F423768

General Info

Members Datasets Scaffolds Average Seq Length
365 184 730 148

Family's Representative Sequence

Representative Sequence 3300042435|Ga0439434_0004305|Ga0439434_0004305_3130_3651
Length 173
Sequence MVSDEVGGRRGSLQSVVWNLRATPDVVTDMALDGEYEPSASEWVRNQVAKYEATGGAEGNTVLNRPIVVITSRGHLSGKLRKNPVMRVEKDGVYAAVASQGGAPEHPTWFHNFVADPVVDLQDGPEVRSYRARLAEGEERAEWWERAVAAFPNYADYQEKTERQIPVFLLEPV

Samples

Sample ID Description Type Environment
1 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
95 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
96 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
97 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
98 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
99 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
100 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
101 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
102 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
103 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
104 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
109 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
110 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
119 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
121 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
122 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
142 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
145 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
154 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
161 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
167 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
168 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
169 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
170 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
173 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
174 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
178 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
179 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
180 2643221561 Nocardioides sp. Root151 Isolate Unclassified
181 2643221696 Nocardioides sp. Root140 Isolate Unclassified
182 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
183 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
184 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.08
Metatranscriptomes 0.27
Isolates 1.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.59
Nodule 0.27
Rhizoplane 6.58
Rhizosphere 80
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439434_0004305 3300042435 Bacteria 4160
2 LJQas_1011885 3300000549 Bacteria 1033
3 LJQas_1014974 3300000549 Bacteria 909
4 Ga0070658_10363368 3300005327 Bacteria 1240
5 Ga0070658_10738512 3300005327 Bacteria 855
6 Ga0070683_100249263 3300005329 Bacteria 1689
7 Ga0070683_100268122 3300005329 Bacteria 1624
8 Ga0070683_101937983 3300005329 Bacteria 566
9 Ga0070680_100885852 3300005336 Bacteria 770
10 Ga0070682_100843456 3300005337 Bacteria 748
11 Ga0070660_100152918 3300005339 Bacteria 1856
12 Ga0070667_100163275 3300005367 Bacteria 1963
13 Ga0070667_100276057 3300005367 Bacteria 1508
14 Ga0070714_100233156 3300005435 Bacteria 1696
15 Ga0070713_100852602 3300005436 Bacteria 875
16 Ga0070701_10472619 3300005438 Bacteria 809
17 Ga0070700_100327647 3300005441 Bacteria 1127
18 Ga0070663_100101871 3300005455 Bacteria 2144
19 Ga0070663_100396141 3300005455 Bacteria 1128
20 Ga0070663_101629134 3300005455 Bacteria 576
21 Ga0070662_101256032 3300005457 Bacteria 637
22 Ga0070681_10786178 3300005458 Bacteria 869
23 Ga0070681_11310633 3300005458 Bacteria 647
24 Ga0070679_100437350 3300005530 Bacteria 1253
25 Ga0070684_101620695 3300005535 Bacteria 610
26 Ga0068853_101392175 3300005539 Bacteria 678
