F423905

General Info

Members Datasets Scaffolds Average Seq Length
366 185 732 136

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100319127|Ga0070683_1003191272
Length 143
Sequence MTGLIGATSGSLRRGWISLCAVLGLAGAGAALAHHSFAMYDSDHQIKLAGTVTSFEWNNPHVYIALTSSDEHGDTKGYTVECASPGILNRVGWKFNMIKPGDKITVIIAPLKTGEPGGLLKQLTLADGRVFSNGGPAGKPNIQ

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
137 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
138 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
139 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
157 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
158 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
161 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
162 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
163 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
167 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
172 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
179 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.55
Rhizosphere 98.09
Stem 0
Stem Tuber 0
Unclassified 27.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100319127 3300005329 Bacteria 1478
2 Ga0065707_10513119 3300005295 Unclassified 748
3 Ga0070676_10010989 3300005328 Unclassified 4917
4 Ga0070690_100033225 3300005330 Unclassified 3228
5 Ga0070670_100013016 3300005331 Bacteria 7126
6 Ga0070670_100132986 3300005331 Bacteria 2149
7 Ga0070677_10095815 3300005333 Unclassified 1299
8 Ga0070677_10161925 3300005333 Bacteria 1050
9 Ga0070677_10179881 3300005333 Unclassified 1006
10 Ga0068869_100011358 3300005334 Bacteria 5837
11 Ga0068869_100154465 3300005334 Bacteria 1782
12 Ga0070666_10221963 3300005335 Unclassified 1333
13 Ga0070666_10496998 3300005335 Bacteria 884
14 Ga0070680_100212067 3300005336 Bacteria 1634
15 Ga0070680_100757321 3300005336 Bacteria 836
16 Ga0070680_101698163 3300005336 Unclassified 547
17 Ga0068868_100367844 3300005338 Bacteria 1235
18 Ga0068868_100412089 3300005338 Bacteria 1168
19 Ga0068868_100632256 3300005338 Unclassified 951
20 Ga0068868_101079275 3300005338 Bacteria 738
21 Ga0070689_100330579 3300005340 Unclassified 1275
22 Ga0070689_100462911 3300005340 Bacteria 1081
23 Ga0070687_100385213 3300005343 Unclassified 915
24 Ga0070687_101356865 3300005343 Unclassified 530
25 Ga0070661_100617192 3300005344 Bacteria 878
26 Ga0070669_100021915 3300005353 Bacteria 4569
27 Ga0070669_100034947 3300005353 Bacteria 3640
28 Ga0070669_100109788 3300005353 Bacteria 2092
29 Ga0070669_100120061 3300005353 Bacteria 2004
30 Ga0070669_100166829 3300005353 Unclassified 1714
31 Ga0070675_100000390 3300005354 Bacteria 29739
32 Ga0070675_100000970 3300005354 Bacteria 20511
33 Ga0070675_100280020 3300005354 Bacteria 1465
34 Ga0070675_100447213 3300005354 Bacteria 1158
35 Ga0070675_100703317 3300005354 Bacteria 920
36 Ga0070675_100763468 3300005354 Bacteria 883
37 Ga0070675_101365772 3300005354 Bacteria 653
38 Ga0070675_101424332 3300005354 Bacteria 639
39 Ga0070675_101539555 3300005354 Unclassified 613
40 Ga0070671_100199762 3300005355 Unclassified 1695
41 Ga0070671_100712082 3300005355 Unclassified 871
42 Ga0070674_100005708 3300005356 Bacteria 7219
43 Ga0070674_100417106 3300005356 Bacteria 1100
44 Ga0070673_100010001 3300005364 Bacteria 6397
45 Ga0070673_100037634 3300005364 Unclassified 3688
46 Ga0070673_100291160 3300005364 Bacteria 1435
47 Ga0070673_101267898 3300005364 Bacteria 692
48 Ga0070673_102042977 3300005364 Bacteria 544
49 Ga0070667_100219343 3300005367 Unclassified 1693
50 Ga0070667_101515167 3300005367 Unclassified 630
51 Ga0070709_11584855 3300005434 Unclassified 533
52 Ga0070713_100462487 3300005436 Bacteria 1193
