F423882

General Info

Members Datasets Scaffolds Average Seq Length
366 138 732 129

Family's Representative Sequence

Representative Sequence 3300001915|JGI24741J21665_1015836|JGI24741J21665_10158362
Length 151
Sequence MSQFDNMQGHALDGAARGGEGALMTRIPLLITLAAAAALAGCNKDDHTIVAGGPEVGDTNVAANAPVALPPTISATKIYRCADNAVVYVDWLSDNKTANVRTEKAGSPTQVTAAEPGKPMSAPGGYSVEGSAAASSAKIGVPGHPAQSCKA

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
123 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
124 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
133 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
136 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
137 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
138 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.27
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 0.27
Rhizosphere 99.18
Stem 0
Stem Tuber 0
Unclassified 10.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1015836 3300001915 Bacteria 1239
2 JGI24741J21665_1018630 3300001915 Unclassified 1108
3 JGI24740J21852_10013579 3300001979 Bacteria 3033
4 JGI24739J22299_10017777 3300001989 Bacteria 2562
5 JGI24743J22301_10032585 3300001991 Bacteria 1030
6 JGI24735J21928_10001944 3300002067 Bacteria 7257
7 JGI24738J21930_10003121 3300002075 Bacteria 4241
8 Ga0065715_10233434 3300005293 Bacteria 1225
9 Ga0070658_10001346 3300005327 Bacteria 20990
10 Ga0070658_10029489 3300005327 Bacteria 4408
11 Ga0070658_10078356 3300005327 Bacteria 2712
12 Ga0070658_10116261 3300005327 Bacteria 2219
13 Ga0070658_10200887 3300005327 Bacteria 1682
14 Ga0070658_10425357 3300005327 Bacteria 1142
15 Ga0070658_10465720 3300005327 Bacteria 1090
16 Ga0070658_10944139 3300005327 Bacteria 750
17 Ga0070676_10108642 3300005328 Bacteria 1724
18 Ga0070676_10403462 3300005328 Bacteria 952
19 Ga0070683_100102151 3300005329 Bacteria 2700
20 Ga0070683_100187694 3300005329 Bacteria 1962
21 Ga0070690_100177337 3300005330 Bacteria 1471
22 Ga0070690_100650546 3300005330 Bacteria 805
23 Ga0070670_100177347 3300005331 Bacteria 1849
24 Ga0070670_100363991 3300005331 Bacteria 1272
25 Ga0070670_100741760 3300005331 Bacteria 885
26 Ga0070666_10151677 3300005335 Bacteria 1617
27 Ga0070666_10203350 3300005335 Bacteria 1393
28 Ga0070680_100040917 3300005336 Bacteria 3756
29 Ga0070680_100163588 3300005336 Bacteria 1870
30 Ga0070680_100493345 3300005336 Bacteria 1047
31 Ga0070680_100844994 3300005336 Bacteria 789
32 Ga0070680_101233048 3300005336 Unclassified 647
33 Ga0070682_100225910 3300005337 Bacteria 1335
34 Ga0070660_100000683 3300005339 Bacteria 22453
35 Ga0070660_100009311 3300005339 Bacteria 6902
36 Ga0070660_100065075 3300005339 Bacteria 2837
37 Ga0070660_100069186 3300005339 Bacteria 2752
38 Ga0070660_100071050 3300005339 Bacteria 2717
39 Ga0070660_100122418 3300005339 Bacteria 2076
40 Ga0070660_100147288 3300005339 Unclassified 1892
41 Ga0070660_100152507 3300005339 Bacteria 1858
42 Ga0070660_100184812 3300005339 Bacteria 1687
43 Ga0070660_100382465 3300005339 Bacteria 1162
44 Ga0070660_100585769 3300005339 Bacteria 932
45 Ga0070660_101241060 3300005339 Unclassified 632
46 Ga0070661_100057072 3300005344 Bacteria 2861
47 Ga0070661_100080660 3300005344 Unclassified 2401
48 Ga0070661_100120958 3300005344 Bacteria 1961
49 Ga0070661_100138185 3300005344 Bacteria 1835
50 Ga0070661_100157009 3300005344 Bacteria 1722
51 Ga0070692_10029275 3300005345 Bacteria 2744
52 Ga0070692_10083523 3300005345 Unclassified 1725
53 Ga0070668_100169078 3300005347 Unclassified 1779
54 Ga0070669_100222995 3300005353 Bacteria 1491
55 Ga0070675_100031550 3300005354 Bacteria 4284
