F423772

General Info

Members Datasets Scaffolds Average Seq Length
365 148 362 260

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0036304|Ga0466972_0036304_814_1602
Length 262
Sequence MRTTKELFDLTGRTALVTGGSRGLGLQIAEAIGELGGKVVLSSRKQEDLDEAVAHLKTRGIEASAIAADLSKETSINPLVDETLKRLGRIDILVNNAGASWGAPAEDYPLEAWDKVMNLNVRSIFLLSQAVGKRSMIPREYGKIINVASIAGLFGNMPDSAMQTVAYNTSKAAVINFTRTLAGEWGKYGITVNAIAPGFFPSKMTKGLMQQVGAENIAKHAPLLRIGDDEDLKGITALFASDASKHITGQVMAVDGGVSAVH

Samples

Sample ID Description Type Environment
1 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
2 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
3 2643221638 Duganella sp. Root336D2 Isolate Unclassified
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
22 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
23 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
24 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
25 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
26 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
27 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
28 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
29 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
30 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
31 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
33 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
35 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
38 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
43 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
44 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
45 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
46 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
47 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
48 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
49 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
50 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
51 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
52 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
53 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
54 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
55 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
56 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
57 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
58 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
59 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
60 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
61 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
62 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
63 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
64 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
65 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
66 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
67 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
68 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
69 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
70 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
71 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
72 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
73 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
74 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
75 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
76 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
77 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
78 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
79 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
80 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
81 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
82 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
83 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
84 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
85 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
86 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
87 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
88 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
89 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
90 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
91 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
92 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
95 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
96 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
97 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
98 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
99 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
100 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
101 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
102 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
103 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
104 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
105 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
106 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
107 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
108 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
109 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
110 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
111 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
112 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
113 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
114 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
115 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
116 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
119 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
120 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
121 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
122 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
123 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
124 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
125 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
126 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
127 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
128 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
129 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
140 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
141 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
144 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
145 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
146 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
147 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.63
Metatranscriptomes 0.55
Isolates 0.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.53
Nodule 0
Rhizoplane 3.56
Rhizosphere 76.99
Stem 0
Stem Tuber 0
Unclassified 1.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1000549 3300002774 Bacteria 15158
2 JGI25159J45721_1002170 3300002987 Bacteria 7645
3 JGI25159J45721_1025164 3300002987 Bacteria 1048
4 JGI25151J46595_10017026 3300003187 Bacteria 3165
5 JGI25153J46596_10011033 3300003215 Bacteria 4028
6 JGI25160J50197_1022264 3300003354 Bacteria 1861
7 JGI25161J50226_1000266 3300003374 Bacteria 30738
8 JGI25161J50226_1002117 3300003374 Bacteria 5343
9 Ga0055526_1013126 3300003771 Bacteria 3535
10 Ga0055537_1000044 3300003773 Bacteria 90696
11 Ga0055537_1009476 3300003773 Bacteria 2144
12 Ga0055524_1002445 3300003775 Bacteria 9574
13 Ga0055524_1003807 3300003775 Bacteria 7164
14 Ga0055524_1013832 3300003775 Bacteria 3019
15 Ga0055534_1001834 3300003784 Bacteria 7934
16 Ga0055534_1002186 3300003784 Bacteria 6981
17 Ga0055534_1013716 3300003784 Bacteria 1546
18 Ga0055528_1000011 3300003790 Bacteria 218512
19 Ga0055528_1028437 3300003790 Bacteria 1541
20 Ga0055530_10000499 3300003791 Bacteria 34011
21 Ga0055530_10007207 3300003791 Bacteria 4745
22 Ga0055531_10004666 3300003794 Bacteria 8214
23 Ga0055543_1000339 3300004625 Bacteria 31976
24 Ga0055543_1025923 3300004625 Bacteria 1045