53 Ga0070713_100731017 3300005436 Unclassified 946
54 Ga0070701_10050073 3300005438 Bacteria 2161
55 Ga0070701_11001439 3300005438 Bacteria 583
56 Ga0070700_100003331 3300005441 Bacteria 8283
57 Ga0070700_100783958 3300005441 Unclassified 766
58 Ga0070694_100172982 3300005444 Unclassified 1592
59 Ga0070694_100287773 3300005444 Bacteria 1255
60 Ga0070708_100248139 3300005445 Bacteria 1672
61 Ga0070663_100065510 3300005455 Bacteria 2630
62 Ga0070678_100104620 3300005456 Bacteria 2202
63 Ga0070662_100147617 3300005457 Bacteria 1828
64 Ga0070681_10000460 3300005458 Bacteria 33209
65 Ga0070681_10074937 3300005458 Bacteria 3344
66 Ga0068867_100005160 3300005459 Bacteria 9214
67 Ga0068867_100527622 3300005459 Bacteria 1019
68 Ga0070685_10580525 3300005466 Bacteria 804
69 Ga0070685_11041869 3300005466 Unclassified 616
70 Ga0070698_100071044 3300005471 Bacteria 3492
71 Ga0070698_100365180 3300005471 Unclassified 1376
72 Ga0070679_100442818 3300005530 Bacteria 1244
73 Ga0070684_100083505 3300005535 Bacteria 2830
74 Ga0070684_100210592 3300005535 Bacteria 1771
75 Ga0070684_100668888 3300005535 Unclassified 967
76 Ga0070672_100033607 3300005543 Bacteria 3885
77 Ga0070672_100084808 3300005543 Bacteria 2545
78 Ga0070672_100108086 3300005543 Unclassified 2264
79 Ga0070672_100938416 3300005543 Unclassified 765
80 Ga0070686_100018909 3300005544 Bacteria 4052
81 Ga0070693_100101173 3300005547 Unclassified 1756
82 Ga0070665_100006960 3300005548 Bacteria 11497
83 Ga0070665_100324379 3300005548 Bacteria 1544
84 Ga0070664_100018323 3300005564 Bacteria 5749
85 Ga0068854_100494326 3300005578 Bacteria 1029
86 Ga0068856_100672088 3300005614 Bacteria 1056
87 Ga0070702_100323278 3300005615 Bacteria 1076
88 Ga0070702_100563823 3300005615 Bacteria 848
89 Ga0068852_100876186 3300005616 Bacteria 914
90 Ga0068859_100146188 3300005617 Bacteria 2439
91 Ga0068859_101113020 3300005617 Unclassified 869
92 Ga0068859_101705948 3300005617 Unclassified 696
93 Ga0068864_100013311 3300005618 Bacteria 6814
94 Ga0068864_100241758 3300005618 Bacteria 1673
95 Ga0068864_100729309 3300005618 Unclassified 970
96 Ga0068864_100790664 3300005618 Unclassified 932
97 Ga0068866_10028160 3300005718 Unclassified 2675
98 Ga0068866_10388932 3300005718 Bacteria 896
99 Ga0068861_100014097 3300005719 Bacteria 5604
100 Ga0068861_100057702 3300005719 Bacteria 2966
101 Ga0068861_100069969 3300005719 Bacteria 2716
102 Ga0068861_100247062 3300005719 Bacteria 1521
103 Ga0068861_100455812 3300005719 Unclassified 1147
104 Ga0068861_100624898 3300005719 Bacteria 992
105 Ga0068861_101258626 3300005719 Bacteria 718
106 Ga0068861_101300357 3300005719 Unclassified 707
107 Ga0068861_101369511 3300005719 Bacteria 690
108 Ga0068851_10023058 3300005834 Bacteria 3039
109 Ga0068870_10224558 3300005840 Bacteria 1151
110 Ga0068863_100050482 3300005841 Bacteria 3943
111 Ga0068858_100036903 3300005842 Bacteria 4530
112 Ga0068858_100205585 3300005842 Unclassified 1863
113 Ga0068858_101263155 3300005842 Unclassified 726
114 Ga0068860_100063944 3300005843 Bacteria 3495
115 Ga0068860_100239616 3300005843 Bacteria 1764
116 Ga0068862_100295091 3300005844 Bacteria 1490
117 Ga0068862_100406884 3300005844 Bacteria 1274
118 Ga0068862_100897077 3300005844 Unclassified 871
119 Ga0081539_10000006 3300005985 Bacteria 534555
120 Ga0081539_10059173 3300005985 Bacteria 2110
121 Ga0097621_100453993 3300006237 Bacteria 1155
122 Ga0097621_101629980 3300006237 Unclassified 614
123 Ga0068871_100044525 3300006358 Bacteria 3570
124 Ga0068871_100178261 3300006358 Bacteria 1825
125 Ga0068871_100233915 3300006358 Unclassified 1596
126 Ga0075428_100509662 3300006844 Bacteria 1287