27 Ga0070693_100632856 3300005547 Bacteria 776
28 Ga0070665_100253484 3300005548 Bacteria 1761
29 Ga0070704_100487447 3300005549 Bacteria 1068
30 Ga0070664_100369039 3300005564 Bacteria 1308
31 Ga0068856_101553879 3300005614 Bacteria 675
32 Ga0068856_101657908 3300005614 Bacteria 652
33 Ga0070702_100436957 3300005615 Bacteria 946
34 Ga0068852_100515116 3300005616 Bacteria 1193
35 Ga0068864_100085653 3300005618 Bacteria 2771
36 Ga0068863_100015224 3300005841 Bacteria 7391
37 Ga0068863_100702563 3300005841 Bacteria 1005
38 Ga0068858_100319293 3300005842 Bacteria 1484
39 Ga0068860_100303301 3300005843 Bacteria 1565
40 Ga0068860_100644688 3300005843 Bacteria 1067
41 Ga0081540_1033858 3300005983 Bacteria 2765
42 Ga0070717_10020584 3300006028 Bacteria 5191
43 Ga0070717_10053338 3300006028 Bacteria 3333
44 Ga0075365_10013963 3300006038 Bacteria 4821
45 Ga0075365_10865579 3300006038 Bacteria 637
46 Ga0075368_10251573 3300006042 Bacteria 755
47 Ga0075363_100011844 3300006048 Bacteria 4188
48 Ga0075363_100123592 3300006048 Bacteria 1447
49 Ga0075363_100136632 3300006048 Bacteria 1378
50 Ga0075363_100372065 3300006048 Bacteria 837
51 Ga0075363_100414534 3300006048 Bacteria 792
52 Ga0075363_100590387 3300006048 Bacteria 665
53 Ga0075364_10105576 3300006051 Bacteria 1877
54 Ga0075364_10123983 3300006051 Bacteria 1731
55 Ga0075364_10218261 3300006051 Bacteria 1294
56 Ga0075367_10182857 3300006178 Bacteria 1307
57 Ga0075367_10346208 3300006178 Bacteria 938
58 Ga0075428_100443745 3300006844 Bacteria 1390
59 Ga0075431_100250364 3300006847 Bacteria 1800
60 Ga0105250_10551342 3300009092 Bacteria 529
61 Ga0111539_10378995 3300009094 Bacteria 1647
62 Ga0105245_10994558 3300009098 Bacteria 883
63 Ga0105247_10261225 3300009101 Bacteria 1187
64 Ga0105241_10925823 3300009174 Bacteria 811
65 Ga0105241_11511259 3300009174 Bacteria 647
66 Ga0105241_12165736 3300009174 Bacteria 551
67 Ga0105248_10939028 3300009177 Bacteria 977
68 Ga0105238_10150767 3300009551 Bacteria 2300
69 Ga0105238_11682668 3300009551 Bacteria 665
70 Ga0105249_10948612 3300009553 Bacteria 928
71 Ga0105239_10446608 3300010375 Bacteria 1467
72 Ga0105246_10939554 3300011119 Bacteria 778
73 Ga0157370_10417177 3300013104 Bacteria 1235
74 Ga0157370_12009223 3300013104 Bacteria 518
75 Ga0157369_11251316 3300013105 Bacteria 757
76 Ga0157372_10027163 3300013307 Bacteria 6230
77 Ga0157372_10113957 3300013307 Bacteria 3099
78 Ga0157372_10903859 3300013307 Bacteria 1024
79 Ga0157372_11108447 3300013307 Bacteria 916
80 Ga0157372_11329214 3300013307 Bacteria 829
81 Ga0157375_10516486 3300013308 Bacteria 1358
82 Ga0163163_10005786 3300014325 Bacteria 10741
83 Ga0163163_10716896 3300014325 Bacteria 1064
84 Ga0163163_10863608 3300014325 Bacteria 968
85 Ga0163163_13019114 3300014325 Bacteria 525
86 Ga0157380_10304410 3300014326 Bacteria 1470
87 Ga0157376_10642703 3300014969 Bacteria 1060
88 Ga0206351_10517125 3300020077 Bacteria 2380
89 Ga0207688_10806097 3300025901 Bacteria 595
90 Ga0207705_10393674 3300025909 Bacteria 1071
91 Ga0207705_11030600 3300025909 Bacteria 635
92 Ga0207657_10146763 3300025919 Bacteria 1924
93 Ga0207657_10419598 3300025919 Bacteria 1052
94 Ga0207652_10320046 3300025921 Bacteria 1400
95 Ga0207700_10046685 3300025928 Bacteria 3205
96 Ga0207664_10276149 3300025929 Bacteria 1473
97 Ga0207709_10189987 3300025935 Bacteria 1458
98 Ga0207679_10098953 3300025945 Bacteria 2276
99 Ga0207668_10646721 3300025972 Bacteria 925
100 Ga0207658_10270457 3300025986 Bacteria 1452
101 Ga0207658_11814385 3300025986 Bacteria 556
102 Ga0207678_10239084 3300026067 Bacteria 1555
103 Ga0207708_10100515 3300026075 Bacteria 2238
104 Ga0207708_11499394 3300026075 Bacteria 592
105 Ga0207702_11818610 3300026078 Bacteria 601
106 Ga0207641_10026948 3300026088 Bacteria 4746