25 Ga0065165_1000007 3300005262 Bacteria 337871
26 Ga0065165_1001110 3300005262 Bacteria 31976
27 Ga0070682_100013207 3300005337 Bacteria 4747
28 Ga0070712_100311005 3300006175 Bacteria 1278
29 Ga0105241_10572770 3300009174 Bacteria 1017
30 Ga0157371_10000149 3300013102 Bacteria 101593
31 Ga0182008_10070153 3300014497 Bacteria 1724
32 Ga0182006_1063494 3300015261 Bacteria 1387
33 Ga0209436_100554 3300025208 Bacteria 16204
34 Ga0209436_100859 3300025208 Bacteria 12186
35 Ga0207425_1000001 3300025245 Bacteria 2525432
36 Ga0207425_1000067 3300025245 Bacteria 124459
37 Ga0209129_1000003 3300025258 Bacteria 903689
38 Ga0209129_1001364 3300025258 Bacteria 13741
39 Ga0209565_1000003 3300025263 Bacteria 1099648
40 Ga0209565_1001086 3300025263 Bacteria 13571
41 Ga0209565_1001429 3300025263 Bacteria 10553
42 Ga0209565_1007596 3300025263 Bacteria 2910
43 Ga0209565_1009905 3300025263 Bacteria 2388
44 Ga0209673_1000003 3300025273 Bacteria 980859
45 Ga0209673_1011123 3300025273 Bacteria 3734
46 Ga0209130_1000047 3300025284 Bacteria 234691
47 Ga0209130_1000059 3300025284 Bacteria 204772
48 Ga0209130_1001599 3300025284 Bacteria 14146
49 Ga0209675_1000003 3300025291 Bacteria 1003982
50 Ga0209675_1005797 3300025291 Bacteria 5086
51 Ga0209675_1013798 3300025291 Bacteria 2500
52 Ga0209025_1000718 3300025294 Bacteria 56292
53 Ga0209564_1000012 3300025295 Bacteria 792078
54 Ga0209564_1000142 3300025295 Bacteria 178742
55 Ga0209564_1003831 3300025295 Bacteria 9730
56 Ga0209564_1034530 3300025295 Bacteria 1481
57 Ga0209758_1000098 3300025297 Bacteria 230499
58 Ga0209050_1000058 3300025298 Bacteria 325558
59 Ga0209050_1000654 3300025298 Bacteria 53586
60 Ga0209050_1001112 3300025298 Bacteria 32536
61 Ga0209050_1001305 3300025298 Bacteria 28023
62 Ga0209256_1000029 3300025299 Bacteria 415922
63 Ga0209256_1000186 3300025299 Bacteria 119070
64 Ga0209256_1000875 3300025299 Bacteria 37255
65 Ga0207426_1001774 3300025302 Bacteria 16264
66 Ga0209051_1020891 3300025303 Bacteria 2804
67 Ga0209257_1000003 3300025304 Bacteria 1702593
68 Ga0209257_1002931 3300025304 Bacteria 15718
69 Ga0209257_1003953 3300025304 Bacteria 12031
70 Ga0207693_10303808 3300025915 Bacteria 1250
71 Ga0207698_10022051 3300026142 Bacteria 4418
72 Ga0316182_1246430 3300030745 Bacteria 2023
73 Ga0307509_10400766 3300031507 Bacteria 1079
74 Ga0307408_100000082 3300031548 Bacteria 106847
75 Ga0307408_100058824 3300031548 Bacteria 2795
76 Ga0395899_0001402 3300037312 Bacteria 20666
77 Ga0395899_0004872 3300037312 Bacteria 10454
78 Ga0395899_0007376 3300037312 Bacteria 8500
79 Ga0395899_0197536 3300037312 Bacteria 1404
80 Ga0395899_0249575 3300037312 Bacteria 1218
81 Ga0395900_0018511 3300037418 Bacteria 7103
82 Ga0395900_0217093 3300037418 Bacteria 1929
83 Ga0395898_0229288 3300037466 Bacteria 1771
84 Ga0395898_0336473 3300037466 Bacteria 1439
85 Ga0395905_0003674 3300037471 Bacteria 16267
86 Ga0395905_0022941 3300037471 Bacteria 5898
87 Ga0395905_0114606 3300037471 Bacteria 2532
88 Ga0395905_0696180 3300037471 Bacteria 918
89 Ga0395901_0026078 3300038443 Bacteria 6001
90 Ga0395901_0053884 3300038443 Bacteria 4180
91 Ga0395901_0248548 3300038443 Bacteria 1853
92 Ga0436361_0167113 3300039447 Bacteria 5758
93 Ga0436361_0582900 3300039447 Bacteria 8543
94 Ga0436361_0742159 3300039447 Bacteria 3785
95 Ga0450904_001169 3300042139 Bacteria 3985
96 Ga0450893_0004911 3300042532 Bacteria 2135
97 Ga0466972_0005099 3300044658 Bacteria 6581
98 Ga0466972_0036304 3300044658 Bacteria 2412
99 Ga0466965_0007849 3300044683 Bacteria 4921
100 Ga0466965_0038367 3300044683 Bacteria 2353
101 Ga0466971_0124024 3300044719 Bacteria 1197
102 Ga0466968_0015750 3300044735 Bacteria 3002
103 Ga0451576_0090282 3300045051 Bacteria 3187
104 Ga0466958_0249339 3300045836 Bacteria 1135
105 Ga0466967_0151479 3300045976 Bacteria 2168
106 Ga0495627_003603 3300046453 Bacteria 6752
107 Ga0495603_0089280 3300046455 Bacteria 1803
108 Ga0495590_0009070 3300046457 Bacteria 3778
109 Ga0495590_0038588 3300046457 Bacteria 1666
110 Ga0495638_0022329 3300046460 Bacteria 4155
111 Ga0495638_0101332 3300046460 Bacteria 1722
112 Ga0495653_0013488 3300046463 Bacteria 6659
113 Ga0495650_0000001 3300046471 Bacteria 1085492
114 Ga0495580_0004208 3300046472 Bacteria 12101
115 Ga0495582_0017054 3300046473 Bacteria 3976
116 Ga0495605_0014258 3300046474 Bacteria 4357
117 Ga0495605_0111565 3300046474 Bacteria 1247
118 Ga0495584_0000002 3300046491 Bacteria 512179
119 Ga0495584_0000028 3300046491 Bacteria 111816
120 Ga0495584_0002511 3300046491 Bacteria 10397
121 Ga0495584_0039440 3300046491 Bacteria 2385
122 Ga0495584_0045374 3300046491 Bacteria 2217
123 Ga0495584_0057700 3300046491 Bacteria 1953
124 Ga0495584_0122619 3300046491 Bacteria 1316
125 Ga0495584_0164537 3300046491 Bacteria 1127
126 Ga0495585_0000038 3300046492 Bacteria 131919
127 Ga0495585_0000187 3300046492 Bacteria 66273
128 Ga0495585_0000188 3300046492 Bacteria 66122
129 Ga0495585_0000325 3300046492 Bacteria 46819
130 Ga0495585_0001769 3300046492 Bacteria 16401
131 Ga0495585_0005991 3300046492 Bacteria 7606
132 Ga0495585_0012043 3300046492 Bacteria 5104
133 Ga0495585_0024942 3300046492 Bacteria 3427
134 Ga0495585_0041051 3300046492 Bacteria 2595
135 Ga0495585_0045950 3300046492 Bacteria 2436
136 Ga0495585_0135666 3300046492 Bacteria 1292
137 Ga0495585_0154138 3300046492 Bacteria 1196
138 Ga0495594_0000521 3300046499 Bacteria 19714
139 Ga0495594_0036177 3300046499 Bacteria 2691
140 Ga0495594_0077677 3300046499 Bacteria 1852
141 Ga0495594_0119925 3300046499 Bacteria 1486
142 Ga0495596_0000017 3300046500 Bacteria 114761
143 Ga0495596_0000116 3300046500 Bacteria 55099
144 Ga0495596_0000362 3300046500 Bacteria 29160
145 Ga0495596_0003264 3300046500 Bacteria 8285
146 Ga0495596_0005466 3300046500 Bacteria 5997
147 Ga0495596_0009184 3300046500 Bacteria 4361
148 Ga0495596_0012976 3300046500 Bacteria 3549
149 Ga0495596_0027630 3300046500 Bacteria 2280
150 Ga0495596_0028974 3300046500 Bacteria 2221
151 Ga0495596_0055932 3300046500 Bacteria 1541
152 Ga0495596_0107720 3300046500 Bacteria 1082
153 Ga0495607_0019506 3300046501 Bacteria 4306
154 Ga0495607_0021740 3300046501 Bacteria 4034
155 Ga0495607_0026968 3300046501 Bacteria 3559
156 Ga0495607_0059978 3300046501 Bacteria 2167
157 Ga0495583_0000009 3300046506 Bacteria 372527
158 Ga0495583_0002668 3300046506 Bacteria 14852
159 Ga0495583_0004155 3300046506 Bacteria 10583
160 Ga0495583_0028353 3300046506 Bacteria 2754
161 Ga0495583_0040366 3300046506 Bacteria 2193
162 Ga0495583_0047350 3300046506 Bacteria 1978
163 Ga0495606_0017971 3300046507 Bacteria 5320
164 Ga0495606_0024889 3300046507 Bacteria 4301
165 Ga0495616_0000102 3300046513 Bacteria 73446
166 Ga0495616_0003229 3300046513 Bacteria 10492
167 Ga0495616_0007875 3300046513 Bacteria 6355
168 Ga0495616_0087210 3300046513 Bacteria 1483
169 Ga0495616_0133305 3300046513 Bacteria 1136
170 Ga0495620_0008218 3300046515 Bacteria 5612
171 Ga0495631_0000745 3300046518 Bacteria 20926
172 Ga0495631_0002287 3300046518 Bacteria 10959
173 Ga0495631_0011940 3300046518 Bacteria 4259
174 Ga0495631_0012524 3300046518 Bacteria 4138
175 Ga0495631_0016973 3300046518 Bacteria 3454
176 Ga0495631_0017150 3300046518 Bacteria 3431
177 Ga0495631_0020334 3300046518 Bacteria 3102
178 Ga0495631_0028886 3300046518 Bacteria 2527
179 Ga0495632_0000133 3300046519 Bacteria 75692
180 Ga0495632_0001962 3300046519 Bacteria 16384
181 Ga0495632_0008911 3300046519 Bacteria 6096
182 Ga0495643_0000096 3300046522 Bacteria 146041
183 Ga0495643_0022878 3300046522 Bacteria 3559
184 Ga0495643_0064706 3300046522 Bacteria 1931
185 Ga0495643_0202034 3300046522 Bacteria 953
186 Ga0495644_0006108 3300046523 Bacteria 4682
187 Ga0495644_0009064 3300046523 Bacteria 3830
188 Ga0495644_0043341 3300046523 Bacteria 1693
189 Ga0495644_0049044 3300046523 Bacteria 1586
190 Ga0495644_0075734 3300046523 Bacteria 1267
191 Ga0495644_0135261 3300046523 Bacteria 940
192 Ga0495648_0014838 3300046524 Bacteria 5676
193 Ga0495648_0018553 3300046524 Bacteria 4920