127 Ga0075433_10000202 3300006852 Bacteria 33478
128 Ga0075433_10001786 3300006852 Bacteria 16117
129 Ga0075433_11091694 3300006852 Bacteria 694
130 Ga0075434_100000526 3300006871 Bacteria 29136
131 Ga0075434_100027352 3300006871 Bacteria 5599
132 Ga0068865_100083415 3300006881 Bacteria 2300
133 Ga0075436_100042896 3300006914 Bacteria 3119
134 Ga0097620_100131547 3300006931 Bacteria 2574
135 Ga0097620_100146194 3300006931 Bacteria 2439
136 Ga0097620_101113065 3300006931 Unclassified 869
137 Ga0097620_101705975 3300006931 Unclassified 696
138 Ga0075435_100002177 3300007076 Bacteria 12923
139 Ga0105240_10058520 3300009093 Bacteria 4811
140 Ga0111539_10000577 3300009094 Bacteria 47124
141 Ga0111539_10456298 3300009094 Bacteria 1488
142 Ga0111539_10481857 3300009094 Unclassified 1445
143 Ga0114129_10053222 3300009147 Bacteria 5677
144 Ga0114129_10212359 3300009147 Unclassified 2615
145 Ga0114129_12059614 3300009147 Bacteria 689
146 Ga0105243_10008460 3300009148 Bacteria 7899
147 Ga0105243_10483910 3300009148 Bacteria 1169
148 Ga0105242_10220543 3300009176 Unclassified 1695
149 Ga0105242_10722941 3300009176 Bacteria 977
150 Ga0105242_10853032 3300009176 Unclassified 907
151 Ga0105248_10250241 3300009177 Bacteria 1994
152 Ga0105248_10878696 3300009177 Bacteria 1012
153 Ga0105248_11825279 3300009177 Unclassified 690
154 Ga0105237_10239454 3300009545 Bacteria 1816
155 Ga0105238_10025760 3300009551 Bacteria 5997
156 Ga0105238_10314423 3300009551 Bacteria 1551
157 Ga0105238_10361071 3300009551 Bacteria 1442
158 Ga0105238_10371906 3300009551 Bacteria 1420
159 Ga0105238_10465358 3300009551 Bacteria 1262
160 Ga0105238_11090322 3300009551 Bacteria 821
161 Ga0105238_11729958 3300009551 Unclassified 657
162 Ga0105249_10126275 3300009553 Bacteria 2436
163 Ga0105239_10586062 3300010375 Viruses 1271
164 Ga0105246_10415309 3300011119 Bacteria 1121
165 Ga0157345_1039910 3300012498 Bacteria 561
166 Ga0157369_10077794 3300013105 Bacteria 3555
167 Ga0157369_11060010 3300013105 Bacteria 829
168 Ga0157369_11566705 3300013105 Bacteria 670
169 Ga0157369_11606984 3300013105 Bacteria 661
170 Ga0157374_10127536 3300013296 Bacteria 2460
171 Ga0157374_11244021 3300013296 Bacteria 766
172 Ga0157378_10106368 3300013297 Unclassified 2566
173 Ga0157378_10108871 3300013297 Bacteria 2538
174 Ga0157378_12403680 3300013297 Bacteria 579
175 Ga0163162_12305229 3300013306 Bacteria 618
176 Ga0157372_10412700 3300013307 Bacteria 1573
177 Ga0157375_10247901 3300013308 Bacteria 1941
178 Ga0163163_10172924 3300014325 Bacteria 2207
179 Ga0157380_10003552 3300014326 Bacteria 10719
180 Ga0157380_10038414 3300014326 Bacteria 3717
181 Ga0157380_10061913 3300014326 Unclassified 2996
182 Ga0157380_10366083 3300014326 Unclassified 1355
183 Ga0157380_10483076 3300014326 Bacteria 1199
184 Ga0157380_10577226 3300014326 Bacteria 1108
185 Ga0157380_11497243 3300014326 Unclassified 728
186 Ga0157377_10068396 3300014745 Unclassified 2046
187 Ga0157377_10098702 3300014745 Bacteria 1736
188 Ga0157376_10171107 3300014969 Bacteria 1978
189 Ga0157376_10240136 3300014969 Bacteria 1688
190 Ga0157376_10276514 3300014969 Bacteria 1580
191 Ga0157376_10320862 3300014969 Unclassified 1473
192 Ga0157376_10403688 3300014969 Unclassified 1322
193 Ga0157376_10895794 3300014969 Unclassified 905
194 Ga0207656_10017146 3300025321 Bacteria 2832
195 Ga0207682_10019579 3300025893 Bacteria 2651
196 Ga0207682_10036202 3300025893 Unclassified 1997
197 Ga0207642_10003132 3300025899 Bacteria 5185
198 Ga0207688_10132583 3300025901 Unclassified 1461
199 Ga0207680_10446650 3300025903 Unclassified 918
200 Ga0207680_10492100 3300025903 Bacteria 873
