ga0070717_10155350 3300006028 Unclassified 1982
61 Ga0070717_10415944 3300006028 Bacteria 1209
62 Ga0070715_10068221 3300006163 Bacteria 1581
63 Ga0070716_100024518 3300006173 Bacteria 3211
64 Ga0070716_100030272 3300006173 Bacteria 2934
65 Ga0070716_100237151 3300006173 Unclassified 1235
66 Ga0070716_100249632 3300006173 Unclassified 1208
67 Ga0070712_100033171 3300006175 Bacteria 3492
68 Ga0070712_100347263 3300006175 Unclassified 1213
69 Ga0097621_100001202 3300006237 Bacteria 17935
70 Ga0097621_100035143 3300006237 Unclassified 4003
71 Ga0097621_100380945 3300006237 Unclassified 1260
72 Ga0068871_100001221 3300006358 Bacteria 17152
73 Ga0068871_100337988 3300006358 Bacteria 1329
74 Ga0075434_100043650 3300006871 Unclassified 4446
75 Ga0075436_100004734 3300006914 Bacteria 9336
76 Ga0097620_100447835 3300006931 Bacteria 1387
77 Ga0105240_10000001 3300009093 Bacteria 2887840
78 Ga0105240_10000370 3300009093 Bacteria 84485
79 Ga0105240_10021060 3300009093 Bacteria 8678
80 Ga0105240_10031585 3300009093 Bacteria 6865
81 Ga0105240_10085980 3300009093 Bacteria 3852
82 Ga0105240_10135454 3300009093 Bacteria 2950
83 Ga0105240_10201587 3300009093 Bacteria 2331
84 Ga0105245_10364428 3300009098 Bacteria 1435
85 Ga0105241_10012418 3300009174 Bacteria 6242
86 Ga0105248_10000003 3300009177 Bacteria 1019601
87 Ga0105248_10000781 3300009177 Bacteria 35776
88 Ga0105248_10030335 3300009177 Bacteria 6037
89 Ga0105248_10378341 3300009177 Bacteria 1594
90 Ga0105237_10029936 3300009545 Bacteria 5530
91 Ga0105237_10229288 3300009545 Bacteria 1858
92 Ga0105238_10000761 3300009551 Bacteria 33515
93 Ga0105238_10001004 3300009551 Bacteria 28819
94 Ga0105239_10102676 3300010375 Bacteria 3164
95 Ga0157314_1000002 3300012500 Bacteria 42978
96 Ga0157371_10030602 3300013102 Bacteria 3882
97 Ga0157370_10003499 3300013104 Bacteria 18408
98 Ga0157370_10007247 3300013104 Bacteria 12099
99 Ga0157370_10016566 3300013104 Bacteria 7456
100 Ga0157370_10041265 3300013104 Bacteria 4453
101 Ga0157370_10135847 3300013104 Bacteria 2292
102 Ga0157370_10442983 3300013104 Bacteria 1194
103 Ga0157369_10000062 3300013105 Bacteria 149758
104 Ga0157369_10051546 3300013105 Unclassified 4453
105 Ga0157369_10058707 3300013105 Bacteria 4150
106 Ga0157369_10098427 3300013105 Bacteria 3119
107 Ga0157369_10108577 3300013105 Bacteria 2951
108 Ga0157374_10000325 3300013296 Bacteria 44176
109 Ga0157374_10810194 3300013296 Unclassified 952
110 Ga0157374_10967942 3300013296 Bacteria 870
111 Ga0157378_10069996 3300013297 Bacteria 3149
112 Ga0157372_10000126 3300013307 Bacteria 82702
113 Ga0157372_10000283 3300013307 Bacteria 56441
114 Ga0157372_10018075 3300013307 Bacteria 7579
115 Ga0157372_10035872 3300013307 Bacteria 5461
116 Ga0157372_10057066 3300013307 Bacteria 4364
117 Ga0157372_10057637 3300013307 Unclassified 4342
118 Ga0157372_10065055 3300013307 Bacteria 4093
119 Ga0157372_10079291 3300013307 Bacteria 3713
120 Ga0157372_10301850 3300013307 Bacteria 1863
121 Ga0157375_10055232 3300013308 Bacteria 3915
122 Ga0163163_10056884 3300014325 Bacteria 3866
123 Ga0163163_10175563 3300014325 Unclassified 2189