56 Ga0070671_100061600 3300005355 Bacteria 3125
57 Ga0070671_100117642 3300005355 Bacteria 2235
58 Ga0070671_100146971 3300005355 Bacteria 1990
59 Ga0070671_100585309 3300005355 Bacteria 964
60 Ga0070674_100070621 3300005356 Bacteria 2468
61 Ga0070673_100174722 3300005364 Bacteria 1835
62 Ga0070673_100254424 3300005364 Bacteria 1532
63 Ga0070673_100469181 3300005364 Bacteria 1135
64 Ga0070673_100540921 3300005364 Bacteria 1057
65 Ga0070659_100004958 3300005366 Bacteria 9525
66 Ga0070659_100033819 3300005366 Bacteria 3974
67 Ga0070659_100036388 3300005366 Bacteria 3838
68 Ga0070659_100333236 3300005366 Bacteria 1270
69 Ga0070659_100557009 3300005366 Bacteria 982
70 Ga0070659_100990059 3300005366 Bacteria 738
71 Ga0070659_101004361 3300005366 Unclassified 732
72 Ga0070667_100009965 3300005367 Bacteria 7876
73 Ga0070667_100166481 3300005367 Bacteria 1944
74 Ga0070667_100284033 3300005367 Bacteria 1487
75 Ga0070714_100032344 3300005435 Bacteria 4365
76 Ga0070714_100217194 3300005435 Bacteria 1755
77 Ga0070713_100030703 3300005436 Bacteria 4271
78 Ga0070663_100004532 3300005455 Bacteria 8185
79 Ga0070663_100069892 3300005455 Bacteria 2552
80 Ga0070663_100091893 3300005455 Bacteria 2250
81 Ga0070663_101077673 3300005455 Bacteria 702
82 Ga0070663_101118011 3300005455 Bacteria 689
83 Ga0070678_100361527 3300005456 Bacteria 1251
84 Ga0070678_100676430 3300005456 Bacteria 928
85 Ga0070662_100000146 3300005457 Bacteria 40344
86 Ga0070662_100044359 3300005457 Bacteria 3185
87 Ga0070662_100229753 3300005457 Bacteria 1484
88 Ga0070662_100247220 3300005457 Bacteria 1433
89 Ga0070662_100442657 3300005457 Bacteria 1077
90 Ga0070662_100614852 3300005457 Bacteria 915
91 Ga0070662_100873049 3300005457 Bacteria 767
92 Ga0070681_10099847 3300005458 Bacteria 2848
93 Ga0070681_10268783 3300005458 Bacteria 1617
94 Ga0070681_10314673 3300005458 Bacteria 1475
95 Ga0070681_10476036 3300005458 Bacteria 1161
96 Ga0070681_10645141 3300005458 Bacteria 974
97 Ga0068867_100114658 3300005459 Bacteria 2075
98 Ga0070679_100025098 3300005530 Bacteria 5845
99 Ga0070679_100072772 3300005530 Bacteria 3429
100 Ga0070679_100124395 3300005530 Bacteria 2562
101 Ga0070679_100267191 3300005530 Bacteria 1665
102 Ga0070679_100632002 3300005530 Bacteria 1014
103 Ga0070679_101211816 3300005530 Bacteria 700
104 Ga0070679_101298198 3300005530 Unclassified 673
105 Ga0070684_100193836 3300005535 Bacteria 1850
106 Ga0068853_100563505 3300005539 Bacteria 1080
107 Ga0068853_100812213 3300005539 Bacteria 896
108 Ga0068853_100819931 3300005539 Unclassified 891
109 Ga0068853_101093616 3300005539 Bacteria 769
110 Ga0070672_100027521 3300005543 Bacteria 4241
111 Ga0070672_100424931 3300005543 Bacteria 1142
112 Ga0070672_100582998 3300005543 Bacteria 973
113 Ga0070696_100593707 3300005546 Archaea 892
114 Ga0070693_101216643 3300005547 Archaea 579
115 Ga0070665_100098825 3300005548 Bacteria 2923
116 Ga0070665_100149655 3300005548 Bacteria 2337
117 Ga0070665_100154175 3300005548 Bacteria 2299
118 Ga0068855_100001753 3300005563 Bacteria 27078
119 Ga0068855_100078600 3300005563 Bacteria 3827
120 Ga0068855_100323153 3300005563 Unclassified 1705
121 Ga0068855_100947409 3300005563 Unclassified 907
122 Ga0068855_101309524 3300005563 Bacteria 749
123 Ga0070664_100182082 3300005564 Bacteria 1868
124 Ga0070664_100221114 3300005564 Bacteria 1694
125 Ga0070664_100319229 3300005564 Bacteria 1407
126 Ga0070664_100579991 3300005564 Bacteria 1039
127 Ga0070664_101316208 3300005564 Unclassified 682
128 Ga0068857_100393687 3300005577 Bacteria 1288
129 Ga0068854_100031877 3300005578 Bacteria 3664