194 Ga0495648_0020626 3300046524 Bacteria 4589
195 Ga0495648_0025220 3300046524 Bacteria 4030
196 Ga0495648_0061084 3300046524 Bacteria 2239
197 Ga0495663_0046191 3300046525 Bacteria 1337
198 Ga0495666_0000577 3300046526 Bacteria 16399
199 Ga0495666_0005743 3300046526 Bacteria 6254
200 Ga0495642_0003439 3300046528 Bacteria 6235
201 Ga0495642_0006524 3300046528 Bacteria 4474
202 Ga0495642_0013874 3300046528 Bacteria 3120
203 Ga0495642_0020186 3300046528 Bacteria 2615
204 Ga0495642_0037842 3300046528 Bacteria 1953
205 Ga0495642_0050856 3300046528 Bacteria 1704
206 Ga0495642_0053601 3300046528 Bacteria 1662
207 Ga0495642_0087975 3300046528 Bacteria 1313
208 Ga0495654_0012892 3300046530 Bacteria 4482
209 Ga0495665_0004255 3300046531 Bacteria 7732
210 Ga0495665_0013689 3300046531 Bacteria 4382
211 Ga0495665_0137903 3300046531 Bacteria 1276
212 Ga0495640_0101214 3300046533 Bacteria 1891
213 Ga0495586_0099545 3300046535 Bacteria 1612
214 Ga0495609_0004306 3300046538 Bacteria 7833
215 Ga0495609_0005293 3300046538 Bacteria 6835
216 Ga0495609_0020957 3300046538 Bacteria 3016
217 Ga0495609_0077350 3300046538 Bacteria 1457
218 Ga0495621_0006593 3300046539 Bacteria 3398
219 Ga0495597_0000650 3300046542 Bacteria 28233
220 Ga0495597_0001181 3300046542 Bacteria 19574
221 Ga0495597_0003417 3300046542 Bacteria 9279
222 Ga0495597_0008638 3300046542 Bacteria 5094
223 Ga0495597_0009282 3300046542 Bacteria 4869
224 Ga0495597_0064907 3300046542 Bacteria 1584
225 Ga0495645_0244754 3300046543 Bacteria 1195
226 Ga0495622_0007801 3300046557 Bacteria 4970
227 Ga0495633_0002027 3300046558 Bacteria 14623
228 Ga0495633_0002874 3300046558 Bacteria 11807
229 Ga0495633_0006564 3300046558 Bacteria 6876
230 Ga0495633_0017549 3300046558 Bacteria 3657
231 Ga0495633_0086529 3300046558 Bacteria 1457
232 Ga0495633_0092248 3300046558 Bacteria 1407
233 Ga0495656_0017083 3300046615 Bacteria 2763
234 Ga0495656_0055359 3300046615 Bacteria 1710
235 Ga0495668_0000020 3300046616 Bacteria 411641
236 Ga0495668_0000052 3300046616 Bacteria 212864
237 Ga0495668_0009891 3300046616 Bacteria 5816
238 Ga0495668_0019710 3300046616 Bacteria 3884
239 Ga0495668_0027286 3300046616 Bacteria 3236
240 Ga0495668_0028822 3300046616 Bacteria 3138
241 Ga0495668_0037360 3300046616 Bacteria 2716
242 Ga0495668_0061973 3300046616 Bacteria 2061
243 Ga0495668_0066495 3300046616 Bacteria 1983
244 Ga0495668_0129240 3300046616 Bacteria 1383
245 Ga0495668_0334393 3300046616 Bacteria 831
246 Ga0495634_0122219 3300046642 Bacteria 1667
247 Ga0495611_0006162 3300046648 Bacteria 5118
248 Ga0495611_0077260 3300046648 Bacteria 1527
249 Ga0495611_0119863 3300046648 Bacteria 1226
250 Ga0495611_0128834 3300046648 Bacteria 1180
251 Ga0495611_0195890 3300046648 Bacteria 943
252 Ga0495625_0067000 3300046660 Bacteria 2528
253 Ga0495625_0070341 3300046660 Bacteria 2457
254 Ga0495625_0117672 3300046660 Bacteria 1811
255 Ga0495635_0072145 3300046663 Bacteria 2366
256 Ga0495659_0029054 3300046664 Bacteria 1917
257 Ga0495659_0096333 3300046664 Bacteria 1142
258 Ga0495661_0001589 3300046665 Bacteria 18719
259 Ga0495661_0005420 3300046665 Bacteria 9063
260 Ga0495661_0021325 3300046665 Bacteria 4225
261 Ga0495661_0024131 3300046665 Bacteria 3938
262 Ga0495661_0076054 3300046665 Bacteria 1949
263 Ga0495661_0145117 3300046665 Bacteria 1287
264 Ga0495588_0019914 3300046674 Bacteria 3292
265 Ga0495588_0037351 3300046674 Bacteria 2467
266 Ga0495588_0044011 3300046674 Bacteria 2285
267 Ga0495588_0069188 3300046674 Bacteria 1834
268 Ga0495588_0091971 3300046674 Bacteria 1589
269 Ga0495646_0123789 3300046680 Bacteria 1461
270 Ga0495669_0000040 3300046684 Bacteria 90851
271 Ga0495669_0001604 3300046684 Bacteria 9283
272 Ga0495624_0103657 3300046690 Bacteria 1750
273 Ga0495670_0000173 3300046691 Bacteria 28767
274 Ga0495670_0000390 3300046691 Bacteria 20896
275 Ga0495670_0001692 3300046691 Bacteria 10834
276 Ga0495670_0011400 3300046691 Bacteria 4372
277 Ga0495670_0033198 3300046691 Bacteria 2568
278 Ga0495670_0035406 3300046691 Bacteria 2488
279 Ga0495670_0113222 3300046691 Bacteria 1405
280 Ga0495670_0129220 3300046691 Bacteria 1316
281 Ga0495671_0000877 3300046692 Bacteria 21472
282 Ga0495671_0091608 3300046692 Bacteria 1488
283 Ga0495649_0207096 3300046694 Bacteria 1017
284 Ga0495589_0000304 3300046794 Bacteria 39263
285 Ga0495589_0076404 3300046794 Bacteria 1633
286 Ga0495589_0093077 3300046794 Bacteria 1463
287 Ga0495589_0101611 3300046794 Bacteria 1391
288 Ga0495589_0137306 3300046794 Bacteria 1172
289 Ga0495660_0047442 3300046810 Bacteria 2352
290 Ga0495660_0088374 3300046810 Bacteria 1614
291 Ga0495604_0004363 3300047317 Bacteria 11202
292 Ga0495604_0430370 3300047317 Bacteria 865
293 Ga0495636_0099837 3300047318 Bacteria 1268
294 Ga0495672_0000445 3300047320 Bacteria 49224
295 Ga0495672_0070174 3300047320 Bacteria 1986
296 Ga0495672_0115317 3300047320 Bacteria 1436
297 Ga0495676_0000007 3300047321 Bacteria 276148
298 Ga0495676_0215424 3300047321 Bacteria 1326
299 Ga0495680_0008586 3300047322 Bacteria 9275
300 Ga0495683_0000133 3300047323 Bacteria 72553
301 Ga0495683_0007510 3300047323 Bacteria 5887
302 Ga0495683_0021530 3300047323 Bacteria 3322
303 Ga0495683_0084087 3300047323 Bacteria 1549
304 Ga0495683_0115429 3300047323 Bacteria 1278
305 Ga0495687_000150 3300047443 Bacteria 105759
306 Ga0495687_000411 3300047443 Bacteria 53055
307 Ga0495687_003977 3300047443 Bacteria 10310
308 Ga0495687_049560 3300047443 Bacteria 1794
309 Ga0495675_0001419 3300047444 Bacteria 14514
310 Ga0495677_0003593 3300047445 Bacteria 6013
311 Ga0495677_0005794 3300047445 Bacteria 4673
312 Ga0495677_0023639 3300047445 Bacteria 2230
313 Ga0495677_0047980 3300047445 Bacteria 1568
314 Ga0495685_018646 3300047447 Bacteria 2382
315 Ga0495673_0037488 3300047469 Bacteria 2213
316 Ga0495681_0000080 3300047470 Bacteria 84770
317 Ga0495681_0000606 3300047470 Bacteria 27406
318 Ga0495681_0011960 3300047470 Bacteria 5127
319 Ga0495686_0000593 3300047472 Bacteria 50448
320 Ga0495686_0075603 3300047472 Bacteria 2065
321 Ga0495593_0004319 3300047673 Bacteria 8454
322 Ga0495593_0077038 3300047673 Bacteria 1727
323 Ga0495614_0008604 3300048089 Bacteria 4537
324 Ga0495614_0012757 3300048089 Bacteria 3687
325 Ga0495615_0025485 3300048090 Bacteria 1373
326 Ga0495626_0000018 3300048091 Bacteria 230153
327 Ga0495626_0006973 3300048091 Bacteria 6359
328 Ga0495626_0010257 3300048091 Bacteria 5014
329 Ga0495626_0015913 3300048091 Bacteria 3837
330 Ga0495626_0020768 3300048091 Bacteria 3268
331 Ga0495626_0023521 3300048091 Bacteria 3033
332 Ga0495626_0027251 3300048091 Bacteria 2779
333 Ga0495626_0058686 3300048091 Bacteria 1757
334 Ga0495626_0068627 3300048091 Bacteria 1598
335 Ga0495626_0149491 3300048091 Bacteria 985
336 Ga0496101_0090801 3300048904 Bacteria 2272
337 Ga0496102_0099267 3300048905 Bacteria 2702
338 Ga0496105_0120636 3300048908 Bacteria 2162
339 Ga0496106_0216103 3300048909 Bacteria 1528
340 Ga0496107_0132046 3300048910 Bacteria 1844
341 Ga0496108_0059338 3300048911 Bacteria 3217
342 Ga0496110_0008250 3300048913 Bacteria 8375
343 Ga0496110_0411717 3300048913 Bacteria 1233
344 Ga0496111_0007192 3300048914 Bacteria 7276
345 Ga0496111_0016990 3300048914 Bacteria 5023
346 Ga0496115_0006409 3300048918 Bacteria 8621
347 Ga0496115_0088920 3300048918 Bacteria 2522
348 Ga0496115_0172307 3300048918 Bacteria 1790
349 Ga0496124_0003287 3300048927 Bacteria 19940
350 Ga0496124_0004757 3300048927 Bacteria 15634
351 Ga0496124_0087142 3300048927 Bacteria 2554
352 Ga0495678_000050 3300049459 Bacteria 160887
353 Ga0495678_000257 3300049459 Bacteria 59306
354 Ga0495678_001385 3300049459 Bacteria 19307
355 Ga0495682_0011052 3300049460 Bacteria 3479
356 Ga0501034_0103008 3300049571 Bacteria 2848
357 Ga0501227_021163 3300049665 Bacteria 1498
358 Ga0501233_027047 3300049668 Bacteria 1271
359 Ga0501279_012853 3300049775 Bacteria 1141
360 Ga0500637_0001382 3300053178 Bacteria 10312
361 Ga0587077_004284 3300059493 Bacteria 1863
362 Ga0587068_001842 3300059641 Bacteria 2473