201 Ga0207645_10006606 3300025907 Bacteria 8291
202 Ga0207645_10828871 3300025907 Bacteria 629
203 Ga0207643_10006642 3300025908 Bacteria 6202
204 Ga0207643_10030523 3300025908 Unclassified 3000
205 Ga0207643_10392090 3300025908 Bacteria 877
206 Ga0207643_10401732 3300025908 Unclassified 866
207 Ga0207707_10018476 3300025912 Bacteria 6078
208 Ga0207707_10025002 3300025912 Bacteria 5226
209 Ga0207707_10981038 3300025912 Bacteria 694
210 Ga0207695_10052050 3300025913 Bacteria 4293
211 Ga0207695_11498621 3300025913 Unclassified 555
212 Ga0207671_10128900 3300025914 Bacteria 1940
213 Ga0207671_10775395 3300025914 Unclassified 761
214 Ga0207693_10210641 3300025915 Bacteria 1528
215 Ga0207660_10277041 3300025917 Bacteria 1330
216 Ga0207662_10254375 3300025918 Bacteria 1154
217 Ga0207662_10553355 3300025918 Bacteria 797
218 Ga0207681_10013793 3300025923 Bacteria 5006
219 Ga0207681_10030098 3300025923 Unclassified 3536
220 Ga0207681_10034061 3300025923 Unclassified 3346
221 Ga0207681_10139388 3300025923 Unclassified 1804
222 Ga0207694_10089276 3300025924 Bacteria 2431
223 Ga0207694_10112444 3300025924 Bacteria 2167
224 Ga0207694_10726259 3300025924 Bacteria 838
225 Ga0207650_10028058 3300025925 Bacteria 4034
226 Ga0207650_10077339 3300025925 Bacteria 2516
227 Ga0207659_10000580 3300025926 Bacteria 22027
228 Ga0207659_10006488 3300025926 Bacteria 7169
229 Ga0207659_10349872 3300025926 Bacteria 1226
230 Ga0207659_10422687 3300025926 Unclassified 1118
231 Ga0207659_10481408 3300025926 Unclassified 1049
232 Ga0207659_10988224 3300025926 Bacteria 724
233 Ga0207659_11149809 3300025926 Bacteria 667
234 Ga0207687_10639194 3300025927 Bacteria 899
235 Ga0207700_10149248 3300025928 Bacteria 1930
236 Ga0207700_10452369 3300025928 Bacteria 1132
237 Ga0207700_10831566 3300025928 Unclassified 826
238 Ga0207644_10461723 3300025931 Unclassified 1044
239 Ga0207686_10007447 3300025934 Bacteria 5891
240 Ga0207709_10114309 3300025935 Bacteria 1811
241 Ga0207670_10211125 3300025936 Bacteria 1481
242 Ga0207669_10018165 3300025937 Bacteria 3627
243 Ga0207704_10006688 3300025938 Bacteria 5400
244 Ga0207704_10145824 3300025938 Bacteria 1663
245 Ga0207704_10793436 3300025938 Bacteria 790
246 Ga0207691_10025920 3300025940 Bacteria 5502
247 Ga0207691_10064679 3300025940 Bacteria 3313
248 Ga0207691_10496334 3300025940 Bacteria 1037
249 Ga0207691_10550519 3300025940 Unclassified 978
250 Ga0207691_10886923 3300025940 Unclassified 747
251 Ga0207711_10417030 3300025941 Unclassified 1248
252 Ga0207711_10795883 3300025941 Bacteria 881
253 Ga0207689_10009438 3300025942 Bacteria 8424
254 Ga0207689_10128323 3300025942 Bacteria 2086
255 Ga0207689_10693320 3300025942 Bacteria 859
256 Ga0207661_10058816 3300025944 Unclassified 3095
257 Ga0207661_10345336 3300025944 Bacteria 1342
258 Ga0207679_10011736 3300025945 Bacteria 5689
259 Ga0207667_10463680 3300025949 Bacteria 1287
260 Ga0207651_10146193 3300025960 Unclassified 1833
261 Ga0207651_10158452 3300025960 Bacteria 1771
262 Ga0207712_10053268 3300025961 Bacteria 2837
263 Ga0207640_10169610 3300025981 Bacteria 1625
264 Ga0207640_10229840 3300025981 Unclassified 1426
265 Ga0207658_10464553 3300025986 Bacteria 1122
266 Ga0207658_10850588 3300025986 Bacteria 829
267 Ga0207677_10401459 3300026023 Bacteria 1162
268 Ga0207677_10402894 3300026023 Bacteria 1161
269 Ga0207677_10588128 3300026023 Bacteria 975
270 Ga0207677_11253316 3300026023 Bacteria 680
271 Ga0207677_11948755 3300026023 Unclassified 546
272 Ga0207703_10021899 3300026035 Bacteria 5005
273 Ga0207703_10979684 3300026035 Unclassified 811
274 Ga0207678_10016394 3300026067 Bacteria 6505
275 Ga0207708_10009376 3300026075 Bacteria 7247