130 Ga0068854_100062538 3300005578 Bacteria 2699
131 Ga0068854_101703349 3300005578 Bacteria 576
132 Ga0068856_100172464 3300005614 Bacteria 2175
133 Ga0068856_100239347 3300005614 Bacteria 1830
134 Ga0068856_100495395 3300005614 Bacteria 1243
135 Ga0068856_100706311 3300005614 Bacteria 1029
136 Ga0068852_100024272 3300005616 Bacteria 4897
137 Ga0068852_100068700 3300005616 Bacteria 3102
138 Ga0068852_100181484 3300005616 Bacteria 1979
139 Ga0068852_100522727 3300005616 Bacteria 1184
140 Ga0068852_100820827 3300005616 Bacteria 945
141 Ga0068859_100123575 3300005617 Unclassified 2656
142 Ga0068864_100668771 3300005618 Bacteria 1012
143 Ga0068851_10066112 3300005834 Bacteria 1862
144 Ga0068851_10135592 3300005834 Bacteria 1334
145 Ga0068851_10155827 3300005834 Bacteria 1252
146 Ga0068863_101080446 3300005841 Unclassified 807
147 Ga0068858_100349493 3300005842 Unclassified 1416
148 Ga0068860_100641211 3300005843 Bacteria 1070
149 Ga0068860_101078802 3300005843 Bacteria 822
150 Ga0068862_100042597 3300005844 Bacteria 3868
151 Ga0075364_10346344 3300006051 Bacteria 1013
152 Ga0068865_100112575 3300006881 Bacteria 2010
153 Ga0097620_100123576 3300006931 Unclassified 2656
154 Ga0105241_10344361 3300009174 Bacteria 1292
155 Ga0105248_10045035 3300009177 Bacteria 4947
156 Ga0105248_10227522 3300009177 Bacteria 2099
157 Ga0105248_10699937 3300009177 Bacteria 1143
158 Ga0105238_10128535 3300009551 Bacteria 2512
159 Ga0105238_10161338 3300009551 Bacteria 2217
160 Ga0105239_11670854 3300010375 Unclassified 737
161 Ga0157373_10021821 3300013100 Bacteria 4646
162 Ga0157373_10220476 3300013100 Bacteria 1338
163 Ga0157373_10261478 3300013100 Bacteria 1225
164 Ga0157373_10294678 3300013100 Bacteria 1151
165 Ga0157373_10709705 3300013100 Bacteria 737
166 Ga0157371_10012165 3300013102 Bacteria 6592
167 Ga0157371_10105082 3300013102 Bacteria 2004
168 Ga0157371_10212610 3300013102 Bacteria 1388
169 Ga0157371_10274827 3300013102 Bacteria 1216
170 Ga0157371_10300836 3300013102 Bacteria 1161
171 Ga0157371_10336019 3300013102 Bacteria 1098
172 Ga0157370_10037730 3300013104 Bacteria 4680
173 Ga0157370_10147775 3300013104 Bacteria 2188
174 Ga0157370_10175658 3300013104 Unclassified 1991
175 Ga0157370_10176991 3300013104 Bacteria 1983
176 Ga0157369_10227690 3300013105 Bacteria 1950
177 Ga0157369_10366686 3300013105 Bacteria 1495
178 Ga0157369_10415714 3300013105 Bacteria 1394
179 Ga0157378_12797591 3300013297 Bacteria 540
180 Ga0163162_10950362 3300013306 Bacteria 971
181 Ga0157372_10158630 3300013307 Bacteria 2614
182 Ga0157372_10224992 3300013307 Bacteria 2175
183 Ga0157372_10276544 3300013307 Bacteria 1952
184 Ga0157372_10767646 3300013307 Unclassified 1121
185 Ga0157372_12797179 3300013307 Bacteria 559
186 Ga0157375_10099347 3300013308 Bacteria 2989
187 Ga0163161_10076950 3300017792 Bacteria 2450
188 Ga0206353_11051149 3300020082 Bacteria 843
189 Ga0207666_1041037 3300025271 Bacteria 724
190 Ga0207697_10045279 3300025315 Bacteria 1811
191 Ga0207656_10079492 3300025321 Bacteria 1471
192 Ga0207656_10246288 3300025321 Bacteria 875
193 Ga0207647_10133046 3300025904 Bacteria 1461
194 Ga0207647_10145496 3300025904 Bacteria 1387
195 Ga0207645_10376720 3300025907 Bacteria 952
196 Ga0207705_10000135 3300025909 Bacteria 79350
197 Ga0207705_10000469 3300025909 Bacteria 34559
198 Ga0207705_10016375 3300025909 Bacteria 5316
199 Ga0207705_10039870 3300025909 Bacteria 3366
200 Ga0207705_10302677 3300025909 Bacteria 1226
201 Ga0207705_10349265 3300025909 Unclassified 1139
202 Ga0207705_10639711 3300025909 Unclassified 827
203 Ga0207707_10074109 3300025912 Bacteria 2969