124 Ga0157379_10074628 3300014968 Bacteria 3036
125 Ga0157376_10019375 3300014969 Bacteria 5243
126 Ga0157376_10107852 3300014969 Unclassified 2445
127 Ga0157376_10245035 3300014969 Bacteria 1671
128 Ga0197907_11171460 3300020069 Bacteria 1261
129 Ga0213876_10003591 3300021384 Bacteria 8824
130 Ga0224572_1006780 3300024225 Bacteria 2079
131 Ga0224572_1007196 3300024225 Bacteria 2033
132 Ga0224572_1010720 3300024225 Bacteria 1728
133 Ga0228598_1004640 3300024227 Bacteria 2906
134 Ga0209672_101001 3300025228 Bacteria 12361
135 Ga0207427_100021 3300025231 Bacteria 494115
136 Ga0209437_100087 3300025233 Bacteria 253432
137 Ga0209258_100275 3300025242 Bacteria 86719
138 Ga0209646_1002250 3300025246 Bacteria 4429
139 Ga0209026_1000592 3300025250 Bacteria 23632
140 Ga0209148_1000245 3300025254 Bacteria 86719
141 Ga0209233_1000023 3300025261 Bacteria 738870
142 Ga0209455_1000202 3300025272 Bacteria 86719
143 Ga0207656_10019165 3300025321 Bacteria 2704
144 Ga0207647_10063159 3300025904 Bacteria 2253
145 Ga0207699_10022950 3300025906 Bacteria 3389
146 Ga0207699_10134806 3300025906 Bacteria 1616
147 Ga0207699_10161946 3300025906 Bacteria 1490
148 Ga0207705_10000024 3300025909 Bacteria 259977
149 Ga0207705_10058789 3300025909 Bacteria 2773
150 Ga0207705_10094321 3300025909 Bacteria 2195
151 Ga0207705_10095616 3300025909 Bacteria 2180
152 Ga0207705_10158241 3300025909 Bacteria 1700
153 Ga0207654_10011902 3300025911 Bacteria 4447
154 Ga0207707_10002117 3300025912 Bacteria 17975
155 Ga0207707_10531443 3300025912 Bacteria 1001
156 Ga0207695_10000001 3300025913 Bacteria 2888630
157 Ga0207695_10000665 3300025913 Bacteria 67735
158 Ga0207695_10020345 3300025913 Bacteria 7606
159 Ga0207695_10040311 3300025913 Bacteria 5010
160 Ga0207695_10043476 3300025913 Bacteria 4787
161 Ga0207695_10411016 3300025913 Bacteria 1238
162 Ga0207671_10204323 3300025914 Bacteria 1543
163 Ga0207693_10002109 3300025915 Bacteria 17352
164 Ga0207693_10011563 3300025915 Bacteria 7139
165 Ga0207693_10031114 3300025915 Bacteria 4216
166 Ga0207663_10041802 3300025916 Bacteria 2796
167 Ga0207660_10018759 3300025917 Bacteria 4617
168 Ga0207660_10081849 3300025917 Unclassified 2374
169 Ga0207660_10486637 3300025917 Unclassified 1000
170 Ga0207657_10007008 3300025919 Bacteria 11597
171 Ga0207657_10015950 3300025919 Bacteria 7258
172 Ga0207652_10000951 3300025921 Bacteria 27138
173 Ga0207652_10001674 3300025921 Bacteria 19417
174 Ga0207646_10224880 3300025922 Bacteria 1695
175 Ga0207694_10001003 3300025924 Bacteria 24665
176 Ga0207694_10005760 3300025924 Bacteria 9494
177 Ga0207694_10050703 3300025924 Bacteria 3216
178 Ga0207700_10010907 3300025928 Bacteria 5768
179 Ga0207700_10022144 3300025928 Bacteria 4353
180 Ga0207700_10101754 3300025928 Bacteria 2293
181 Ga0207664_10054341 3300025929 Unclassified 3173
182 Ga0207664_10083670 3300025929 Bacteria 2601
183 Ga0207664_10137732 3300025929 Bacteria 2061
184 Ga0207690_10004366 3300025932 Bacteria 8349
185 Ga0207665_10016767 3300025939 Bacteria 4811
186 Ga0207665_10031181 3300025939 Bacteria 3527
187 Ga0207665_10100945 3300025939 Unclassified 2014