276 Ga0207708_10108058 3300026075 Bacteria 2157
277 Ga0207708_10267032 3300026075 Bacteria 1383
278 Ga0207708_11169756 3300026075 Unclassified 672
279 Ga0207641_10167703 3300026088 Unclassified 2001
280 Ga0207641_11785094 3300026088 Bacteria 617
281 Ga0207648_10005401 3300026089 Bacteria 12881
282 Ga0207676_10015022 3300026095 Bacteria 5582
283 Ga0207676_10041217 3300026095 Bacteria 3543
284 Ga0207676_10822518 3300026095 Unclassified 907
285 Ga0207674_11191805 3300026116 Bacteria 731
286 Ga0207675_100089509 3300026118 Bacteria 2893
287 Ga0207675_100154492 3300026118 Bacteria 2186
288 Ga0207675_100179234 3300026118 Bacteria 2028
289 Ga0207675_100310807 3300026118 Unclassified 1537
290 Ga0207675_100318893 3300026118 Bacteria 1517
291 Ga0207675_100355915 3300026118 Unclassified 1435
292 Ga0207675_100625539 3300026118 Bacteria 1081
293 Ga0207675_101878239 3300026118 Unclassified 618
294 Ga0207683_10056350 3300026121 Bacteria 3447
295 Ga0207683_10068094 3300026121 Bacteria 3142
296 Ga0207698_11217659 3300026142 Bacteria 767
297 Ga0207428_10039960 3300027907 Bacteria 3808
298 Ga0268266_10005010 3300028379 Bacteria 12513
299 Ga0268266_10262135 3300028379 Bacteria 1602
300 Ga0268265_10119407 3300028380 Bacteria 2169
301 Ga0268265_10249908 3300028380 Bacteria 1570
302 Ga0268265_10539316 3300028380 Bacteria 1106
303 Ga0268264_10065959 3300028381 Unclassified 3052
304 Ga0268264_10145321 3300028381 Bacteria 2120
305 Ga0268264_10770131 3300028381 Bacteria 960
306 Ga0265319_1046982 3300028563 Unclassified 1438
307 Ga0265318_10090899 3300028577 Bacteria 1124
308 Ga0265320_10026329 3300031240 Bacteria 3046
309 Ga0265340_10146057 3300031247 Unclassified 1080
310 Ga0265331_10001343 3300031250 Bacteria 18138
311 Ga0307509_10290531 3300031507 Bacteria 1390
312 Ga0307408_100080268 3300031548 Bacteria 2436
313 Ga0265313_10083652 3300031595 Bacteria 1445
314 Ga0265314_10052275 3300031711 Bacteria 2841
315 Ga0307405_10542799 3300031731 Bacteria 939
316 Ga0307413_10000791 3300031824 Bacteria 10984
317 Ga0307410_10004538 3300031852 Bacteria 7195
318 Ga0307410_10491455 3300031852 Bacteria 1008
319 Ga0307406_10006029 3300031901 Bacteria 6658
320 Ga0307407_10006820 3300031903 Bacteria 5117
321 Ga0307412_10054441 3300031911 Bacteria 2656
322 Ga0307409_100277382 3300031995 Bacteria 1547
323 Ga0307409_100545655 3300031995 Bacteria 1137
324 Ga0307416_100070011 3300032002 Bacteria 2906
325 Ga0307416_101369827 3300032002 Bacteria 813
326 Ga0307414_10013995 3300032004 Bacteria 4794
327 Ga0307411_10003018 3300032005 Bacteria 7675
328 Ga0307411_10036670 3300032005 Bacteria 3075
329 Ga0307415_100038790 3300032126 Bacteria 3142
330 Ga0307415_100105376 3300032126 Unclassified 2079
331 Ga0373952_0135275 3300035092 Unclassified 680
332 Ga0451807_1782852 3300041486 Bacteria 917
333 Ga0451849_0511483 3300041505 Bacteria 522
334 Ga0451853_1281546 3300041512 Bacteria 1905
335 Ga0439446_0278236 3300042156 Bacteria 583
336 Ga0439434_0147442 3300042435 Unclassified 778
337 Ga0450918_029468 3300042531 Bacteria 968
338 Ga0466969_0001817 3300044656 Bacteria 11390
339 Ga0466966_0882951 3300044684 Unclassified 539
340 Ga0466961_0157626 3300044693 Bacteria 1416
341 Ga0453684_2390247 3300044712 Bacteria 524
342 Ga0466971_0237942 3300044719 Unclassified 865
343 Ga0466959_0037959 3300045049 Bacteria 3560
344 Ga0451576_0654876 3300045051 Bacteria 1104
345 Ga0495603_0881984 3300046455 Unclassified 509
346 Ga0495643_0038782 3300046522 Unclassified 2607
347 Ga0495598_0082946 3300046537 Unclassified 1032
348 Ga0495668_0320716 3300046616 Unclassified 850
349 Ga0495669_0074748 3300046684 Unclassified 1549