107 Ga0207641_10613902 3300026088 Bacteria 1066
108 Ga0207676_10100066 3300026095 Bacteria 2401
109 Ga0207698_11070961 3300026142 Bacteria 818
110 Ga0207698_11189557 3300026142 Bacteria 776
111 Ga0207698_11328543 3300026142 Bacteria 734
112 Ga0207698_11682122 3300026142 Bacteria 650
113 Ga0268266_10079890 3300028379 Bacteria 2849
114 Ga0268264_10003157 3300028381 Bacteria 14279
115 Ga0314311_1137599 3300030733 Bacteria 828
116 Ga0265327_10000041 3300031251 Bacteria 288506
117 Ga0307408_100457526 3300031548 Bacteria 1108
118 Ga0307408_100652274 3300031548 Bacteria 941
119 Ga0307408_101546561 3300031548 Bacteria 628
120 Ga0265314_10279956 3300031711 Bacteria 944
121 Ga0307405_10022742 3300031731 Bacteria 3550
122 Ga0307405_10071369 3300031731 Bacteria 2234
123 Ga0307405_10216488 3300031731 Bacteria 1402
124 Ga0307405_10403910 3300031731 Bacteria 1070
125 Ga0307405_11076371 3300031731 Bacteria 690
126 Ga0307413_10059159 3300031824 Bacteria 2353
127 Ga0307413_10176633 3300031824 Bacteria 1518
128 Ga0307413_10180424 3300031824 Bacteria 1505
129 Ga0307413_10208915 3300031824 Bacteria 1416
130 Ga0307413_10353425 3300031824 Bacteria 1135
131 Ga0307413_11260938 3300031824 Bacteria 645
132 Ga0307410_10107921 3300031852 Bacteria 2009
133 Ga0307410_10153658 3300031852 Bacteria 1716
134 Ga0307410_10241280 3300031852 Bacteria 1400
135 Ga0307410_10308504 3300031852 Bacteria 1251
136 Ga0307410_10408682 3300031852 Bacteria 1098
137 Ga0307410_10463304 3300031852 Bacteria 1036
138 Ga0307410_10813324 3300031852 Bacteria 796
139 Ga0307410_10835446 3300031852 Bacteria 785
140 Ga0307406_10047158 3300031901 Bacteria 2714
141 Ga0307406_10175028 3300031901 Bacteria 1557
142 Ga0307406_10288441 3300031901 Bacteria 1255
143 Ga0307406_10457986 3300031901 Bacteria 1025
144 Ga0307406_11331688 3300031901 Bacteria 627
145 Ga0307407_10035312 3300031903 Bacteria 2746
146 Ga0307407_10093661 3300031903 Bacteria 1847
147 Ga0307407_10172585 3300031903 Bacteria 1426
148 Ga0307407_10659622 3300031903 Bacteria 784
149 Ga0307407_11110939 3300031903 Bacteria 615
150 Ga0307412_10173769 3300031911 Bacteria 1613
151 Ga0307409_100050667 3300031995 Bacteria 3172
152 Ga0307409_100051613 3300031995 Bacteria 3148
153 Ga0307409_100057849 3300031995 Bacteria 3007
154 Ga0307409_100114785 3300031995 Bacteria 2266
155 Ga0307409_100261934 3300031995 Bacteria 1587
156 Ga0307409_100263582 3300031995 Bacteria 1583
157 Ga0307409_100478084 3300031995 Bacteria 1208
158 Ga0307409_100528748 3300031995 Bacteria 1153
159 Ga0307409_100541868 3300031995 Bacteria 1141
160 Ga0307409_100641675 3300031995 Bacteria 1054
161 Ga0307409_100648638 3300031995 Bacteria 1049
162 Ga0307409_100805360 3300031995 Bacteria 947
163 Ga0307409_100985051 3300031995 Bacteria 860
164 Ga0307409_101081216 3300031995 Bacteria 823
165 Ga0307409_101145687 3300031995 Bacteria 800
166 Ga0307409_101205407 3300031995 Bacteria 780
167 Ga0307409_101471665 3300031995 Bacteria 708
168 Ga0307416_100014207 3300032002 Bacteria 5444
169 Ga0307416_100091103 3300032002 Bacteria 2617
170 Ga0307416_100220757 3300032002 Bacteria 1817
171 Ga0307416_100251221 3300032002 Bacteria 1721
172 Ga0307416_100310012 3300032002 Bacteria 1574
173 Ga0307416_100332751 3300032002 Bacteria 1527
174 Ga0307416_100402931 3300032002 Bacteria 1406
175 Ga0307416_100783711 3300032002 Bacteria 1048
176 Ga0307416_102180090 3300032002 Bacteria 655
177 Ga0307414_10059659 3300032004 Bacteria 2695
178 Ga0307414_10096403 3300032004 Bacteria 2213
179 Ga0307414_10170484 3300032004 Bacteria 1739
180 Ga0307414_10397082 3300032004 Bacteria 1197
181 Ga0307414_10474537 3300032004 Bacteria 1102
182 Ga0307414_11734657 3300032004 Bacteria 582
183 Ga0307411_10053590 3300032005 Bacteria 2644