188 Ga0207711_10000012 3300025941 Bacteria 515147
189 Ga0207661_10031802 3300025944 Bacteria 4081
190 Ga0207679_10307318 3300025945 Bacteria 1369
191 Ga0207667_10000059 3300025949 Bacteria 192543
192 Ga0207667_10000562 3300025949 Bacteria 48478
193 Ga0207667_10000997 3300025949 Bacteria 36207
194 Ga0207667_10291060 3300025949 Bacteria 1669
195 Ga0207640_10000001 3300025981 Bacteria 628778
196 Ga0207640_10044619 3300025981 Bacteria 2842
197 Ga0207640_10227861 3300025981 Bacteria 1431
198 Ga0207677_10142003 3300026023 Bacteria 1840
199 Ga0207703_10094409 3300026035 Bacteria 2522
200 Ga0207639_10000155 3300026041 Bacteria 51965
201 Ga0207639_10005522 3300026041 Bacteria 8547
202 Ga0207639_10095056 3300026041 Bacteria 2394
203 Ga0207678_10001778 3300026067 Bacteria 19735
204 Ga0207678_10182452 3300026067 Bacteria 1792
205 Ga0207702_10001496 3300026078 Bacteria 23099
206 Ga0207702_10391550 3300026078 Bacteria 1338
207 Ga0207702_10461207 3300026078 Unclassified 1234
208 Ga0207648_10090303 3300026089 Bacteria 2676
209 Ga0207674_10162108 3300026116 Bacteria 2190
210 Ga0207698_10013540 3300026142 Bacteria 5386
211 Ga0265356_1004472 3300028017 Bacteria 1707
212 Ga0265318_10005801 3300028577 Bacteria 5757
213 Ga0265336_10005194 3300028666 Bacteria 4831
214 Ga0265338_10002104 3300028800 Bacteria 30725
215 Ga0265338_10071343 3300028800 Unclassified 2972
216 Ga0265338_10073933 3300028800 Bacteria 2902
217 Ga0265338_10309211 3300028800 Bacteria 1147
218 Ga0265762_1000493 3300030760 Bacteria 6868
219 Ga0265762_1035731 3300030760 Unclassified 957
220 Ga0265762_1039147 3300030760 Bacteria 923
221 Ga0265770_1012230 3300030878 Bacteria 1269
222 Ga0265760_10001232 3300031090 Bacteria 7484
223 Ga0265760_10005364 3300031090 Bacteria 3679
224 Ga0265330_10000128 3300031235 Bacteria 61159
225 Ga0265330_10000273 3300031235 Bacteria 38107
226 Ga0265330_10009040 3300031235 Bacteria 4751
227 Ga0265330_10116950 3300031235 Bacteria 1137
228 Ga0265332_10014079 3300031238 Bacteria 3539
229 Ga0265332_10043138 3300031238 Bacteria 1948
230 Ga0265328_10009499 3300031239 Bacteria 3957
231 Ga0265328_10071402 3300031239 Bacteria 1276
232 Ga0265325_10000020 3300031241 Bacteria 125088
233 Ga0265325_10000266 3300031241 Bacteria 37071
234 Ga0265340_10037181 3300031247 Bacteria 2412
235 Ga0265340_10039917 3300031247 Bacteria 2313
236 Ga0265339_10005214 3300031249 Bacteria 8693
237 Ga0265339_10011260 3300031249 Bacteria 5518
238 Ga0265339_10058891 3300031249 Bacteria 2072
239 Ga0265339_10103883 3300031249 Unclassified 1476
240 Ga0265316_10001379 3300031344 Bacteria 26180
241 Ga0265316_10003675 3300031344 Bacteria 15459
242 Ga0265316_10009443 3300031344 Bacteria 8985
243 Ga0265316_10010853 3300031344 Bacteria 8272
244 Ga0265316_10011160 3300031344 Bacteria 8128
245 Ga0265316_10183157 3300031344 Bacteria 1559
246 Ga0265313_10009680 3300031595 Bacteria 6221
247 Ga0265313_10095908 3300031595 Bacteria 1323
248 Ga0307508_10417222 3300031616 Bacteria 934
249 Ga0265314_10000025 3300031711 Bacteria 292548
250 Ga0265314_10124028 3300031711 Bacteria 1621