204 Ga0207707_10100431 3300025912 Bacteria 2529
205 Ga0207707_10299617 3300025912 Bacteria 1390
206 Ga0207707_10358057 3300025912 Bacteria 1257
207 Ga0207707_10396843 3300025912 Bacteria 1185
208 Ga0207707_10554542 3300025912 Unclassified 976
209 Ga0207660_10113776 3300025917 Bacteria 2040
210 Ga0207660_10357318 3300025917 Unclassified 1171
211 Ga0207660_10468734 3300025917 Bacteria 1020
212 Ga0207657_10000542 3300025919 Bacteria 40318
213 Ga0207657_10002150 3300025919 Bacteria 21362
214 Ga0207657_10005987 3300025919 Bacteria 12657
215 Ga0207657_10006401 3300025919 Bacteria 12221
216 Ga0207657_10043027 3300025919 Bacteria 3981
217 Ga0207657_10071461 3300025919 Bacteria 2938
218 Ga0207657_10083328 3300025919 Bacteria 2683
219 Ga0207649_10169078 3300025920 Bacteria 1521
220 Ga0207649_10457953 3300025920 Bacteria 964
221 Ga0207649_10805300 3300025920 Bacteria 733
222 Ga0207649_11146026 3300025920 Bacteria 614
223 Ga0207652_10046134 3300025921 Bacteria 3717
224 Ga0207652_10240719 3300025921 Bacteria 1631
225 Ga0207652_10259583 3300025921 Bacteria 1567
226 Ga0207652_10339371 3300025921 Bacteria 1356
227 Ga0207652_10444917 3300025921 Bacteria 1168
228 Ga0207652_11032636 3300025921 Unclassified 721
229 Ga0207681_10090179 3300025923 Bacteria 2188
230 Ga0207694_10224297 3300025924 Bacteria 1534
231 Ga0207694_10239728 3300025924 Bacteria 1482
232 Ga0207650_10245890 3300025925 Bacteria 1447
233 Ga0207659_10026502 3300025926 Bacteria 3912
234 Ga0207700_10015704 3300025928 Bacteria 5006
235 Ga0207664_10025893 3300025929 Bacteria 4426
236 Ga0207664_10324151 3300025929 Bacteria 1359
237 Ga0207664_10543137 3300025929 Bacteria 1042
238 Ga0207644_10032432 3300025931 Bacteria 3645
239 Ga0207644_10169161 3300025931 Unclassified 1705
240 Ga0207644_10362932 3300025931 Bacteria 1178
241 Ga0207690_10023631 3300025932 Bacteria 3838
242 Ga0207690_10052918 3300025932 Bacteria 2721
243 Ga0207690_10092947 3300025932 Unclassified 2136
244 Ga0207690_10162616 3300025932 Bacteria 1665
245 Ga0207690_10302849 3300025932 Bacteria 1251
246 Ga0207690_10348916 3300025932 Bacteria 1170
247 Ga0207690_10742852 3300025932 Bacteria 808
248 Ga0207690_10997671 3300025932 Bacteria 696
249 Ga0207706_10000461 3300025933 Bacteria 43387
250 Ga0207706_10065992 3300025933 Bacteria 3186
251 Ga0207706_10277373 3300025933 Bacteria 1462
252 Ga0207706_10325633 3300025933 Bacteria 1337
253 Ga0207706_10363116 3300025933 Bacteria 1258
254 Ga0207706_10903909 3300025933 Bacteria 746
255 Ga0207669_10181667 3300025937 Bacteria 1509
256 Ga0207704_10041015 3300025938 Bacteria 2711
257 Ga0207711_10000543 3300025941 Bacteria 38517
258 Ga0207711_10455180 3300025941 Bacteria 1191
259 Ga0207661_10006409 3300025944 Bacteria 8325
260 Ga0207661_10018564 3300025944 Bacteria 5169
261 Ga0207679_10058442 3300025945 Bacteria 2858
262 Ga0207679_10189271 3300025945 Bacteria 1709
263 Ga0207679_10263666 3300025945 Bacteria 1471
264 Ga0207679_10592879 3300025945 Bacteria 998
265 Ga0207679_10839095 3300025945 Bacteria 839
266 Ga0207667_10000122 3300025949 Bacteria 121588
267 Ga0207667_10764254 3300025949 Bacteria 965
268 Ga0207651_10178585 3300025960 Bacteria 1682
269 Ga0207651_10182725 3300025960 Bacteria 1665
270 Ga0207651_10477580 3300025960 Bacteria 1074
271 Ga0207668_10107116 3300025972 Bacteria 2090
272 Ga0207640_10075366 3300025981 Bacteria 2286
273 Ga0207640_11109378 3300025981 Unclassified 700
274 Ga0207658_10025405 3300025986 Bacteria 4148
275 Ga0207658_10202311 3300025986 Bacteria 1659
276 Ga0207703_11367690 3300026035 Unclassified 681
277 Ga0207639_10121054 3300026041 Bacteria 2150