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0151479 Ga0466967_0151479_1306_2136 231
2 3300046648 Ga0495611_0195890 Ga0495611_0195890_13_714 233
3 3300049460 Ga0495682_0011052 Ga0495682_0011052_2758_3459 233
4 3300044658 Ga0466972_0005099 Ga0466972_0005099_1744_2517 244
5 3300044683 Ga0466965_0007849 Ga0466965_0007849_2004_2777 244
6 3300044735 Ga0466968_0015750 Ga0466968_0015750_166_939 244
7 3300005337 Ga0070682_100013207 Ga0070682_1000132075 247
8 3300046810 Ga0495660_0047442 Ga0495660_0047442_114_1019 254
9 iso_pu_bacteria 2643221603 2644030106 256
10 iso_pu_bacteria 2643221554 2643791551 257
11 iso_pu_bacteria 2643221638 2644211192 257
12 3300046472 Ga0495580_0004208 Ga0495580_0004208_5935_6714 258
13 3300046499 Ga0495594_0077677 Ga0495594_0077677_784_1563 258
14 3300046526 Ga0495666_0000577 Ga0495666_0000577_10206_10985 258
15 3300046531 Ga0495665_0013689 Ga0495665_0013689_3432_4211 258
16 3300046616 Ga0495668_0334393 Ga0495668_0334393_39_815 258
17 3300046690 Ga0495624_0103657 Ga0495624_0103657_767_1546 258
18 3300047317 Ga0495604_0004363 Ga0495604_0004363_10058_10837 258
19 3300031507 Ga0307509_10400766 Ga0307509_104007661 259
20 3300045051 Ga0451576_0090282 Ga0451576_0090282_86_907 259
21 3300046455 Ga0495603_0089280 Ga0495603_0089280_441_1220 259
22 3300046492 Ga0495585_0154138 Ga0495585_0154138_155_934 259
23 3300046499 Ga0495594_0000521 Ga0495594_0000521_11101_11880 259
24 3300046518 Ga0495631_0011940 Ga0495631_0011940_1245_2024 259
25 3300046518 Ga0495631_0012524 Ga0495631_0012524_1529_2308 259
26 3300046528 Ga0495642_0020186 Ga0495642_0020186_857_1636 259
27 3300046542 Ga0495597_0003417 Ga0495597_0003417_6040_6819 259
28 3300046542 Ga0495597_0008638 Ga0495597_0008638_3406_4185 259
29 3300046616 Ga0495668_0028822 Ga0495668_0028822_1718_2497 259
30 3300046648 Ga0495611_0119863 Ga0495611_0119863_16_795 259
31 3300046660 Ga0495625_0070341 Ga0495625_0070341_1147_1926 259
32 3300046674 Ga0495588_0091971 Ga0495588_0091971_128_907 259
33 3300046691 Ga0495670_0129220 Ga0495670_0129220_356_1135 259
34 3300046794 Ga0495589_0137306 Ga0495589_0137306_15_794 259
35 3300047321 Ga0495676_0215424 Ga0495676_0215424_332_1111 259
36 3300047673 Ga0495593_0077038 Ga0495593_0077038_432_1211 259
37 3300048091 Ga0495626_0149491 Ga0495626_0149491_68_847 259
38 3300048918 Ga0496115_0006409 Ga0496115_0006409_4063_4842 259
39 3300048918 Ga0496115_0088920 Ga0496115_0088920_252_1031 259
40 3300053178 Ga0500637_0001382 Ga0500637_0001382_5892_6674 259
41 3300003187 JGI25151J46595_10017026 JGI25151J46595_100170263 260
42 3300003773 Ga0055537_1000044 Ga0055537_100004485 260
43 3300003784 Ga0055534_1002186 Ga0055534_10021869 260
44 3300003790 Ga0055528_1000011 Ga0055528_100001156 260
45 3300004625 Ga0055543_1025923 Ga0055543_10259231 260
46 3300005262 Ga0065165_1000007 Ga0065165_1000007157 260
47 3300006175 Ga0070712_100311005 Ga0070712_1003110052 260
48 3300009174 Ga0105241_10572770 Ga0105241_105727701 260
49 3300013102 Ga0157371_10000149 Ga0157371_1000014931 260
50 3300014497 Ga0182008_10070153 Ga0182008_100701532 260
51 3300015261 Ga0182006_1063494 Ga0182006_10634942 260
52 3300025263 Ga0209565_1000003 Ga0209565_1000003730 260
53 3300025273 Ga0209673_1000003 Ga0209673_1000003616 260
54 3300025284 Ga0209130_1000047 Ga0209130_1000047136 260
55 3300025291 Ga0209675_1000003 Ga0209675_1000003308 260
56 3300025294 Ga0209025_1000718 Ga0209025_100071813 260
57 3300025295 Ga0209564_1000012 Ga0209564_1000012116 260
58 3300025299 Ga0209256_1000029 Ga0209256_1000029117 260
59 3300025915 Ga0207693_10303808 Ga0207693_103038081 260
60 3300026142 Ga0207698_10022051 Ga0207698_100220514 260
61 3300030745 Ga0316182_1246430 Ga0316182_12464302 260
62 3300037312 Ga0395899_0001402 Ga0395899_0001402_19468_20253 260
63 3300037312 Ga0395899_0004872 Ga0395899_0004872_4477_5259 260
64 3300037312 Ga0395899_0007376 Ga0395899_0007376_5405_6190 260
65 3300037312 Ga0395899_0197536 Ga0395899_0197536_391_1173 260
66 3300037312 Ga0395899_0249575 Ga0395899_0249575_238_1020 260
67 3300037418 Ga0395900_0018511 Ga0395900_0018511_4302_5084 260
68 3300037418 Ga0395900_0217093 Ga0395900_0217093_13_798 260
69 3300037466 Ga0395898_0229288 Ga0395898_0229288_456_1238 260
70 3300037466 Ga0395898_0336473 Ga0395898_0336473_491_1276 260
71 3300037471 Ga0395905_0003674 Ga0395905_0003674_3484_4269 260
72 3300037471 Ga0395905_0022941 Ga0395905_0022941_1476_2261 260
73 3300037471 Ga0395905_0114606 Ga0395905_0114606_462_1244 260
74 3300037471 Ga0395905_0696180 Ga0395905_0696180_48_833 260
75 3300038443 Ga0395901_0026078 Ga0395901_0026078_375_1160 260
76 3300038443 Ga0395901_0053884 Ga0395901_0053884_3135_3917 260
77 3300038443 Ga0395901_0248548 Ga0395901_0248548_565_1347 260
78 3300039447 Ga0436361_0167113 Ga0436361_0167113_3501_4373 260
79 3300039447 Ga0436361_0582900 Ga0436361_0582900_6641_7429 260
80 3300039447 Ga0436361_0742159 Ga0436361_0742159_2725_3525 260
81 3300042139 Ga0450904_001169 Ga0450904_001169_3098_3880 260
82 3300044658 Ga0466972_0036304 Ga0466972_0036304_814_1602 260
83 3300044683 Ga0466965_0038367 Ga0466965_0038367_1414_2202 260
84 3300044719 Ga0466971_0124024 Ga0466971_0124024_151_939 260
85 3300045836 Ga0466958_0249339 Ga0466958_0249339_276_1058 260
86 3300046453 Ga0495627_003603 Ga0495627_003603_532_1314 260
87 3300046457 Ga0495590_0009070 Ga0495590_0009070_2298_3080 260
88 3300046457 Ga0495590_0038588 Ga0495590_0038588_853_1635 260
89 3300046460 Ga0495638_0022329 Ga0495638_0022329_2008_2790 260
90 3300046460 Ga0495638_0101332 Ga0495638_0101332_530_1312 260
91 3300046463 Ga0495653_0013488 Ga0495653_0013488_123_905 260
92 3300046471 Ga0495650_0000001 Ga0495650_0000001_892408_893190 260
93 3300046473 Ga0495582_0017054 Ga0495582_0017054_763_1545 260