251 Ga0265342_10000225 3300031712 Bacteria 63822
252 Ga0265342_10000586 3300031712 Bacteria 38357
253 Ga0265342_10016145 3300031712 Bacteria 4886
254 Ga0265342_10020744 3300031712 Bacteria 4208
255 Ga0265342_10165809 3300031712 Bacteria 1218
256 Ga0265342_10192662 3300031712 Bacteria 1112
257 Ga0316214_1007251 3300033545 Bacteria 1477
258 Ga0316214_1007938 3300033545 Bacteria 1423
259 Ga0373934_0024311 3300035086 Bacteria 2343
260 Ga0373923_0157997 3300035111 Unclassified 1033
261 Ga0373936_0051138 3300035113 Bacteria 1672
262 Ga0373954_0098309 3300035118 Unclassified 1411
263 Ga0373955_0091576 3300035172 Bacteria 1733
264 Ga0373955_0225667 3300035172 Unclassified 1120
265 Ga0373924_0123543 3300035410 Unclassified 1124
266 Ga0373935_0098077 3300035692 Bacteria 1928
267 Ga0373927_0016285 3300035695 Unclassified 4905
268 Ga0373947_0005597 3300035725 Bacteria 7328
269 Ga0373947_0269886 3300035725 Bacteria 1129
270 Ga0373937_0017705 3300036401 Bacteria 6356
271 Ga0373937_0026268 3300036401 Bacteria 5262
272 Ga0373925_0089946 3300037068 Unclassified 2346
273 Ga0373925_0705615 3300037068 Bacteria 832
274 Ga0436364_0009064 3300037853 Unclassified 1183
275 Ga0436364_1288248 3300037853 Bacteria 1041
276 Ga0395901_0180199 3300038443 Unclassified 2216
277 Ga0436365_0726921 3300039437 Bacteria 59637
278 Ga0436365_1557691 3300039437 Archaea 3324
279 Ga0436360_0122286 3300039438 Bacteria 5451
280 Ga0436360_0460600 3300039438 Unclassified 1352
281 Ga0436360_0827341 3300039438 Bacteria 14306
282 Ga0436361_0057308 3300039447 Bacteria 2500
283 Ga0436361_0361747 3300039447 Bacteria 4352
284 Ga0436361_0908651 3300039447 Bacteria 4021
285 Ga0436361_1060109 3300039447 Unclassified 1075
286 Ga0436363_0876065 3300039450 Bacteria 3517
287 Ga0436363_1185795 3300039450 Bacteria 914
288 Ga0436362_0041631 3300039453 Bacteria 6288
289 Ga0466959_0216727 3300045049 Bacteria 1329
290 Ga0495651_0036377 3300046462 Bacteria 3833
291 Ga0495653_0374680 3300046463 Unclassified 910
292 Ga0495580_0000687 3300046472 Bacteria 28835
293 Ga0495580_0092237 3300046472 Bacteria 2108
294 Ga0495580_0144481 3300046472 Unclassified 1649
295 Ga0495580_0228686 3300046472 Bacteria 1277
296 Ga0495580_0455619 3300046472 Bacteria 858
297 Ga0495607_0024495 3300046501 Bacteria 3762
298 Ga0495583_0173627 3300046506 Bacteria 884
299 Ga0495628_0083556 3300046516 Bacteria 2479
300 Ga0495630_0423327 3300046517 Unclassified 1020
301 Ga0495652_0101950 3300046529 Bacteria 2326
302 Ga0495652_0141190 3300046529 Bacteria 1894
303 Ga0495652_0393009 3300046529 Unclassified 984
304 Ga0495665_0008528 3300046531 Bacteria 5562
305 Ga0495640_0150910 3300046533 Unclassified 1493
306 Ga0495587_0009644 3300046536 Bacteria 6176
307 Ga0495645_0001223 3300046543 Bacteria 17539
308 Ga0495645_0035435 3300046543 Bacteria 3638
309 Ga0495645_0129283 3300046543 Bacteria 1772
310 Ga0495645_0220330 3300046543 Unclassified 1276
311 Ga0495634_0079776 3300046642 Bacteria 2143
312 Ga0495635_0174439 3300046663 Unclassified 1462
313 Ga0495623_0181845 3300046679 Bacteria 1221
314 Ga0495646_0253508 3300046680 Bacteria 942
315 Ga0495647_0043313 3300046681 Bacteria 1722