278 Ga0207639_10138851 3300026041 Bacteria 2022
279 Ga0207639_11360475 3300026041 Unclassified 666
280 Ga0207678_10042051 3300026067 Bacteria 3961
281 Ga0207678_10057295 3300026067 Bacteria 3353
282 Ga0207678_10061797 3300026067 Bacteria 3222
283 Ga0207678_10092444 3300026067 Bacteria 2586
284 Ga0207678_10222165 3300026067 Bacteria 1617
285 Ga0207678_10803198 3300026067 Unclassified 831
286 Ga0207702_10292593 3300026078 Bacteria 1543
287 Ga0207702_10472335 3300026078 Bacteria 1219
288 Ga0207641_11652382 3300026088 Bacteria 642
289 Ga0207648_10093895 3300026089 Bacteria 2623
290 Ga0207674_10124322 3300026116 Bacteria 2546
291 Ga0207674_10578721 3300026116 Unclassified 1085
292 Ga0207674_10848582 3300026116 Bacteria 881
293 Ga0207683_10065360 3300026121 Bacteria 3207
294 Ga0207698_10148434 3300026142 Bacteria 2031
295 Ga0207698_10435224 3300026142 Bacteria 1262
296 Ga0207698_10615151 3300026142 Bacteria 1072
297 Ga0207698_10930346 3300026142 Bacteria 878
298 Ga0268266_10000998 3300028379 Bacteria 35702
299 Ga0268266_10047205 3300028379 Bacteria 3688
300 Ga0268265_10020943 3300028380 Bacteria 4571
301 Ga0268264_11371178 3300028381 Bacteria 717
302 Ga0307409_100372390 3300031995 Unclassified 1355
303 Ga0307414_10069040 3300032004 Bacteria 2539
304 Ga0373946_0146383 3300035171 Bacteria 1099
305 Ga0373925_0685360 3300037068 Bacteria 845
306 Ga0395899_0000352 3300037312 Bacteria 56166
307 Ga0395899_0138296 3300037312 Bacteria 1735
308 Ga0395899_0298329 3300037312 Bacteria 1091
309 Ga0395899_0883951 3300037312 Bacteria 546
310 Ga0395900_0001013 3300037418 Bacteria 36249
311 Ga0395900_0038683 3300037418 Bacteria 4917
312 Ga0395900_0050664 3300037418 Bacteria 4276
313 Ga0395900_0058664 3300037418 Bacteria 3962
314 Ga0395900_0117875 3300037418 Bacteria 2724
315 Ga0395900_0296332 3300037418 Unclassified 1605
316 Ga0395900_0407848 3300037418 Bacteria 1322
317 Ga0395900_0533219 3300037418 Bacteria 1120
318 Ga0395900_0602645 3300037418 Bacteria 1039
319 Ga0395900_0873025 3300037418 Unclassified 824
320 Ga0395898_0012355 3300037466 Bacteria 8833
321 Ga0395898_0074420 3300037466 Bacteria 3280
322 Ga0395898_0082980 3300037466 Bacteria 3089
323 Ga0395898_0132744 3300037466 Bacteria 2384
324 Ga0395898_0245103 3300037466 Bacteria 1709
325 Ga0395898_0393730 3300037466 Bacteria 1321
326 Ga0395905_0026518 3300037471 Bacteria 5463
327 Ga0395905_0032782 3300037471 Bacteria 4884
328 Ga0395905_0042401 3300037471 Bacteria 4271
329 Ga0395905_0042598 3300037471 Bacteria 4260
330 Ga0395905_0081372 3300037471 Bacteria 3035
331 Ga0395905_0147816 3300037471 Bacteria 2211
332 Ga0395905_0196112 3300037471 Bacteria 1893
333 Ga0395905_0199221 3300037471 Bacteria 1877
334 Ga0395905_0228872 3300037471 Bacteria 1739
335 Ga0395905_0299126 3300037471 Bacteria 1496
336 Ga0395905_0472043 3300037471 Bacteria 1153
337 Ga0395905_0485923 3300037471 Bacteria 1134
338 Ga0395901_0000047 3300038443 Bacteria 175221
339 Ga0395901_0080276 3300038443 Bacteria 3406
340 Ga0395901_0125103 3300038443 Bacteria 2701
341 Ga0395901_0164967 3300038443 Unclassified 2326
342 Ga0395901_0856048 3300038443 Bacteria 894
343 Ga0395901_0894165 3300038443 Bacteria 870
344 Ga0395901_1246513 3300038443 Bacteria 707
345 Ga0439458_0028109 3300042157 Bacteria 1330
346 Ga0439434_0074482 3300042435 Bacteria 1072
347 Ga0466969_0105417 3300044656 Bacteria 1324
348 Ga0466965_0330974 3300044683 Bacteria 831
349 Ga0466966_0794016 3300044684 Bacteria 571
350 Ga0466961_0973095 3300044693 Bacteria 504
351 Ga0466963_0260911 3300044694 Unclassified 1216
352 Ga0466957_0084317 3300044842 Bacteria 1983
353 Ga0466957_0106278 3300044842 Unclassified 1775