94 3300046474 Ga0495605_0014258 Ga0495605_0014258_2559_3341 260
95 3300046474 Ga0495605_0111565 Ga0495605_0111565_17_799 260
96 3300046491 Ga0495584_0000002 Ga0495584_0000002_58569_59351 260
97 3300046491 Ga0495584_0000028 Ga0495584_0000028_89597_90379 260
98 3300046491 Ga0495584_0002511 Ga0495584_0002511_3595_4377 260
99 3300046491 Ga0495584_0039440 Ga0495584_0039440_895_1677 260
100 3300046491 Ga0495584_0045374 Ga0495584_0045374_455_1237 260
101 3300046491 Ga0495584_0057700 Ga0495584_0057700_467_1249 260
102 3300046491 Ga0495584_0122619 Ga0495584_0122619_164_946 260
103 3300046491 Ga0495584_0164537 Ga0495584_0164537_44_826 260
104 3300046492 Ga0495585_0000038 Ga0495585_0000038_52406_53188 260
105 3300046492 Ga0495585_0000187 Ga0495585_0000187_27568_28350 260
106 3300046492 Ga0495585_0000188 Ga0495585_0000188_42273_43055 260
107 3300046492 Ga0495585_0000325 Ga0495585_0000325_39069_39851 260
108 3300046492 Ga0495585_0001769 Ga0495585_0001769_6104_6886 260
109 3300046492 Ga0495585_0005991 Ga0495585_0005991_5569_6351 260
110 3300046492 Ga0495585_0012043 Ga0495585_0012043_4030_4812 260
111 3300046492 Ga0495585_0024942 Ga0495585_0024942_1215_1997 260
112 3300046492 Ga0495585_0041051 Ga0495585_0041051_939_1721 260
113 3300046492 Ga0495585_0045950 Ga0495585_0045950_1282_2064 260
114 3300046492 Ga0495585_0135666 Ga0495585_0135666_281_1063 260
115 3300046499 Ga0495594_0036177 Ga0495594_0036177_501_1283 260
116 3300046499 Ga0495594_0119925 Ga0495594_0119925_69_851 260
117 3300046500 Ga0495596_0000017 Ga0495596_0000017_96965_97747 260
118 3300046500 Ga0495596_0000116 Ga0495596_0000116_33496_34278 260
119 3300046500 Ga0495596_0000362 Ga0495596_0000362_8154_8936 260
120 3300046500 Ga0495596_0003264 Ga0495596_0003264_4502_5284 260
121 3300046500 Ga0495596_0005466 Ga0495596_0005466_4006_4788 260
122 3300046500 Ga0495596_0009184 Ga0495596_0009184_1771_2553 260
123 3300046500 Ga0495596_0012976 Ga0495596_0012976_2181_2963 260
124 3300046500 Ga0495596_0027630 Ga0495596_0027630_926_1708 260
125 3300046500 Ga0495596_0028974 Ga0495596_0028974_1386_2168 260
126 3300046500 Ga0495596_0055932 Ga0495596_0055932_338_1120 260
127 3300046500 Ga0495596_0107720 Ga0495596_0107720_72_854 260
128 3300046501 Ga0495607_0019506 Ga0495607_0019506_1755_2537 260
129 3300046501 Ga0495607_0021740 Ga0495607_0021740_2438_3220 260
130 3300046501 Ga0495607_0026968 Ga0495607_0026968_1973_2755 260
131 3300046501 Ga0495607_0059978 Ga0495607_0059978_1190_1972 260
132 3300046506 Ga0495583_0000009 Ga0495583_0000009_217412_218194 260
133 3300046506 Ga0495583_0002668 Ga0495583_0002668_158_940 260
134 3300046506 Ga0495583_0004155 Ga0495583_0004155_7664_8446 260
135 3300046506 Ga0495583_0028353 Ga0495583_0028353_1451_2233 260
136 3300046506 Ga0495583_0040366 Ga0495583_0040366_16_798 260
137 3300046506 Ga0495583_0047350 Ga0495583_0047350_988_1770 260
138 3300046507 Ga0495606_0017971 Ga0495606_0017971_949_1731 260
139 3300046507 Ga0495606_0024889 Ga0495606_0024889_1525_2307 260
140 3300046513 Ga0495616_0000102 Ga0495616_0000102_8667_9449 260
141 3300046513 Ga0495616_0003229 Ga0495616_0003229_9230_10012 260
142 3300046513 Ga0495616_0007875 Ga0495616_0007875_4435_5217 260
143 3300046513 Ga0495616_0087210 Ga0495616_0087210_470_1252 260
144 3300046513 Ga0495616_0133305 Ga0495616_0133305_326_1108 260
145 3300046515 Ga0495620_0008218 Ga0495620_0008218_1714_2496 260
146 3300046518 Ga0495631_0000745 Ga0495631_0000745_19957_20739 260
147 3300046518 Ga0495631_0002287 Ga0495631_0002287_7007_7789 260
148 3300046518 Ga0495631_0016973 Ga0495631_0016973_1031_1813 260
149 3300046518 Ga0495631_0017150 Ga0495631_0017150_809_1591 260
150 3300046518 Ga0495631_0020334 Ga0495631_0020334_331_1113 260
151 3300046518 Ga0495631_0028886 Ga0495631_0028886_699_1481 260
152 3300046519 Ga0495632_0000133 Ga0495632_0000133_25566_26348 260
153 3300046519 Ga0495632_0001962 Ga0495632_0001962_4996_5778 260
154 3300046519 Ga0495632_0008911 Ga0495632_0008911_2168_2950 260
155 3300046522 Ga0495643_0000096 Ga0495643_0000096_20911_21693 260
156 3300046522 Ga0495643_0022878 Ga0495643_0022878_114_896 260
157 3300046522 Ga0495643_0064706 Ga0495643_0064706_551_1333 260
158 3300046522 Ga0495643_0202034 Ga0495643_0202034_116_898 260
159 3300046523 Ga0495644_0006108 Ga0495644_0006108_2902_3684 260
160 3300046523 Ga0495644_0009064 Ga0495644_0009064_2677_3459 260
161 3300046523 Ga0495644_0043341 Ga0495644_0043341_660_1442 260
162 3300046523 Ga0495644_0049044 Ga0495644_0049044_734_1516 260
163 3300046523 Ga0495644_0075734 Ga0495644_0075734_126_908 260
164 3300046523 Ga0495644_0135261 Ga0495644_0135261_38_820 260
165 3300046524 Ga0495648_0014838 Ga0495648_0014838_2718_3500 260
166 3300046524 Ga0495648_0018553 Ga0495648_0018553_2234_3016 260
167 3300046524 Ga0495648_0020626 Ga0495648_0020626_2849_3631 260
168 3300046524 Ga0495648_0025220 Ga0495648_0025220_985_1767 260
169 3300046524 Ga0495648_0061084 Ga0495648_0061084_167_949 260
170 3300046525 Ga0495663_0046191 Ga0495663_0046191_226_1008 260
171 3300046526 Ga0495666_0005743 Ga0495666_0005743_471_1253 260
172 3300046528 Ga0495642_0003439 Ga0495642_0003439_4153_4935 260
173 3300046528 Ga0495642_0006524 Ga0495642_0006524_824_1606 260
174 3300046528 Ga0495642_0013874 Ga0495642_0013874_715_1497 260
175 3300046528 Ga0495642_0037842 Ga0495642_0037842_372_1154 260
176 3300046528 Ga0495642_0050856 Ga0495642_0050856_556_1338 260
177 3300046528 Ga0495642_0053601 Ga0495642_0053601_218_1000 260
178 3300046528 Ga0495642_0087975 Ga0495642_0087975_209_994 260
179 3300046530 Ga0495654_0012892 Ga0495654_0012892_628_1410 260
180 3300046531 Ga0495665_0004255 Ga0495665_0004255_2776_3558 260
181 3300046531 Ga0495665_0137903 Ga0495665_0137903_371_1153 260
182 3300046533 Ga0495640_0101214 Ga0495640_0101214_356_1138 260