316 Ga0495658_0187066 3300046683 Bacteria 1286
317 Ga0495600_0020101 3300046809 Bacteria 4272
318 Ga0495604_0050091 3300047317 Bacteria 3244
319 Ga0495674_0071024 3300047319 Unclassified 3007
320 Ga0495674_0308310 3300047319 Bacteria 1292
321 Ga0495672_0006398 3300047320 Bacteria 9143
322 Ga0495683_0000646 3300047323 Bacteria 25848
323 Ga0495684_0014268 3300047471 Bacteria 6114
324 Ga0495686_0005459 3300047472 Bacteria 10018
325 Ga0495686_0008096 3300047472 Bacteria 7775
326 Ga0496101_0197119 3300048904 Unclassified 1556
327 Ga0496101_0370741 3300048904 Unclassified 1126
328 Ga0496102_0086463 3300048905 Bacteria 2896
329 Ga0496102_0317393 3300048905 Unclassified 1468
330 Ga0496104_0058607 3300048907 Unclassified 3645
331 Ga0496104_0299401 3300048907 Unclassified 1520
332 Ga0496105_0113621 3300048908 Unclassified 2234
333 Ga0496105_0168051 3300048908 Bacteria 1799
334 Ga0496105_0590169 3300048908 Unclassified 863
335 Ga0496107_0010159 3300048910 Bacteria 6529
336 Ga0496109_0291113 3300048912 Unclassified 1540
337 Ga0496112_0089744 3300048915 Bacteria 3042
338 Ga0496112_0115455 3300048915 Bacteria 2655
339 Ga0496112_0466157 3300048915 Bacteria 1200
340 Ga0496113_0424604 3300048916 Bacteria 1068
341 Ga0496114_0190169 3300048917 Bacteria 1796
342 Ga0496115_0029766 3300048918 Bacteria 4291
343 Ga0496115_0184989 3300048918 Unclassified 1721
344 Ga0496124_0219993 3300048927 Unclassified 1429
345 Ga0496126_0000091 3300048929 Bacteria 209427
346 Ga0496126_0001289 3300048929 Bacteria 40164
347 Ga0496126_0005046 3300048929 Bacteria 15325
348 Ga0496126_0379458 3300048929 Bacteria 1151
349 Ga0501031_0017966 3300049568 Bacteria 4601
350 Ga0501032_0008312 3300049569 Bacteria 7564
351 Ga0501034_0020708 3300049571 Bacteria 6715
352 Ga0501036_0067324 3300049572 Bacteria 3029
353 Ga0501037_0026874 3300049573 Bacteria 4251
354 Ga0501038_0000798 3300049574 Bacteria 27960
355 Ga0501043_0020993 3300049579 Bacteria 5121
356 Ga0501046_0002025 3300049580 Bacteria 19248
357 Ga0501047_0002667 3300049581 Bacteria 16982
358 Ga0501070_0148172 3300049586 Bacteria 1937
359 Ga0501080_0025626 3300049742 Bacteria 5477
360 Ga0501035_0011557 3300049822 Bacteria 8182
361 Ga0501044_0021066 3300049823 Bacteria 6959
362 nmdc:mga0n895_39300_c1 3300050512 Bacteria 4590
363 nmdc:mga0n895_422114_c1 3300050512 Unclassified 1348
364 nmdc:mga08x19_1148_c1 3300050514 Bacteria 16534
365 Ga0495619_0261498 3300053085 Unclassified 1199
366 2884216835 2884215851 Bacteria 4554841
367 Ga0070713_100095289
368 JGI25162J39368_1001548
369 JGI25154J39366_1006082
370 JGI25157J39369_1002430
371 JGI25164J39214_1000088
372 JGI25165J46597_1000088
373 rootH2_10009379
374 rootH2_10309098
375 Ga0055535_1000175
376 Ga0055542_1000155
377 Ga0055529_1000182
378 Ga0070658_10000004
379 Ga0070658_10062516
380 Ga0070680_100031603
381 Ga0068868_100183442
382 Ga0070660_100002582
383 Ga0070660_100004609
384 Ga0070671_100067340
385 Ga0070659_100002809
386 Ga0070709_10140064
387 Ga0070709_10201307
388 Ga0070714_100147823
389 Ga0070713_100039287
390 Ga0070713_100123430
391 Ga0070713_100243711