354 Ga0466957_0373193 3300044842 Unclassified 971
355 Ga0466957_1249292 3300044842 Bacteria 538
356 Ga0466959_0210185 3300045049 Bacteria 1352
357 Ga0466967_0446523 3300045976 Unclassified 1263
358 Ga0466967_1155249 3300045976 Bacteria 771
359 Ga0495621_0004645 3300046539 Bacteria 3882
360 Ga0495633_0169254 3300046558 Bacteria 1007
361 Ga0496107_0704511 3300048910 Bacteria 742
362 Ga0501209_175384 3300049656 Bacteria 653
363 nmdc:mga00v17_326267_c1 3300050491 Bacteria 997
364 Ga0466962_0006061 3300061719 Bacteria 5814
365 Ga0466962_0055712 3300061719 Bacteria 1889
366 2896431219 2896429255 Bacteria 2557483
367 JGI24741J21665_1015836
368 JGI24741J21665_1018630
369 JGI24740J21852_10013579
370 JGI24739J22299_10017777
371 JGI24743J22301_10032585
372 JGI24735J21928_10001944
373 JGI24738J21930_10003121
374 Ga0065715_10233434
375 Ga0070658_10001346
376 Ga0070658_10029489
377 Ga0070658_10078356
378 Ga0070658_10116261
379 Ga0070658_10200887
380 Ga0070658_10425357
381 Ga0070658_10465720
382 Ga0070658_10944139
383 Ga0070676_10108642
384 Ga0070676_10403462
385 Ga0070683_100102151
386 Ga0070683_100187694
387 Ga0070690_100177337
388 Ga0070690_100650546
389 Ga0070670_100177347
390 Ga0070670_100363991
391 Ga0070670_100741760
392 Ga0070666_10151677
393 Ga0070666_10203350
394 Ga0070680_100040917
395 Ga0070680_100163588
396 Ga0070680_100493345
397 Ga0070680_100844994
398 Ga0070680_101233048
399 Ga0070682_100225910
400 Ga0070660_100000683
401 Ga0070660_100009311
402 Ga0070660_100065075
403 Ga0070660_100069186
404 Ga0070660_100071050
405 Ga0070660_100122418
406 Ga0070660_100147288
407 Ga0070660_100152507
408 Ga0070660_100184812
409 Ga0070660_100382465
410 Ga0070660_100585769
411 Ga0070660_101241060
412 Ga0070661_100057072
413 Ga0070661_100080660
414 Ga0070661_100120958
415 Ga0070661_100138185
416 Ga0070661_100157009
417 Ga0070692_10029275
418 Ga0070692_10083523
419 Ga0070668_100169078
420 Ga0070669_100222995
421 Ga0070675_100031550
422 Ga0070671_100061600
423 Ga0070671_100117642
424 Ga0070671_100146971
425 Ga0070671_100585309
426 Ga0070674_100070621
427 Ga0070673_100174722
428 Ga0070673_100254424
429 Ga0070673_100469181
430 Ga0070673_100540921
431 Ga0070659_100004958
432 Ga0070659_100033819
433 Ga0070659_100036388
434 Ga0070659_100333236
435 Ga0070659_100557009
436 Ga0070659_100990059
437 Ga0070659_101004361
438 Ga0070667_100009965
439 Ga0070667_100166481
440 Ga0070667_100284033
441 Ga0070714_100032344
442 Ga0070714_100217194
443 Ga0070713_100030703
444 Ga0070663_100004532
445 Ga0070663_100069892
446 Ga0070663_100091893
447 Ga0070663_101077673
448 Ga0070663_101118011
449 Ga0070678_100361527
450 Ga0070678_100676430
451 Ga0070662_100000146
452 Ga0070662_100044359
453 Ga0070662_100229753
454 Ga0070662_100247220
455 Ga0070662_100442657
456 Ga0070662_100614852
457 Ga0070662_100873049
458 Ga0070681_10099847
459 Ga0070681_10268783
460 Ga0070681_10314673
461 Ga0070681_10476036
462 Ga0070681_10645141
463 Ga0068867_100114658
464 Ga0070679_100025098
465 Ga0070679_100072772
466 Ga0070679_100124395
467 Ga0070679_100267191
468 Ga0070679_100632002
469 Ga0070679_101211816
470 Ga0070679_101298198
471 Ga0070684_100193836
472 Ga0068853_100563505
473 Ga0068853_100812213
474 Ga0068853_100819931
475 Ga0068853_101093616
476 Ga0070672_100027521
477 Ga0070672_100424931
478 Ga0070672_100582998
479 Ga0070696_100593707
480 Ga0070693_101216643
481 Ga0070665_100098825
482 Ga0070665_100149655
483 Ga0070665_100154175
484 Ga0068855_100001753
485 Ga0068855_100078600
486 Ga0068855_100323153
487 Ga0068855_100947409
488 Ga0068855_101309524
489 Ga0070664_100182082