350 Ga0496101_1375611 3300048904 Unclassified 551
351 Ga0496125_0145485 3300048928 Bacteria 1639
352 Ga0496126_0002415 3300048929 Bacteria 25280
353 Ga0501299_176065 3300049522 Unclassified 556
354 Ga0501206_085361 3300049653 Bacteria 554
355 nmdc:mga05p37_118417_c1 3300050507 Unclassified 2400
356 nmdc:mga08y16_159_c2 3300050511 Bacteria 44026
357 nmdc:mga08y16_405556_c1 3300050511 Unclassified 1394
358 nmdc:mga08y16_774200_c1 3300050511 Unclassified 954
359 nmdc:mga0n895_26697_c1 3300050512 Bacteria 5474
360 nmdc:mga0n895_6071_c1 3300050512 Bacteria 10189
361 nmdc:mga0rr50_1063436_c1 3300050513 Bacteria 689
362 nmdc:mga0rr50_2819_c1 3300050513 Bacteria 9885
363 nmdc:mga0a205_1013889_c1 3300050515 Bacteria 677
364 nmdc:mga0a205_2503_c1 3300050515 Bacteria 16199
365 nmdc:mga0a205_76_c1 3300050515 Bacteria 54611
366 Ga0501082_1622262 3300060353 Bacteria 565
367 Ga0070683_100319127
368 Ga0065707_10513119
369 Ga0070676_10010989
370 Ga0070690_100033225
371 Ga0070670_100013016
372 Ga0070670_100132986
373 Ga0070677_10095815
374 Ga0070677_10161925
375 Ga0070677_10179881
376 Ga0068869_100011358
377 Ga0068869_100154465
378 Ga0070666_10221963
379 Ga0070666_10496998
380 Ga0070680_100212067
381 Ga0070680_100757321
382 Ga0070680_101698163
383 Ga0068868_100367844
384 Ga0068868_100412089
385 Ga0068868_100632256
386 Ga0068868_101079275
387 Ga0070689_100330579
388 Ga0070689_100462911
389 Ga0070687_100385213
390 Ga0070687_101356865
391 Ga0070661_100617192
392 Ga0070669_100021915
393 Ga0070669_100034947
394 Ga0070669_100109788
395 Ga0070669_100120061
396 Ga0070669_100166829
397 Ga0070675_100000390
398 Ga0070675_100000970
399 Ga0070675_100280020
400 Ga0070675_100447213
401 Ga0070675_100703317
402 Ga0070675_100763468
403 Ga0070675_101365772
404 Ga0070675_101424332
405 Ga0070675_101539555
406 Ga0070671_100199762
407 Ga0070671_100712082
408 Ga0070674_100005708
409 Ga0070674_100417106
410 Ga0070673_100010001
411 Ga0070673_100037634
412 Ga0070673_100291160
413 Ga0070673_101267898
414 Ga0070673_102042977
415 Ga0070667_100219343
416 Ga0070667_101515167
417 Ga0070709_11584855
418 Ga0070713_100462487
419 Ga0070713_100731017
420 Ga0070701_10050073
421 Ga0070701_11001439
422 Ga0070700_100003331
423 Ga0070700_100783958
424 Ga0070694_100172982
425 Ga0070694_100287773
426 Ga0070708_100248139
427 Ga0070663_100065510
428 Ga0070678_100104620
429 Ga0070662_100147617
430 Ga0070681_10000460
431 Ga0070681_10074937
432 Ga0068867_100005160
433 Ga0068867_100527622
434 Ga0070685_10580525
435 Ga0070685_11041869
436 Ga0070698_100071044
437 Ga0070698_100365180
438 Ga0070679_100442818
439 Ga0070684_100083505
440 Ga0070684_100210592
441 Ga0070684_100668888
442 Ga0070672_100033607
443 Ga0070672_100084808
444 Ga0070672_100108086
445 Ga0070672_100938416
446 Ga0070686_100018909
447 Ga0070693_100101173
448 Ga0070665_100006960
449 Ga0070665_100324379
450 Ga0070664_100018323
451 Ga0068854_100494326
452 Ga0068856_100672088
453 Ga0070702_100323278
454 Ga0070702_100563823
455 Ga0068852_100876186
456 Ga0068859_100146188
457 Ga0068859_101113020
458 Ga0068859_101705948
459 Ga0068864_100013311
460 Ga0068864_100241758
461 Ga0068864_100729309
462 Ga0068864_100790664
463 Ga0068866_10028160
464 Ga0068866_10388932
465 Ga0068861_100014097
466 Ga0068861_100057702
467 Ga0068861_100069969
468 Ga0068861_100247062
469 Ga0068861_100455812
470 Ga0068861_100624898
471 Ga0068861_101258626
472 Ga0068861_101300357
473 Ga0068861_101369511
474 Ga0068851_10023058
475 Ga0068870_10224558
476 Ga0068863_100050482
477 Ga0068858_100036903
478 Ga0068858_100205585
479 Ga0068858_101263155
480 Ga0068860_100063944
481 Ga0068860_100239616
482 Ga0068862_100295091
483 Ga0068862_100406884