183 3300046535 Ga0495586_0099545 Ga0495586_0099545_383_1165 260
184 3300046538 Ga0495609_0004306 Ga0495609_0004306_888_1670 260
185 3300046538 Ga0495609_0005293 Ga0495609_0005293_1137_1919 260
186 3300046538 Ga0495609_0020957 Ga0495609_0020957_2083_2865 260
187 3300046538 Ga0495609_0077350 Ga0495609_0077350_170_952 260
188 3300046539 Ga0495621_0006593 Ga0495621_0006593_711_1496 260
189 3300046542 Ga0495597_0000650 Ga0495597_0000650_22587_23369 260
190 3300046542 Ga0495597_0001181 Ga0495597_0001181_11977_12759 260
191 3300046542 Ga0495597_0009282 Ga0495597_0009282_877_1659 260
192 3300046542 Ga0495597_0064907 Ga0495597_0064907_217_999 260
193 3300046543 Ga0495645_0244754 Ga0495645_0244754_299_1081 260
194 3300046557 Ga0495622_0007801 Ga0495622_0007801_2133_2915 260
195 3300046558 Ga0495633_0002027 Ga0495633_0002027_6762_7544 260
196 3300046558 Ga0495633_0002874 Ga0495633_0002874_9591_10373 260
197 3300046558 Ga0495633_0006564 Ga0495633_0006564_5085_5867 260
198 3300046558 Ga0495633_0017549 Ga0495633_0017549_1362_2144 260
199 3300046558 Ga0495633_0086529 Ga0495633_0086529_392_1174 260
200 3300046558 Ga0495633_0092248 Ga0495633_0092248_378_1160 260
201 3300046615 Ga0495656_0017083 Ga0495656_0017083_1312_2094 260
202 3300046615 Ga0495656_0055359 Ga0495656_0055359_782_1564 260
203 3300046616 Ga0495668_0000020 Ga0495668_0000020_22585_23367 260
204 3300046616 Ga0495668_0000052 Ga0495668_0000052_164758_165540 260
205 3300046616 Ga0495668_0009891 Ga0495668_0009891_1251_2033 260
206 3300046616 Ga0495668_0019710 Ga0495668_0019710_2780_3565 260
207 3300046616 Ga0495668_0027286 Ga0495668_0027286_338_1120 260
208 3300046616 Ga0495668_0037360 Ga0495668_0037360_886_1668 260
209 3300046616 Ga0495668_0061973 Ga0495668_0061973_1125_1907 260
210 3300046616 Ga0495668_0066495 Ga0495668_0066495_173_955 260
211 3300046616 Ga0495668_0129240 Ga0495668_0129240_441_1223 260
212 3300046642 Ga0495634_0122219 Ga0495634_0122219_607_1440 260
213 3300046648 Ga0495611_0006162 Ga0495611_0006162_774_1556 260
214 3300046648 Ga0495611_0077260 Ga0495611_0077260_465_1247 260
215 3300046648 Ga0495611_0128834 Ga0495611_0128834_149_931 260
216 3300046660 Ga0495625_0067000 Ga0495625_0067000_83_865 260
217 3300046660 Ga0495625_0117672 Ga0495625_0117672_719_1501 260
218 3300046663 Ga0495635_0072145 Ga0495635_0072145_950_1732 260
219 3300046664 Ga0495659_0029054 Ga0495659_0029054_1101_1883 260
220 3300046664 Ga0495659_0096333 Ga0495659_0096333_41_823 260
221 3300046665 Ga0495661_0001589 Ga0495661_0001589_14346_15128 260
222 3300046665 Ga0495661_0005420 Ga0495661_0005420_3422_4204 260
223 3300046665 Ga0495661_0021325 Ga0495661_0021325_1881_2663 260
224 3300046665 Ga0495661_0024131 Ga0495661_0024131_1931_2713 260
225 3300046665 Ga0495661_0076054 Ga0495661_0076054_714_1496 260
226 3300046665 Ga0495661_0145117 Ga0495661_0145117_110_892 260
227 3300046674 Ga0495588_0019914 Ga0495588_0019914_2009_2791 260
228 3300046674 Ga0495588_0037351 Ga0495588_0037351_1000_1782 260
229 3300046674 Ga0495588_0044011 Ga0495588_0044011_199_981 260
230 3300046674 Ga0495588_0069188 Ga0495588_0069188_985_1767 260
231 3300046680 Ga0495646_0123789 Ga0495646_0123789_585_1367 260
232 3300046684 Ga0495669_0000040 Ga0495669_0000040_39179_39961 260
233 3300046684 Ga0495669_0001604 Ga0495669_0001604_6540_7322 260
234 3300046691 Ga0495670_0000173 Ga0495670_0000173_4193_4975 260
235 3300046691 Ga0495670_0000390 Ga0495670_0000390_20100_20882 260
236 3300046691 Ga0495670_0001692 Ga0495670_0001692_7554_8336 260
237 3300046691 Ga0495670_0011400 Ga0495670_0011400_1987_2769 260
238 3300046691 Ga0495670_0033198 Ga0495670_0033198_730_1512 260
239 3300046691 Ga0495670_0035406 Ga0495670_0035406_294_1076 260
240 3300046691 Ga0495670_0113222 Ga0495670_0113222_559_1341 260
241 3300046692 Ga0495671_0000877 Ga0495671_0000877_2739_3521 260
242 3300046692 Ga0495671_0091608 Ga0495671_0091608_108_890 260
243 3300046694 Ga0495649_0207096 Ga0495649_0207096_43_825 260
244 3300046794 Ga0495589_0000304 Ga0495589_0000304_17848_18630 260
245 3300046794 Ga0495589_0076404 Ga0495589_0076404_497_1279 260
246 3300046794 Ga0495589_0093077 Ga0495589_0093077_201_983 260
247 3300046794 Ga0495589_0101611 Ga0495589_0101611_12_794 260
248 3300046810 Ga0495660_0088374 Ga0495660_0088374_453_1235 260
249 3300047317 Ga0495604_0430370 Ga0495604_0430370_41_823 260
250 3300047318 Ga0495636_0099837 Ga0495636_0099837_259_1041 260
251 3300047320 Ga0495672_0000445 Ga0495672_0000445_6563_7351 260
252 3300047320 Ga0495672_0070174 Ga0495672_0070174_278_1060 260
253 3300047320 Ga0495672_0115317 Ga0495672_0115317_227_1009 260
254 3300047321 Ga0495676_0000007 Ga0495676_0000007_234550_235332 260
255 3300047322 Ga0495680_0008586 Ga0495680_0008586_7785_8567 260
256 3300047323 Ga0495683_0000133 Ga0495683_0000133_64895_65677 260
257 3300047323 Ga0495683_0007510 Ga0495683_0007510_1365_2147 260
258 3300047323 Ga0495683_0021530 Ga0495683_0021530_2085_2867 260
259 3300047323 Ga0495683_0084087 Ga0495683_0084087_318_1100 260
260 3300047323 Ga0495683_0115429 Ga0495683_0115429_360_1142 260
261 3300047443 Ga0495687_000150 Ga0495687_000150_91416_92198 260
262 3300047443 Ga0495687_000411 Ga0495687_000411_42691_43473 260
263 3300047443 Ga0495687_003977 Ga0495687_003977_4075_4857 260
264 3300047443 Ga0495687_049560 Ga0495687_049560_427_1212 260
265 3300047444 Ga0495675_0001419 Ga0495675_0001419_321_1103 260
266 3300047445 Ga0495677_0003593 Ga0495677_0003593_4680_5462 260
267 3300047445 Ga0495677_0005794 Ga0495677_0005794_2585_3367 260
268 3300047445 Ga0495677_0023639 Ga0495677_0023639_640_1422 260
269 3300047445 Ga0495677_0047980 Ga0495677_0047980_520_1302 260
270 3300047447 Ga0495685_018646 Ga0495685_018646_832_1614 260
271 3300047469 Ga0495673_0037488 Ga0495673_0037488_268_1050 260