184 Ga0307411_10070187 3300032005 Bacteria 2370
185 Ga0307411_10441229 3300032005 Bacteria 1086
186 Ga0307415_100035869 3300032126 Bacteria 3243
187 Ga0307415_100059932 3300032126 Bacteria 2627
188 Ga0307415_100144909 3300032126 Bacteria 1819
189 Ga0307415_100249413 3300032126 Bacteria 1441
190 Ga0307415_100351139 3300032126 Bacteria 1241
191 Ga0307415_100550858 3300032126 Bacteria 1018
192 Ga0373959_0014225 3300034820 Bacteria 1446
193 Ga0395900_0305752 3300037418 Bacteria 1575
194 Ga0395900_0779831 3300037418 Bacteria 885
195 Ga0395900_0950920 3300037418 Bacteria 781
196 Ga0436364_0889888 3300037853 Bacteria 969
197 Ga0436365_0736405 3300039437 Bacteria 863
198 Ga0439461_0010317 3300041410 Bacteria 1712
199 Ga0451789_1237956 3300041443 Bacteria 2771
200 Ga0451793_0440945 3300041452 Bacteria 633
201 Ga0451797_1534364 3300041453 Bacteria 649
202 Ga0451833_0925694 3300041491 Bacteria 851
203 Ga0451841_0143509 3300041498 Bacteria 691
204 Ga0451843_0244745 3300041509 Bacteria 598
205 Ga0439442_017516 3300042002 Bacteria 1479
206 Ga0439432_125678 3300042006 Bacteria 758
207 Ga0439446_0016075 3300042156 Bacteria 2082
208 Ga0466965_0112622 3300044683 Bacteria 1399
209 Ga0466965_0257606 3300044683 Bacteria 937
210 Ga0466965_0343884 3300044683 Bacteria 816
211 Ga0466966_0523885 3300044684 Bacteria 713
212 Ga0466966_0554696 3300044684 Bacteria 691
213 Ga0466966_0607801 3300044684 Bacteria 658
214 Ga0466961_0106731 3300044693 Bacteria 1763
215 Ga0466961_0120438 3300044693 Bacteria 1648
216 Ga0466961_0790998 3300044693 Bacteria 566
217 Ga0466963_0036024 3300044694 Bacteria 3225
218 Ga0466963_0121165 3300044694 Bacteria 1800
219 Ga0466963_0154141 3300044694 Bacteria 1596
220 Ga0466963_0161408 3300044694 Bacteria 1560
221 Ga0466963_0522360 3300044694 Bacteria 838
222 Ga0466963_0607285 3300044694 Bacteria 772
223 Ga0466964_0160633 3300044706 Bacteria 1050
224 Ga0466971_0010277 3300044719 Bacteria 4089
225 Ga0466971_0201937 3300044719 Bacteria 938
226 Ga0466971_0265659 3300044719 Bacteria 819
227 Ga0466968_0031338 3300044735 Bacteria 2206
228 Ga0466968_0440046 3300044735 Bacteria 643
229 Ga0466968_0636659 3300044735 Bacteria 541
230 Ga0466970_0049943 3300044765 Bacteria 2231
231 Ga0466970_0057697 3300044765 Bacteria 2076
232 Ga0466970_0203315 3300044765 Bacteria 1102
233 Ga0466970_0319985 3300044765 Bacteria 877
234 Ga0466957_0054865 3300044842 Bacteria 2434
235 Ga0466957_0060357 3300044842 Bacteria 2325
236 Ga0466957_0073822 3300044842 Bacteria 2114
237 Ga0466957_0330951 3300044842 Bacteria 1029
238 Ga0466957_0623255 3300044842 Bacteria 757
239 Ga0466957_1437732 3300044842 Bacteria 502
240 Ga0466960_0025073 3300044901 Bacteria 2696
241 Ga0466960_0045513 3300044901 Bacteria 2097
242 Ga0466960_0222516 3300044901 Bacteria 1039
243 Ga0466959_0055822 3300045049 Bacteria 2882
244 Ga0466959_0166791 3300045049 Bacteria 1546
245 Ga0466959_0217424 3300045049 Bacteria 1326
246 Ga0466959_0266292 3300045049 Bacteria 1179
247 Ga0466959_0352082 3300045049 Bacteria 1004
248 Ga0466958_0018854 3300045836 Bacteria 4009
249 Ga0466958_0021165 3300045836 Bacteria 3797
250 Ga0466958_0567901 3300045836 Bacteria 737
251 Ga0466967_0159500 3300045976 Bacteria 2116
252 Ga0466967_0245043 3300045976 Bacteria 1710
253 Ga0466967_0259983 3300045976 Bacteria 1661
254 Ga0466967_0263503 3300045976 Bacteria 1649
255 Ga0466967_0801082 3300045976 Bacteria 935
256 Ga0466967_1334799 3300045976 Bacteria 714
257 Ga0495653_0626428 3300046463 Bacteria 659
258 Ga0495639_0091072 3300046475 Bacteria 1431
259 Ga0495585_0343231 3300046492 Bacteria 727
260 Ga0495594_0009895 3300046499 Bacteria 4941
261 Ga0495596_0093998 3300046500 Bacteria 1164
262 Ga0495663_0398815 3300046525 Bacteria 506
263 Ga0495645_0492105 3300046543 Bacteria 768