490 Ga0070664_100221114
491 Ga0070664_100319229
492 Ga0070664_100579991
493 Ga0070664_101316208
494 Ga0068857_100393687
495 Ga0068854_100031877
496 Ga0068854_100062538
497 Ga0068854_101703349
498 Ga0068856_100172464
499 Ga0068856_100239347
500 Ga0068856_100495395
501 Ga0068856_100706311
502 Ga0068852_100024272
503 Ga0068852_100068700
504 Ga0068852_100181484
505 Ga0068852_100522727
506 Ga0068852_100820827
507 Ga0068859_100123575
508 Ga0068864_100668771
509 Ga0068851_10066112
510 Ga0068851_10135592
511 Ga0068851_10155827
512 Ga0068863_101080446
513 Ga0068858_100349493
514 Ga0068860_100641211
515 Ga0068860_101078802
516 Ga0068862_100042597
517 Ga0075364_10346344
518 Ga0068865_100112575
519 Ga0097620_100123576
520 Ga0105241_10344361
521 Ga0105248_10045035
522 Ga0105248_10227522
523 Ga0105248_10699937
524 Ga0105238_10128535
525 Ga0105238_10161338
526 Ga0105239_11670854
527 Ga0157373_10021821
528 Ga0157373_10220476
529 Ga0157373_10261478
530 Ga0157373_10294678
531 Ga0157373_10709705
532 Ga0157371_10012165
533 Ga0157371_10105082
534 Ga0157371_10212610
535 Ga0157371_10274827
536 Ga0157371_10300836
537 Ga0157371_10336019
538 Ga0157370_10037730
539 Ga0157370_10147775
540 Ga0157370_10175658
541 Ga0157370_10176991
542 Ga0157369_10227690
543 Ga0157369_10366686
544 Ga0157369_10415714
545 Ga0157378_12797591
546 Ga0163162_10950362
547 Ga0157372_10158630
548 Ga0157372_10224992
549 Ga0157372_10276544
550 Ga0157372_10767646
551 Ga0157372_12797179
552 Ga0157375_10099347
553 Ga0163161_10076950
554 Ga0206353_11051149
555 Ga0207666_1041037
556 Ga0207697_10045279
557 Ga0207656_10079492
558 Ga0207656_10246288
559 Ga0207647_10133046
560 Ga0207647_10145496
561 Ga0207645_10376720
562 Ga0207705_10000135
563 Ga0207705_10000469
564 Ga0207705_10016375
565 Ga0207705_10039870
566 Ga0207705_10302677
567 Ga0207705_10349265
568 Ga0207705_10639711
569 Ga0207707_10074109
570 Ga0207707_10100431
571 Ga0207707_10299617
572 Ga0207707_10358057
573 Ga0207707_10396843
574 Ga0207707_10554542
575 Ga0207660_10113776
576 Ga0207660_10357318
577 Ga0207660_10468734
578 Ga0207657_10000542
579 Ga0207657_10002150
580 Ga0207657_10005987
581 Ga0207657_10006401
582 Ga0207657_10043027
583 Ga0207657_10071461
584 Ga0207657_10083328
585 Ga0207649_10169078
586 Ga0207649_10457953
587 Ga0207649_10805300
588 Ga0207649_11146026
589 Ga0207652_10046134
590 Ga0207652_10240719
591 Ga0207652_10259583
592 Ga0207652_10339371
593 Ga0207652_10444917
594 Ga0207652_11032636
595 Ga0207681_10090179
596 Ga0207694_10224297
597 Ga0207694_10239728
598 Ga0207650_10245890
599 Ga0207659_10026502
600 Ga0207700_10015704
601 Ga0207664_10025893
602 Ga0207664_10324151
603 Ga0207664_10543137
604 Ga0207644_10032432
605 Ga0207644_10169161
606 Ga0207644_10362932
607 Ga0207690_10023631
608 Ga0207690_10052918
609 Ga0207690_10092947
610 Ga0207690_10162616
611 Ga0207690_10302849
612 Ga0207690_10348916
613 Ga0207690_10742852
614 Ga0207690_10997671
615 Ga0207706_10000461
616 Ga0207706_10065992
617 Ga0207706_10277373
618 Ga0207706_10325633
619 Ga0207706_10363116
620 Ga0207706_10903909
621 Ga0207669_10181667
622 Ga0207704_10041015
623 Ga0207711_10000543
624 Ga0207711_10455180
625 Ga0207661_10006409
626 Ga0207661_10018564
627 Ga0207679_10058442
628 Ga0207679_10189271
629 Ga0207679_10263666
630 Ga0207679_10592879
631 Ga0207679_10839095
632 Ga0207667_10000122
633 Ga0207667_10764254
634 Ga0207651_10178585
635 Ga0207651_10182725
636 Ga0207651_10477580
637 Ga0207668_10107116
638 Ga0207640_10075366
639 Ga0207640_11109378
640 Ga0207658_10025405
641 Ga0207658_10202311
642 Ga0207703_11367690
643 Ga0207639_10121054
644 Ga0207639_10138851