272 3300047470 Ga0495681_0000080 Ga0495681_0000080_31238_32020 260
273 3300047470 Ga0495681_0000606 Ga0495681_0000606_23161_23943 260
274 3300047470 Ga0495681_0011960 Ga0495681_0011960_3770_4552 260
275 3300047472 Ga0495686_0000593 Ga0495686_0000593_16097_16879 260
276 3300047472 Ga0495686_0075603 Ga0495686_0075603_1263_2045 260
277 3300047673 Ga0495593_0004319 Ga0495593_0004319_5699_6481 260
278 3300048089 Ga0495614_0008604 Ga0495614_0008604_1487_2269 260
279 3300048089 Ga0495614_0012757 Ga0495614_0012757_710_1492 260
280 3300048090 Ga0495615_0025485 Ga0495615_0025485_169_954 260
281 3300048091 Ga0495626_0000018 Ga0495626_0000018_189874_190656 260
282 3300048091 Ga0495626_0006973 Ga0495626_0006973_1389_2171 260
283 3300048091 Ga0495626_0010257 Ga0495626_0010257_2758_3540 260
284 3300048091 Ga0495626_0015913 Ga0495626_0015913_2109_2891 260
285 3300048091 Ga0495626_0020768 Ga0495626_0020768_1275_2057 260
286 3300048091 Ga0495626_0023521 Ga0495626_0023521_143_925 260
287 3300048091 Ga0495626_0027251 Ga0495626_0027251_1882_2664 260
288 3300048091 Ga0495626_0058686 Ga0495626_0058686_322_1104 260
289 3300048091 Ga0495626_0068627 Ga0495626_0068627_46_828 260
290 3300048904 Ga0496101_0090801 Ga0496101_0090801_794_1579 260
291 3300048905 Ga0496102_0099267 Ga0496102_0099267_391_1176 260
292 3300048908 Ga0496105_0120636 Ga0496105_0120636_694_1479 260
293 3300048909 Ga0496106_0216103 Ga0496106_0216103_82_864 260
294 3300048910 Ga0496107_0132046 Ga0496107_0132046_451_1233 260
295 3300048911 Ga0496108_0059338 Ga0496108_0059338_1759_2544 260
296 3300048913 Ga0496110_0008250 Ga0496110_0008250_480_1262 260
297 3300048913 Ga0496110_0411717 Ga0496110_0411717_171_956 260
298 3300048914 Ga0496111_0007192 Ga0496111_0007192_1357_2142 260
299 3300048914 Ga0496111_0016990 Ga0496111_0016990_2797_3579 260
300 3300048918 Ga0496115_0172307 Ga0496115_0172307_623_1405 260
301 3300048927 Ga0496124_0003287 Ga0496124_0003287_14376_15158 260
302 3300048927 Ga0496124_0004757 Ga0496124_0004757_4315_5097 260
303 3300048927 Ga0496124_0087142 Ga0496124_0087142_559_1341 260
304 3300049459 Ga0495678_000050 Ga0495678_000050_29264_30046 260
305 3300049459 Ga0495678_000257 Ga0495678_000257_17740_18522 260
306 3300049459 Ga0495678_001385 Ga0495678_001385_5725_6507 260
307 3300049571 Ga0501034_0103008 Ga0501034_0103008_1491_2276 260
308 3300049668 Ga0501233_027047 Ga0501233_027047_327_1115 260
309 3300059493 Ga0587077_004284 Ga0587077_004284_182_967 260
310 3300059641 Ga0587068_001842 Ga0587068_001842_902_1687 260
311 3300002774 JGI25150J39212_1000549 JGI25150J39212_10005496 261
312 3300002987 JGI25159J45721_1002170 JGI25159J45721_10021706 261
313 3300002987 JGI25159J45721_1025164 JGI25159J45721_10251641 261
314 3300003215 JGI25153J46596_10011033 JGI25153J46596_100110333 261
315 3300003354 JGI25160J50197_1022264 JGI25160J50197_10222642 261
316 3300003374 JGI25161J50226_1000266 JGI25161J50226_10002669 261
317 3300003374 JGI25161J50226_1002117 JGI25161J50226_10021172 261
318 3300003771 Ga0055526_1013126 Ga0055526_10131262 261
319 3300003773 Ga0055537_1009476 Ga0055537_10094762 261
320 3300003775 Ga0055524_1002445 Ga0055524_10024456 261
321 3300003775 Ga0055524_1003807 Ga0055524_10038074 261
322 3300003775 Ga0055524_1013832 Ga0055524_10138323 261
323 3300003784 Ga0055534_1001834 Ga0055534_10018343 261
324 3300003784 Ga0055534_1013716 Ga0055534_10137162 261
325 3300003790 Ga0055528_1028437 Ga0055528_10284372 261
326 3300003791 Ga0055530_10000499 Ga0055530_100004999 261
327 3300003791 Ga0055530_10007207 Ga0055530_100072072 261
328 3300003794 Ga0055531_10004666 Ga0055531_100046668 261
329 3300004625 Ga0055543_1000339 Ga0055543_100033926 261
330 3300005262 Ga0065165_1001110 Ga0065165_10011109 261
331 3300025208 Ga0209436_100554 Ga0209436_1005544 261
332 3300025208 Ga0209436_100859 Ga0209436_10085913 261
333 3300025245 Ga0207425_1000001 Ga0207425_1000001569 261
334 3300025245 Ga0207425_1000067 Ga0207425_1000067111 261
335 3300025258 Ga0209129_1000003 Ga0209129_1000003569 261
336 3300025258 Ga0209129_1001364 Ga0209129_10013644 261
337 3300025263 Ga0209565_1001086 Ga0209565_10010868 261
338 3300025263 Ga0209565_1001429 Ga0209565_10014292 261
339 3300025263 Ga0209565_1007596 Ga0209565_10075962 261
340 3300025263 Ga0209565_1009905 Ga0209565_10099052 261
341 3300025273 Ga0209673_1011123 Ga0209673_10111234 261
342 3300025284 Ga0209130_1000059 Ga0209130_100005938 261
343 3300025284 Ga0209130_1001599 Ga0209130_100159914 261
344 3300025291 Ga0209675_1005797 Ga0209675_10057973 261
345 3300025291 Ga0209675_1013798 Ga0209675_10137983 261
346 3300025295 Ga0209564_1000142 Ga0209564_1000142137 261
347 3300025295 Ga0209564_1003831 Ga0209564_100383111 261
348 3300025295 Ga0209564_1034530 Ga0209564_10345302 261
349 3300025297 Ga0209758_1000098 Ga0209758_100009854 261
350 3300025298 Ga0209050_1000058 Ga0209050_1000058191 261
351 3300025298 Ga0209050_1000654 Ga0209050_10006544 261
352 3300025298 Ga0209050_1001112 Ga0209050_10011124 261
353 3300025298 Ga0209050_1001305 Ga0209050_10013054 261
354 3300025299 Ga0209256_1000186 Ga0209256_100018695 261
355 3300025299 Ga0209256_1000875 Ga0209256_10008753 261
356 3300025302 Ga0207426_1001774 Ga0207426_10017749 261
357 3300025303 Ga0209051_1020891 Ga0209051_10208912 261
358 3300025304 Ga0209257_1000003 Ga0209257_1000003665 261
359 3300025304 Ga0209257_1002931 Ga0209257_10029318 261
360 3300025304 Ga0209257_1003953 Ga0209257_10039537 261
361 3300031548 Ga0307408_100000082 Ga0307408_10000008296 261
362 3300031548 Ga0307408_100058824 Ga0307408_1000588243 261
363 3300042532 Ga0450893_0004911 Ga0450893_0004911_356_1141 261
364 3300049665 Ga0501227_021163 Ga0501227_021163_59_844 261
365 3300049775 Ga0501279_012853 Ga0501279_012853_197_982 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