264 Ga0495656_0268280 3300046615 Bacteria 866
265 Ga0495657_0182726 3300046675 Bacteria 1286
266 Ga0495581_0150710 3300047315 Bacteria 1358
267 Ga0495674_0596202 3300047319 Bacteria 876
268 Ga0496100_0521495 3300048903 Bacteria 917
269 Ga0496100_0708787 3300048903 Bacteria 786
270 Ga0496102_0389059 3300048905 Bacteria 1312
271 Ga0496103_0149924 3300048906 Bacteria 1494
272 Ga0496104_0328141 3300048907 Bacteria 1443
273 Ga0496105_1149469 3300048908 Bacteria 574
274 Ga0496106_1233843 3300048909 Bacteria 582
275 Ga0496108_0135025 3300048911 Bacteria 2122
276 Ga0496108_0266814 3300048911 Bacteria 1490
277 Ga0496109_0122424 3300048912 Bacteria 2424
278 Ga0496110_0395232 3300048913 Bacteria 1260
279 Ga0496111_0295393 3300048914 Bacteria 1201
280 Ga0496111_0510027 3300048914 Bacteria 885
281 Ga0496112_0010002 3300048915 Bacteria 8584
282 Ga0496112_0300183 3300048915 Bacteria 1551
283 Ga0496112_0732014 3300048915 Bacteria 916
284 Ga0496113_0148674 3300048916 Bacteria 1847
285 Ga0496114_0023405 3300048917 Bacteria 5041
286 Ga0496114_0289018 3300048917 Bacteria 1446
287 Ga0496114_0649611 3300048917 Bacteria 928
288 Ga0496114_0818044 3300048917 Bacteria 811
289 Ga0496124_0076034 3300048927 Bacteria 2773
290 Ga0496125_0043240 3300048928 Bacteria 3827
291 Ga0496126_0449219 3300048929 Bacteria 1038
292 Ga0496126_1325262 3300048929 Bacteria 523
293 Ga0501298_089930 3300049521 Bacteria 687
294 Ga0501031_0342264 3300049568 Bacteria 968
295 Ga0501034_0101627 3300049571 Bacteria 2869
296 Ga0501036_1753862 3300049572 Bacteria 500
297 Ga0501041_0277878 3300049577 Bacteria 1054
298 Ga0501042_0107163 3300049578 Bacteria 2012
299 Ga0501046_0129577 3300049580 Bacteria 1914
300 Ga0501047_0023665 3300049581 Bacteria 5897
301 Ga0501047_0331106 3300049581 Bacteria 1361
302 Ga0501048_0235427 3300049582 Bacteria 1299
303 Ga0501048_0909977 3300049582 Bacteria 633
304 Ga0501067_0095231 3300049583 Bacteria 1653
305 Ga0501067_0566708 3300049583 Bacteria 636
306 Ga0501069_0010701 3300049585 Bacteria 4863
307 Ga0501069_0128252 3300049585 Bacteria 1452
308 Ga0501069_0134976 3300049585 Bacteria 1414
309 Ga0501069_0710474 3300049585 Bacteria 607
310 Ga0501070_0014856 3300049586 Bacteria 6551
311 Ga0501070_0138915 3300049586 Bacteria 2006
312 Ga0501070_0194241 3300049586 Bacteria 1667
313 Ga0501070_0533414 3300049586 Bacteria 941
314 Ga0501070_0537258 3300049586 Bacteria 937
315 Ga0501071_0038357 3300049587 Bacteria 3424
316 Ga0501071_0296962 3300049587 Bacteria 1224
317 Ga0501072_0296428 3300049588 Bacteria 1285
318 Ga0501072_0638806 3300049588 Bacteria 838
319 Ga0501074_0071223 3300049590 Bacteria 2499
320 Ga0501075_0651911 3300049591 Bacteria 803
321 Ga0501076_0275001 3300049592 Bacteria 1379
322 Ga0501245_031946 3300049708 Bacteria 874
323 Ga0501079_0244552 3300049741 Bacteria 1402
324 Ga0501080_0275923 3300049742 Bacteria 1529
325 Ga0501080_0371245 3300049742 Bacteria 1290
326 Ga0501035_0445378 3300049822 Bacteria 1072
327 Ga0501044_0200620 3300049823 Bacteria 1953
328 Ga0501044_1605495 3300049823 Bacteria 515
329 nmdc:mga03n38_199811_c1 3300050490 Bacteria 1034
330 nmdc:mga03n38_284199_c1 3300050490 Bacteria 884
331 nmdc:mga03n38_4419_c1 3300050490 Bacteria 4657
332 nmdc:mga03n38_452747_c1 3300050490 Bacteria 714
333 nmdc:mga00v17_134908_c1 3300050491 Bacteria 1580
334 nmdc:mga00v17_485752_c1 3300050491 Bacteria 801
335 nmdc:mga00v17_87500_c1 3300050491 Bacteria 1953
336 nmdc:mga00v17_96630_c1 3300050491 Bacteria 1861
337 nmdc:mga0yw44_106486_c1 3300050492 Bacteria 1792
338 nmdc:mga0yw44_122172_c1 3300050492 Bacteria 1678
339 nmdc:mga0yw44_173476_c1 3300050492 Bacteria 1417
340 nmdc:mga0yw44_19808_c1 3300050492 Bacteria 3719
341 nmdc:mga0yw44_24693_c1 3300050492 Bacteria 3405
342 nmdc:mga0yw44_267976_c1 3300050492 Bacteria 1140