645 Ga0207639_11360475
646 Ga0207678_10042051
647 Ga0207678_10057295
648 Ga0207678_10061797
649 Ga0207678_10092444
650 Ga0207678_10222165
651 Ga0207678_10803198
652 Ga0207702_10292593
653 Ga0207702_10472335
654 Ga0207641_11652382
655 Ga0207648_10093895
656 Ga0207674_10124322
657 Ga0207674_10578721
658 Ga0207674_10848582
659 Ga0207683_10065360
660 Ga0207698_10148434
661 Ga0207698_10435224
662 Ga0207698_10615151
663 Ga0207698_10930346
664 Ga0268266_10000998
665 Ga0268266_10047205
666 Ga0268265_10020943
667 Ga0268264_11371178
668 Ga0307409_100372390
669 Ga0307414_10069040
670 Ga0373946_0146383
671 Ga0373925_0685360
672 Ga0395899_0000352
673 Ga0395899_0138296
674 Ga0395899_0298329
675 Ga0395899_0883951
676 Ga0395900_0001013
677 Ga0395900_0038683
678 Ga0395900_0050664
679 Ga0395900_0058664
680 Ga0395900_0117875
681 Ga0395900_0296332
682 Ga0395900_0407848
683 Ga0395900_0533219
684 Ga0395900_0602645
685 Ga0395900_0873025
686 Ga0395898_0012355
687 Ga0395898_0074420
688 Ga0395898_0082980
689 Ga0395898_0132744
690 Ga0395898_0245103
691 Ga0395898_0393730
692 Ga0395905_0026518
693 Ga0395905_0032782
694 Ga0395905_0042401
695 Ga0395905_0042598
696 Ga0395905_0081372
697 Ga0395905_0147816
698 Ga0395905_0196112
699 Ga0395905_0199221
700 Ga0395905_0228872
701 Ga0395905_0299126
702 Ga0395905_0472043
703 Ga0395905_0485923
704 Ga0395901_0000047
705 Ga0395901_0080276
706 Ga0395901_0125103
707 Ga0395901_0164967
708 Ga0395901_0856048
709 Ga0395901_0894165
710 Ga0395901_1246513
711 Ga0439458_0028109
712 Ga0439434_0074482
713 Ga0466969_0105417
714 Ga0466965_0330974
715 Ga0466966_0794016
716 Ga0466961_0973095
717 Ga0466963_0260911
718 Ga0466957_0084317
719 Ga0466957_0106278
720 Ga0466957_0373193
721 Ga0466957_1249292
722 Ga0466959_0210185
723 Ga0466967_0446523
724 Ga0466967_1155249
725 Ga0495621_0004645
726 Ga0495633_0169254
727 Ga0496107_0704511
728 Ga0501209_175384
729 nmdc:mga00v17_326267_c1
730 Ga0466962_0006061
731 Ga0466962_0055712
732 2896431219

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gc4-assembly2.cif.gz_E structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 a resolution. 0.6551 73 114
1dvm-assembly3.cif.gz_C active form of human pai-1 0.6201 71 104
4g8o-assembly1.cif.gz_A crystal structure of a novel small molecule inactivator bound to plasminogen activator inhibitor-1 0.5758 70 108
3rra-assembly1.cif.gz_B crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j with magnesium bound 0.5728 70 105
3rr1-assembly1.cif.gz_B crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j 0.5682 70 105
ID Description Score Start End Superfamily
5oc1A01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8241 96 114 3.50.50.60
af_A1ZAB5_318_396_3.30.2280.10 Alpha Beta;2-Layer Sandwich;copper amine oxidase-like fold;Hypothetical protein (hspc210) 0.7053 73 107 3.30.2280.10
af_Q9W029_54_387_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.6964 67 112 2.120.10.30
af_Q9W028_40_372_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.6711 67 110 2.120.10.30
af_A0A1D6HIK9_1_295_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6613 71 109 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A258H3A5-F1-model_v4 C-type lysozyme inhibitor domain-containing protein 0.8883 59 151
AF-A0A258H3A5-F1-model_v4 C-type lysozyme inhibitor domain-containing protein 0.8458 59 151
AF-W1RPZ1-F1-model_v4 C-type lysozyme inhibitor domain-containing protein 0.8361 70 150
AF-A0A084EF57-F1-model_v4 C-type lysozyme inhibitor domain-containing protein 0.8262 70 150
AF-A0A2L0GGT8-F1-model_v4 C-type lysozyme inhibitor domain-containing protein 0.8261 76 150

Map