392 Ga0070711_100047672
393 Ga0070711_100152477
394 Ga0070663_100003138
395 Ga0070681_10003669
396 Ga0070681_10009498
397 Ga0070681_10422603
398 Ga0070681_10552127
399 Ga0070679_100000090
400 Ga0070679_100001400
401 Ga0070679_100177484
402 Ga0070684_100525980
403 Ga0068853_100000125
404 Ga0068853_100188197
405 Ga0070693_100312993
406 Ga0070665_100171673
407 Ga0068855_100003840
408 Ga0068855_100008039
409 Ga0068855_100013805
410 Ga0068855_100131151
411 Ga0070664_100097685
412 Ga0068857_100120866
413 Ga0068854_100000108
414 Ga0068854_100047256
415 Ga0068854_100247597
416 Ga0068856_100001261
417 Ga0068856_100018754
418 Ga0068856_100056395
419 Ga0068852_100019773
420 Ga0068859_100447823
421 Ga0068851_10063890
422 Ga0081540_1009626
423 Ga0070717_10000597
424 Ga0070717_10003349
425 Ga0070717_10109773
426 Ga0070717_10155350
427 Ga0070717_10415944
428 Ga0070715_10068221
429 Ga0070716_100024518
430 Ga0070716_100030272
431 Ga0070716_100237151
432 Ga0070716_100249632
433 Ga0070712_100033171
434 Ga0070712_100347263
435 Ga0097621_100001202
436 Ga0097621_100035143
437 Ga0097621_100380945
438 Ga0068871_100001221
439 Ga0068871_100337988
440 Ga0075434_100043650
441 Ga0075436_100004734
442 Ga0097620_100447835
443 Ga0105240_10000001
444 Ga0105240_10000370
445 Ga0105240_10021060
446 Ga0105240_10031585
447 Ga0105240_10085980
448 Ga0105240_10135454
449 Ga0105240_10201587
450 Ga0105245_10364428
451 Ga0105241_10012418
452 Ga0105248_10000003
453 Ga0105248_10000781
454 Ga0105248_10030335
455 Ga0105248_10378341
456 Ga0105237_10029936
457 Ga0105237_10229288
458 Ga0105238_10000761
459 Ga0105238_10001004
460 Ga0105239_10102676
461 Ga0157314_1000002
462 Ga0157371_10030602
463 Ga0157370_10003499
464 Ga0157370_10007247
465 Ga0157370_10016566
466 Ga0157370_10041265
467 Ga0157370_10135847
468 Ga0157370_10442983
469 Ga0157369_10000062
470 Ga0157369_10051546
471 Ga0157369_10058707
472 Ga0157369_10098427
473 Ga0157369_10108577
474 Ga0157374_10000325
475 Ga0157374_10810194
476 Ga0157374_10967942
477 Ga0157378_10069996
478 Ga0157372_10000126
479 Ga0157372_10000283
480 Ga0157372_10018075
481 Ga0157372_10035872
482 Ga0157372_10057066
483 Ga0157372_10057637
484 Ga0157372_10065055
485 Ga0157372_10079291
486 Ga0157372_10301850
487 Ga0157375_10055232
488 Ga0163163_10056884
489 Ga0163163_10175563
490 Ga0157379_10074628
491 Ga0157376_10019375
492 Ga0157376_10107852
493 Ga0157376_10245035
494 Ga0197907_11171460
495 Ga0213876_10003591
496 Ga0224572_1006780
497 Ga0224572_1007196
498 Ga0224572_1010720
499 Ga0228598_1004640
500 Ga0209672_101001
501 Ga0207427_100021
502 Ga0209437_100087
503 Ga0209258_100275
504 Ga0209646_1002250
505 Ga0209026_1000592
506 Ga0209148_1000245
507 Ga0209233_1000023
508 Ga0209455_1000202
509 Ga0207656_10019165
510 Ga0207647_10063159
511 Ga0207699_10022950
512 Ga0207699_10134806
513 Ga0207699_10161946
514 Ga0207705_10000024
515 Ga0207705_10058789
516 Ga0207705_10094321
517 Ga0207705_10095616
518 Ga0207705_10158241
519 Ga0207654_10011902
520 Ga0207707_10002117
521 Ga0207707_10531443
522 Ga0207695_10000001
523 Ga0207695_10000665
524 Ga0207695_10020345
525 Ga0207695_10040311