484 Ga0068862_100897077
485 Ga0081539_10000006
486 Ga0081539_10059173
487 Ga0097621_100453993
488 Ga0097621_101629980
489 Ga0068871_100044525
490 Ga0068871_100178261
491 Ga0068871_100233915
492 Ga0075428_100509662
493 Ga0075433_10000202
494 Ga0075433_10001786
495 Ga0075433_11091694
496 Ga0075434_100000526
497 Ga0075434_100027352
498 Ga0068865_100083415
499 Ga0075436_100042896
500 Ga0097620_100131547
501 Ga0097620_100146194
502 Ga0097620_101113065
503 Ga0097620_101705975
504 Ga0075435_100002177
505 Ga0105240_10058520
506 Ga0111539_10000577
507 Ga0111539_10456298
508 Ga0111539_10481857
509 Ga0114129_10053222
510 Ga0114129_10212359
511 Ga0114129_12059614
512 Ga0105243_10008460
513 Ga0105243_10483910
514 Ga0105242_10220543
515 Ga0105242_10722941
516 Ga0105242_10853032
517 Ga0105248_10250241
518 Ga0105248_10878696
519 Ga0105248_11825279
520 Ga0105237_10239454
521 Ga0105238_10025760
522 Ga0105238_10314423
523 Ga0105238_10361071
524 Ga0105238_10371906
525 Ga0105238_10465358
526 Ga0105238_11090322
527 Ga0105238_11729958
528 Ga0105249_10126275
529 Ga0105239_10586062
530 Ga0105246_10415309
531 Ga0157345_1039910
532 Ga0157369_10077794
533 Ga0157369_11060010
534 Ga0157369_11566705
535 Ga0157369_11606984
536 Ga0157374_10127536
537 Ga0157374_11244021
538 Ga0157378_10106368
539 Ga0157378_10108871
540 Ga0157378_12403680
541 Ga0163162_12305229
542 Ga0157372_10412700
543 Ga0157375_10247901
544 Ga0163163_10172924
545 Ga0157380_10003552
546 Ga0157380_10038414
547 Ga0157380_10061913
548 Ga0157380_10366083
549 Ga0157380_10483076
550 Ga0157380_10577226
551 Ga0157380_11497243
552 Ga0157377_10068396
553 Ga0157377_10098702
554 Ga0157376_10171107
555 Ga0157376_10240136
556 Ga0157376_10276514
557 Ga0157376_10320862
558 Ga0157376_10403688
559 Ga0157376_10895794
560 Ga0207656_10017146
561 Ga0207682_10019579
562 Ga0207682_10036202
563 Ga0207642_10003132
564 Ga0207688_10132583
565 Ga0207680_10446650
566 Ga0207680_10492100
567 Ga0207645_10006606
568 Ga0207645_10828871
569 Ga0207643_10006642
570 Ga0207643_10030523
571 Ga0207643_10392090
572 Ga0207643_10401732
573 Ga0207707_10018476
574 Ga0207707_10025002
575 Ga0207707_10981038
576 Ga0207695_10052050
577 Ga0207695_11498621
578 Ga0207671_10128900
579 Ga0207671_10775395
580 Ga0207693_10210641
581 Ga0207660_10277041
582 Ga0207662_10254375
583 Ga0207662_10553355
584 Ga0207681_10013793
585 Ga0207681_10030098
586 Ga0207681_10034061
587 Ga0207681_10139388
588 Ga0207694_10089276
589 Ga0207694_10112444
590 Ga0207694_10726259
591 Ga0207650_10028058
592 Ga0207650_10077339
593 Ga0207659_10000580
594 Ga0207659_10006488
595 Ga0207659_10349872
596 Ga0207659_10422687
597 Ga0207659_10481408
598 Ga0207659_10988224
599 Ga0207659_11149809
600 Ga0207687_10639194
601 Ga0207700_10149248
602 Ga0207700_10452369
603 Ga0207700_10831566
604 Ga0207644_10461723
605 Ga0207686_10007447
606 Ga0207709_10114309
607 Ga0207670_10211125
608 Ga0207669_10018165
609 Ga0207704_10006688
610 Ga0207704_10145824
611 Ga0207704_10793436
612 Ga0207691_10025920
613 Ga0207691_10064679
614 Ga0207691_10496334
615 Ga0207691_10550519
616 Ga0207691_10886923
617 Ga0207711_10417030
618 Ga0207711_10795883
619 Ga0207689_10009438
620 Ga0207689_10128323
621 Ga0207689_10693320
622 Ga0207661_10058816
623 Ga0207661_10345336
624 Ga0207679_10011736
625 Ga0207667_10463680
626 Ga0207651_10146193
627 Ga0207651_10158452
628 Ga0207712_10053268
629 Ga0207640_10169610
630 Ga0207640_10229840
631 Ga0207658_10464553
632 Ga0207658_10850588
633 Ga0207677_10401459
634 Ga0207677_10402894
635 Ga0207677_10588128
636 Ga0207677_11253316
637 Ga0207677_11948755
638 Ga0207703_10021899
639 Ga0207703_10979684
640 Ga0207678_10016394
641 Ga0207708_10009376