343 nmdc:mga0yw44_289072_c1 3300050492 Bacteria 1097
344 nmdc:mga06z11_470114_c1 3300050494 Bacteria 761
345 nmdc:mga06z11_88255_c1 3300050494 Bacteria 1679
346 nmdc:mga07m45_183629_c1 3300050496 Bacteria 1216
347 nmdc:mga06r32_234888_c1 3300050510 Bacteria 1821
348 Ga0500644_0000113 3300053088 Bacteria 51111
349 Ga0500568_0066277 3300053139 Bacteria 1389
350 Ga0500573_0123601 3300053140 Bacteria 1439
351 Ga0501084_0098451 3300054114 Bacteria 2456
352 Ga0501084_0835788 3300054114 Bacteria 775
353 Ga0501082_0293032 3300060353 Bacteria 1417
354 Ga0466962_0005558 3300061719 Bacteria 6051
355 Ga0466962_0044641 3300061719 Bacteria 2120
356 Ga0466962_0353427 3300061719 Bacteria 732
357 Ga0530510_0040939 3300061734 Bacteria 3345
358 Ga0530510_0474745 3300061734 Bacteria 947
359 Ga0530510_1123548 3300061734 Bacteria 602
360 2623499526 2622736605 Bacteria 4992138
361 2643826853 2643221561 Bacteria 4984412
362 2644534201 2643221696 Bacteria 5431823
363 2908814293 2908811453 Bacteria 5478616
364 2995470446 2995463766 Bacteria 8577691
365 8054611594 8054609563 Bacteria 5170090
366 Ga0439434_0004305
367 LJQas_1011885
368 LJQas_1014974
369 Ga0070658_10363368
370 Ga0070658_10738512
371 Ga0070683_100249263
372 Ga0070683_100268122
373 Ga0070683_101937983
374 Ga0070680_100885852
375 Ga0070682_100843456
376 Ga0070660_100152918
377 Ga0070667_100163275
378 Ga0070667_100276057
379 Ga0070714_100233156
380 Ga0070713_100852602
381 Ga0070701_10472619
382 Ga0070700_100327647
383 Ga0070663_100101871
384 Ga0070663_100396141
385 Ga0070663_101629134
386 Ga0070662_101256032
387 Ga0070681_10786178
388 Ga0070681_11310633
389 Ga0070679_100437350
390 Ga0070684_101620695
391 Ga0068853_101392175
392 Ga0070693_100632856
393 Ga0070665_100253484
394 Ga0070704_100487447
395 Ga0070664_100369039
396 Ga0068856_101553879
397 Ga0068856_101657908
398 Ga0070702_100436957
399 Ga0068852_100515116
400 Ga0068864_100085653
401 Ga0068863_100015224
402 Ga0068863_100702563
403 Ga0068858_100319293
404 Ga0068860_100303301
405 Ga0068860_100644688
406 Ga0081540_1033858
407 Ga0070717_10020584
408 Ga0070717_10053338
409 Ga0075365_10013963
410 Ga0075365_10865579
411 Ga0075368_10251573
412 Ga0075363_100011844
413 Ga0075363_100123592
414 Ga0075363_100136632
415 Ga0075363_100372065
416 Ga0075363_100414534
417 Ga0075363_100590387
418 Ga0075364_10105576
419 Ga0075364_10123983
420 Ga0075364_10218261
421 Ga0075367_10182857
422 Ga0075367_10346208
423 Ga0075428_100443745
424 Ga0075431_100250364
425 Ga0105250_10551342
426 Ga0111539_10378995
427 Ga0105245_10994558
428 Ga0105247_10261225
429 Ga0105241_10925823
430 Ga0105241_11511259
431 Ga0105241_12165736
432 Ga0105248_10939028
433 Ga0105238_10150767
434 Ga0105238_11682668
435 Ga0105249_10948612
436 Ga0105239_10446608
437 Ga0105246_10939554
438 Ga0157370_10417177
439 Ga0157370_12009223
440 Ga0157369_11251316
441 Ga0157372_10027163
442 Ga0157372_10113957
443 Ga0157372_10903859
444 Ga0157372_11108447
445 Ga0157372_11329214
446 Ga0157375_10516486
447 Ga0163163_10005786
448 Ga0163163_10716896
449 Ga0163163_10863608
450 Ga0163163_13019114
451 Ga0157380_10304410
452 Ga0157376_10642703
453 Ga0206351_10517125
454 Ga0207688_10806097
455 Ga0207705_10393674
456 Ga0207705_11030600
457 Ga0207657_10146763
458 Ga0207657_10419598
459 Ga0207652_10320046
460 Ga0207700_10046685
461 Ga0207664_10276149
462 Ga0207709_10189987
463 Ga0207679_10098953
464 Ga0207668_10646721
465 Ga0207658_10270457
466 Ga0207658_11814385
467 Ga0207678_10239084
468 Ga0207708_10100515
469 Ga0207708_11499394
470 Ga0207702_11818610
471 Ga0207641_10026948
472 Ga0207641_10613902
473 Ga0207676_10100066
474 Ga0207698_11070961
475 Ga0207698_11189557
476 Ga0207698_11328543
477 Ga0207698_11682122
478 Ga0268266_10079890
479 Ga0268264_10003157
480 Ga0314311_1137599