526 Ga0207695_10043476
527 Ga0207695_10411016
528 Ga0207671_10204323
529 Ga0207693_10002109
530 Ga0207693_10011563
531 Ga0207693_10031114
532 Ga0207663_10041802
533 Ga0207660_10018759
534 Ga0207660_10081849
535 Ga0207660_10486637
536 Ga0207657_10007008
537 Ga0207657_10015950
538 Ga0207652_10000951
539 Ga0207652_10001674
540 Ga0207646_10224880
541 Ga0207694_10001003
542 Ga0207694_10005760
543 Ga0207694_10050703
544 Ga0207700_10010907
545 Ga0207700_10022144
546 Ga0207700_10101754
547 Ga0207664_10054341
548 Ga0207664_10083670
549 Ga0207664_10137732
550 Ga0207690_10004366
551 Ga0207665_10016767
552 Ga0207665_10031181
553 Ga0207665_10100945
554 Ga0207711_10000012
555 Ga0207661_10031802
556 Ga0207679_10307318
557 Ga0207667_10000059
558 Ga0207667_10000562
559 Ga0207667_10000997
560 Ga0207667_10291060
561 Ga0207640_10000001
562 Ga0207640_10044619
563 Ga0207640_10227861
564 Ga0207677_10142003
565 Ga0207703_10094409
566 Ga0207639_10000155
567 Ga0207639_10005522
568 Ga0207639_10095056
569 Ga0207678_10001778
570 Ga0207678_10182452
571 Ga0207702_10001496
572 Ga0207702_10391550
573 Ga0207702_10461207
574 Ga0207648_10090303
575 Ga0207674_10162108
576 Ga0207698_10013540
577 Ga0265356_1004472
578 Ga0265318_10005801
579 Ga0265336_10005194
580 Ga0265338_10002104
581 Ga0265338_10071343
582 Ga0265338_10073933
583 Ga0265338_10309211
584 Ga0265762_1000493
585 Ga0265762_1035731
586 Ga0265762_1039147
587 Ga0265770_1012230
588 Ga0265760_10001232
589 Ga0265760_10005364
590 Ga0265330_10000128
591 Ga0265330_10000273
592 Ga0265330_10009040
593 Ga0265330_10116950
594 Ga0265332_10014079
595 Ga0265332_10043138
596 Ga0265328_10009499
597 Ga0265328_10071402
598 Ga0265325_10000020
599 Ga0265325_10000266
600 Ga0265340_10037181
601 Ga0265340_10039917
602 Ga0265339_10005214
603 Ga0265339_10011260
604 Ga0265339_10058891
605 Ga0265339_10103883
606 Ga0265316_10001379
607 Ga0265316_10003675
608 Ga0265316_10009443
609 Ga0265316_10010853
610 Ga0265316_10011160
611 Ga0265316_10183157
612 Ga0265313_10009680
613 Ga0265313_10095908
614 Ga0307508_10417222
615 Ga0265314_10000025
616 Ga0265314_10124028
617 Ga0265342_10000225
618 Ga0265342_10000586
619 Ga0265342_10016145
620 Ga0265342_10020744
621 Ga0265342_10165809
622 Ga0265342_10192662
623 Ga0316214_1007251
624 Ga0316214_1007938
625 Ga0373934_0024311
626 Ga0373923_0157997
627 Ga0373936_0051138
628 Ga0373954_0098309
629 Ga0373955_0091576
630 Ga0373955_0225667
631 Ga0373924_0123543
632 Ga0373935_0098077
633 Ga0373927_0016285
634 Ga0373947_0005597
635 Ga0373947_0269886
636 Ga0373937_0017705
637 Ga0373937_0026268
638 Ga0373925_0089946
639 Ga0373925_0705615
640 Ga0436364_0009064
641 Ga0436364_1288248
642 Ga0395901_0180199
643 Ga0436365_0726921
644 Ga0436365_1557691
645 Ga0436360_0122286
646 Ga0436360_0460600
647 Ga0436360_0827341
648 Ga0436361_0057308
649 Ga0436361_0361747
650 Ga0436361_0908651
651 Ga0436361_1060109
652 Ga0436363_0876065
653 Ga0436363_1185795
654 Ga0436362_0041631
655 Ga0466959_0216727
656 Ga0495651_0036377
657 Ga0495653_0374680
658 Ga0495580_0000687
659 Ga0495580_0092237
660 Ga0495580_0144481
661 Ga0495580_0228686