642 Ga0207708_10108058
643 Ga0207708_10267032
644 Ga0207708_11169756
645 Ga0207641_10167703
646 Ga0207641_11785094
647 Ga0207648_10005401
648 Ga0207676_10015022
649 Ga0207676_10041217
650 Ga0207676_10822518
651 Ga0207674_11191805
652 Ga0207675_100089509
653 Ga0207675_100154492
654 Ga0207675_100179234
655 Ga0207675_100310807
656 Ga0207675_100318893
657 Ga0207675_100355915
658 Ga0207675_100625539
659 Ga0207675_101878239
660 Ga0207683_10056350
661 Ga0207683_10068094
662 Ga0207698_11217659
663 Ga0207428_10039960
664 Ga0268266_10005010
665 Ga0268266_10262135
666 Ga0268265_10119407
667 Ga0268265_10249908
668 Ga0268265_10539316
669 Ga0268264_10065959
670 Ga0268264_10145321
671 Ga0268264_10770131
672 Ga0265319_1046982
673 Ga0265318_10090899
674 Ga0265320_10026329
675 Ga0265340_10146057
676 Ga0265331_10001343
677 Ga0307509_10290531
678 Ga0307408_100080268
679 Ga0265313_10083652
680 Ga0265314_10052275
681 Ga0307405_10542799
682 Ga0307413_10000791
683 Ga0307410_10004538
684 Ga0307410_10491455
685 Ga0307406_10006029
686 Ga0307407_10006820
687 Ga0307412_10054441
688 Ga0307409_100277382
689 Ga0307409_100545655
690 Ga0307416_100070011
691 Ga0307416_101369827
692 Ga0307414_10013995
693 Ga0307411_10003018
694 Ga0307411_10036670
695 Ga0307415_100038790
696 Ga0307415_100105376
697 Ga0373952_0135275
698 Ga0451807_1782852
699 Ga0451849_0511483
700 Ga0451853_1281546
701 Ga0439446_0278236
702 Ga0439434_0147442
703 Ga0450918_029468
704 Ga0466969_0001817
705 Ga0466966_0882951
706 Ga0466961_0157626
707 Ga0453684_2390247
708 Ga0466971_0237942
709 Ga0466959_0037959
710 Ga0451576_0654876
711 Ga0495603_0881984
712 Ga0495643_0038782
713 Ga0495598_0082946
714 Ga0495668_0320716
715 Ga0495669_0074748
716 Ga0496101_1375611
717 Ga0496125_0145485
718 Ga0496126_0002415
719 Ga0501299_176065
720 Ga0501206_085361
721 nmdc:mga05p37_118417_c1
722 nmdc:mga08y16_159_c2
723 nmdc:mga08y16_405556_c1
724 nmdc:mga08y16_774200_c1
725 nmdc:mga0n895_26697_c1
726 nmdc:mga0n895_6071_c1
727 nmdc:mga0rr50_1063436_c1
728 nmdc:mga0rr50_2819_c1
729 nmdc:mga0a205_1013889_c1
730 nmdc:mga0a205_2503_c1
731 nmdc:mga0a205_76_c1
732 Ga0501082_1622262

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

22

122

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pqa-assembly2.cif.gz_C crystal structure of full-length human rpa 14/32 heterodimer 0.7353 39 122
6cqm-assembly2.cif.gz_H-3 crystal structure of mitochondrial single-stranded dna binding proteins from s. cerevisiae, rim1 (form2) 0.6997 33 129
6lbu-assembly1.cif.gz_A crystal structure of yeast stn1 and ten1 0.6922 39 121
3k58-assembly1.cif.gz_A crystal structure of e.coli pol ii-normal dna-dttp ternary complex 0.689 38 80
6cqm-assembly2.cif.gz_H-3 crystal structure of mitochondrial single-stranded dna binding proteins from s. cerevisiae, rim1 (form2) 0.6855 33 129
ID Description Score Start End Superfamily
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8031 41 100 2.40.50.140
3rlfA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7645 41 101 2.40.50.140
af_A0A0G2KVL6_221_307_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7364 38 121 2.40.50.140
1q1eB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7306 42 98 2.40.50.140
3m4qB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7278 32 104 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A521RFX0-F1-model_v4 Uncharacterized protein 0.947 33 138
AF-A0A2W4Q999-F1-model_v4 DUF5666 domain-containing protein 0.9294 33 127
AF-A0A2W4QIE2-F1-model_v4 Uncharacterized protein 0.9248 27 138
AF-A0A534KH95-F1-model_v4 deleted 0.9217 33 128
AF-A0A2W4Q999-F1-model_v4 DUF5666 domain-containing protein 0.9199 33 127

Map