481 Ga0265327_10000041
482 Ga0307408_100457526
483 Ga0307408_100652274
484 Ga0307408_101546561
485 Ga0265314_10279956
486 Ga0307405_10022742
487 Ga0307405_10071369
488 Ga0307405_10216488
489 Ga0307405_10403910
490 Ga0307405_11076371
491 Ga0307413_10059159
492 Ga0307413_10176633
493 Ga0307413_10180424
494 Ga0307413_10208915
495 Ga0307413_10353425
496 Ga0307413_11260938
497 Ga0307410_10107921
498 Ga0307410_10153658
499 Ga0307410_10241280
500 Ga0307410_10308504
501 Ga0307410_10408682
502 Ga0307410_10463304
503 Ga0307410_10813324
504 Ga0307410_10835446
505 Ga0307406_10047158
506 Ga0307406_10175028
507 Ga0307406_10288441
508 Ga0307406_10457986
509 Ga0307406_11331688
510 Ga0307407_10035312
511 Ga0307407_10093661
512 Ga0307407_10172585
513 Ga0307407_10659622
514 Ga0307407_11110939
515 Ga0307412_10173769
516 Ga0307409_100050667
517 Ga0307409_100051613
518 Ga0307409_100057849
519 Ga0307409_100114785
520 Ga0307409_100261934
521 Ga0307409_100263582
522 Ga0307409_100478084
523 Ga0307409_100528748
524 Ga0307409_100541868
525 Ga0307409_100641675
526 Ga0307409_100648638
527 Ga0307409_100805360
528 Ga0307409_100985051
529 Ga0307409_101081216
530 Ga0307409_101145687
531 Ga0307409_101205407
532 Ga0307409_101471665
533 Ga0307416_100014207
534 Ga0307416_100091103
535 Ga0307416_100220757
536 Ga0307416_100251221
537 Ga0307416_100310012
538 Ga0307416_100332751
539 Ga0307416_100402931
540 Ga0307416_100783711
541 Ga0307416_102180090
542 Ga0307414_10059659
543 Ga0307414_10096403
544 Ga0307414_10170484
545 Ga0307414_10397082
546 Ga0307414_10474537
547 Ga0307414_11734657
548 Ga0307411_10053590
549 Ga0307411_10070187
550 Ga0307411_10441229
551 Ga0307415_100035869
552 Ga0307415_100059932
553 Ga0307415_100144909
554 Ga0307415_100249413
555 Ga0307415_100351139
556 Ga0307415_100550858
557 Ga0373959_0014225
558 Ga0395900_0305752
559 Ga0395900_0779831
560 Ga0395900_0950920
561 Ga0436364_0889888
562 Ga0436365_0736405
563 Ga0439461_0010317
564 Ga0451789_1237956
565 Ga0451793_0440945
566 Ga0451797_1534364
567 Ga0451833_0925694
568 Ga0451841_0143509
569 Ga0451843_0244745
570 Ga0439442_017516
571 Ga0439432_125678
572 Ga0439446_0016075
573 Ga0466965_0112622
574 Ga0466965_0257606
575 Ga0466965_0343884
576 Ga0466966_0523885
577 Ga0466966_0554696
578 Ga0466966_0607801
579 Ga0466961_0106731
580 Ga0466961_0120438
581 Ga0466961_0790998
582 Ga0466963_0036024
583 Ga0466963_0121165
584 Ga0466963_0154141
585 Ga0466963_0161408
586 Ga0466963_0522360
587 Ga0466963_0607285
588 Ga0466964_0160633
589 Ga0466971_0010277
590 Ga0466971_0201937
591 Ga0466971_0265659
592 Ga0466968_0031338
593 Ga0466968_0440046
594 Ga0466968_0636659
595 Ga0466970_0049943
596 Ga0466970_0057697
597 Ga0466970_0203315
598 Ga0466970_0319985
599 Ga0466957_0054865
600 Ga0466957_0060357
601 Ga0466957_0073822
602 Ga0466957_0330951
603 Ga0466957_0623255
604 Ga0466957_1437732
605 Ga0466960_0025073
606 Ga0466960_0045513
607 Ga0466960_0222516
608 Ga0466959_0055822
609 Ga0466959_0166791
610 Ga0466959_0217424
611 Ga0466959_0266292
612 Ga0466959_0352082
613 Ga0466958_0018854
614 Ga0466958_0021165
615 Ga0466958_0567901
616 Ga0466967_0159500
617 Ga0466967_0245043
618 Ga0466967_0259983
619 Ga0466967_0263503
620 Ga0466967_0801082
621 Ga0466967_1334799
622 Ga0495653_0626428
623 Ga0495639_0091072
624 Ga0495585_0343231
625 Ga0495594_0009895
626 Ga0495596_0093998
627 Ga0495663_0398815
628 Ga0495645_0492105
629 Ga0495656_0268280
630 Ga0495657_0182726
631 Ga0495581_0150710
632 Ga0495674_0596202
633 Ga0496100_0521495
634 Ga0496100_0708787
635 Ga0496102_0389059
636 Ga0496103_0149924
637 Ga0496104_0328141
638 Ga0496105_1149469
639 Ga0496106_1233843
640 Ga0496108_0135025
641 Ga0496108_0266814
642 Ga0496109_0122424
643 Ga0496110_0395232
644 Ga0496111_0295393
645 Ga0496111_0510027