13

213

0.94

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

19

259

0.94

PF08659

KR

KR domain

13

196

0.91

PF23441

7

261

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cdy-assembly1.cif.gz_C the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9232 9 253
3grp-assembly1.cif.gz_C 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae 0.9229 7 253
3ftp-assembly1.cif.gz_B crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution 0.9218 10 253
3ftp-assembly1.cif.gz_D crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution 0.9204 10 253
3ftp-assembly1.cif.gz_C crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution 0.92 10 253
ID Description Score Start End Superfamily
3grpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9229 7 253 3.40.50.720
3ftpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.92 10 253 3.40.50.720
2et6A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9165 9 253 3.40.50.720
1x1eA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9158 13 257 3.40.50.720
af_P0AET8_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.914 1 253 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1F4EHM9-F1-model_v4 Gluconate 5-dehydrogenase 0.9456 2 257 GO:0016491
AF-A0A270B903-F1-model_v4 Gluconate 5-dehydrogenase (EC 1.1.1.69) 0.9443 11 257 GO:0008874
GO:0030497
AF-A0A5C6TYX4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9419 1 257 GO:0004222
GO:0005737
GO:0006508
GO:0006518
GO:0016491
GO:0046872
AF-A0A363TM17-F1-model_v4 Gluconate 5-dehydrogenase (EC 1.1.1.69) 0.9394 1 257 GO:0008874
AF-A0A1F4EHM9-F1-model_v4 Gluconate 5-dehydrogenase 0.9385 2 257 GO:0016491

Feature Viewer

pLDDT pTM Quality
87.05 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map