662 Ga0495580_0455619
663 Ga0495607_0024495
664 Ga0495583_0173627
665 Ga0495628_0083556
666 Ga0495630_0423327
667 Ga0495652_0101950
668 Ga0495652_0141190
669 Ga0495652_0393009
670 Ga0495665_0008528
671 Ga0495640_0150910
672 Ga0495587_0009644
673 Ga0495645_0001223
674 Ga0495645_0035435
675 Ga0495645_0129283
676 Ga0495645_0220330
677 Ga0495634_0079776
678 Ga0495635_0174439
679 Ga0495623_0181845
680 Ga0495646_0253508
681 Ga0495647_0043313
682 Ga0495658_0187066
683 Ga0495600_0020101
684 Ga0495604_0050091
685 Ga0495674_0071024
686 Ga0495674_0308310
687 Ga0495672_0006398
688 Ga0495683_0000646
689 Ga0495684_0014268
690 Ga0495686_0005459
691 Ga0495686_0008096
692 Ga0496101_0197119
693 Ga0496101_0370741
694 Ga0496102_0086463
695 Ga0496102_0317393
696 Ga0496104_0058607
697 Ga0496104_0299401
698 Ga0496105_0113621
699 Ga0496105_0168051
700 Ga0496105_0590169
701 Ga0496107_0010159
702 Ga0496109_0291113
703 Ga0496112_0089744
704 Ga0496112_0115455
705 Ga0496112_0466157
706 Ga0496113_0424604
707 Ga0496114_0190169
708 Ga0496115_0029766
709 Ga0496115_0184989
710 Ga0496124_0219993
711 Ga0496126_0000091
712 Ga0496126_0001289
713 Ga0496126_0005046
714 Ga0496126_0379458
715 Ga0501031_0017966
716 Ga0501032_0008312
717 Ga0501034_0020708
718 Ga0501036_0067324
719 Ga0501037_0026874
720 Ga0501038_0000798
721 Ga0501043_0020993
722 Ga0501046_0002025
723 Ga0501047_0002667
724 Ga0501070_0148172
725 Ga0501080_0025626
726 Ga0501035_0011557
727 Ga0501044_0021066
728 nmdc:mga0n895_39300_c1
729 nmdc:mga0n895_422114_c1
730 nmdc:mga08x19_1148_c1
731 Ga0495619_0261498
732 2884216835

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01987

AIM24

Mitochondrial biogenesis AIM24

37

240

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yox-assembly1.cif.gz_A structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa 0.8683 2 225
1yox-assembly2.cif.gz_E structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa 0.8677 2 226
1yox-assembly2.cif.gz_F structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa 0.8641 2 225
1yox-assembly1.cif.gz_B structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa 0.8533 2 226
1yox-assembly1.cif.gz_C structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa 0.8525 2 225
ID Description Score Start End Superfamily
1yoxA00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 0.8542 2 225 3.60.160.10
1yoxA00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 0.8027 2 225 3.60.160.10
af_Q54F06_101_330_3.60.160.10 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 0.7956 2 225 3.60.160.10
af_Q54F06_101_330_3.60.160.10 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 0.767 2 225 3.60.160.10
1pg6A00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 0.7569 1 226 3.60.160.10
ID Description Score Start End GO Terms
AF-E6PWL6-F1-model_v4 Protein containing DUF124 0.9127 1 163
AF-A0A536FRP2-F1-model_v4 AIM24 family protein 0.9067 1 185
AF-A0A662SPU1-F1-model_v4 TIGR00266 family protein 0.9024 15 182
AF-A0A535NZB3-F1-model_v4 AIM24 family protein 0.8975 83 230
AF-A0A536FRP2-F1-model_v4 AIM24 family protein 0.8972 1 185

Map