646 Ga0496112_0010002
647 Ga0496112_0300183
648 Ga0496112_0732014
649 Ga0496113_0148674
650 Ga0496114_0023405
651 Ga0496114_0289018
652 Ga0496114_0649611
653 Ga0496114_0818044
654 Ga0496124_0076034
655 Ga0496125_0043240
656 Ga0496126_0449219
657 Ga0496126_1325262
658 Ga0501298_089930
659 Ga0501031_0342264
660 Ga0501034_0101627
661 Ga0501036_1753862
662 Ga0501041_0277878
663 Ga0501042_0107163
664 Ga0501046_0129577
665 Ga0501047_0023665
666 Ga0501047_0331106
667 Ga0501048_0235427
668 Ga0501048_0909977
669 Ga0501067_0095231
670 Ga0501067_0566708
671 Ga0501069_0010701
672 Ga0501069_0128252
673 Ga0501069_0134976
674 Ga0501069_0710474
675 Ga0501070_0014856
676 Ga0501070_0138915
677 Ga0501070_0194241
678 Ga0501070_0533414
679 Ga0501070_0537258
680 Ga0501071_0038357
681 Ga0501071_0296962
682 Ga0501072_0296428
683 Ga0501072_0638806
684 Ga0501074_0071223
685 Ga0501075_0651911
686 Ga0501076_0275001
687 Ga0501245_031946
688 Ga0501079_0244552
689 Ga0501080_0275923
690 Ga0501080_0371245
691 Ga0501035_0445378
692 Ga0501044_0200620
693 Ga0501044_1605495
694 nmdc:mga03n38_199811_c1
695 nmdc:mga03n38_284199_c1
696 nmdc:mga03n38_4419_c1
697 nmdc:mga03n38_452747_c1
698 nmdc:mga00v17_134908_c1
699 nmdc:mga00v17_485752_c1
700 nmdc:mga00v17_87500_c1
701 nmdc:mga00v17_96630_c1
702 nmdc:mga0yw44_106486_c1
703 nmdc:mga0yw44_122172_c1
704 nmdc:mga0yw44_173476_c1
705 nmdc:mga0yw44_19808_c1
706 nmdc:mga0yw44_24693_c1
707 nmdc:mga0yw44_267976_c1
708 nmdc:mga0yw44_289072_c1
709 nmdc:mga06z11_470114_c1
710 nmdc:mga06z11_88255_c1
711 nmdc:mga07m45_183629_c1
712 nmdc:mga06r32_234888_c1
713 Ga0500644_0000113
714 Ga0500568_0066277
715 Ga0500573_0123601
716 Ga0501084_0098451
717 Ga0501084_0835788
718 Ga0501082_0293032
719 Ga0466962_0005558
720 Ga0466962_0044641
721 Ga0466962_0353427
722 Ga0530510_0040939
723 Ga0530510_0474745
724 Ga0530510_1123548
725 2623499526
726 2643826853
727 2644534201
728 2908814293
729 2995470446
730 8054611594

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04075

F420H2_quin_red

F420H(2)-dependent quinone reductase

43

172

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r5y-assembly3.cif.gz_C structure of a deazaflavin-dependent nitroreductase from nocardia farcinica, with co-factor f420 0.9797 16 155
3r5r-assembly2.cif.gz_B structure of ddn, the deazaflavin-dependent nitroreductase from mycobacterium tuberculosis involved in bioreductive activation of pa-824, with co-factor f420 0.9712 48 155
3r5y-assembly3.cif.gz_C structure of a deazaflavin-dependent nitroreductase from nocardia farcinica, with co-factor f420 0.9661 16 155
3r5r-assembly2.cif.gz_B structure of ddn, the deazaflavin-dependent nitroreductase from mycobacterium tuberculosis involved in bioreductive activation of pa-824, with co-factor f420 0.954 48 155
4y9i-assembly1.cif.gz_A structure of f420-h2 dependent reductase (fdr-a) msmeg_2027 0.9506 48 154
ID Description Score Start End Superfamily
3r5yD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9708 15 155 2.30.110.10
af_O53328_2_119_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.966 47 155 2.30.110.10
af_P9WP15_14_151_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9618 26 155 2.30.110.10
3r5yD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9574 15 155 2.30.110.10
4y9iA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9508 48 154 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A6H3J4R1-F1-model_v4 deleted 1.001 13 157
AF-A0A4R8VWK5-F1-model_v4 deleted 1.001 13 157
AF-A0A8B4EXP6-F1-model_v4 deleted 0.9977 13 155
AF-A0A4Z1E3L0-F1-model_v4 AclJ 0.9973 13 155 GO:0005886
GO:0016491
GO:0070967
AF-A0A1H0K0Q7-F1-model_v4 Deazaflavin-dependent oxidoreductase, nitroreductase family 0.9965 13 157 GO:0005886
GO:0016491
GO:0070967

Map