F423765

General Info

Members Datasets Scaffolds Average Seq Length
365 202 269 239

Family's Representative Sequence

Representative Sequence 3300042010|Ga0439452_000037|Ga0439452_000037_96511_97350
Length 279
Sequence MSWRFIYAVWHLRFKTCIYDCRVISPHRNLEQTSMRVHFIVHESFEAPGAYESWAQQRGYQVSHSRLYAGDALPATAEAFDLLIIMGGPQDPDTTQAECPHFDARAEQALIAAAIAGGKAVIGICLGSQLIGEALGAAFAHSPEKEIGKFPITLTTAGKNHPLFAHFPETLAVGHWHNDMPGLTADAQVLAFSEGCPRQIVAYSDRVFGFQCHMELTPEVVEQLIAHSEADLSRAAQFRFVETAEALRAHDYREMNDILCQFLDKLTAYYQDATQALRH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231011 Pseudomonas sp. GM30 Isolate Nodule
3 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
4 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
5 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
6 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
7 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
8 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
9 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
10 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
11 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
12 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
13 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
14 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
15 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
16 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
17 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
18 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
19 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
20 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
21 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
22 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
23 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
24 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
25 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
26 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
27 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
28 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
29 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
30 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
31 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
32 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
33 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
34 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
35 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
36 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
37 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
38 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
39 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
40 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
41 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
42 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
43 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
44 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
45 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
46 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
47 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
48 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
49 2636415599 Klebsiella variicola DX120E Isolate Unclassified
50 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
51 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
52 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
53 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
54 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
55 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
56 2751185917 Enterobacter sp. HK169 Isolate Unclassified
57 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
58 2775507074 Klebsiella sp. D5A Isolate Unclassified
59 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
60 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
61 2821118458 Enterobacter asburiae 609 Isolate Unclassified
62 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
63 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
64 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
65 2847085930 Erwinia persicina B64 Isolate Bulb
66 2865014394 Pantoea sp. R-71966 Isolate Unclassified
67 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
68 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
69 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
70 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
71 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
72 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
73 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
74 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
75 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
76 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
77 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
78 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
79 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
80 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
81 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
82 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
83 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
84 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
85 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
86 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
87 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
88 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
89 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
90 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
91 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
92 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
93 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
94 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
95 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
96 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
97 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
98 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
99 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
100 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
101 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
102 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
103 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
104 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
105 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
106 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
107 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
108 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
111 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
112 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
113 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
125 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
128 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
135 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
147 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
150 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
151 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
155 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
156 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
157 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
158 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
159 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
160 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
161 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
166 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
167 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
170 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
171 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
172 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
173 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
174 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
175 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
176 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
177 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
178 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
185 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
198 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
199 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
200 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
201 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
202 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.7
Metatranscriptomes 0
Isolates 26.3

Biome Distribution

Category Percentage (%)
Aerial Root 0.55
Bulb 0.27
Endosphere 6.3
Nodule 2.74
Rhizoplane 12.33
Rhizosphere 45.75
Stem 0
Stem Tuber 0
Unclassified 32.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_45605 2162886007 Bacteria 4788
2 JGI25152J39213_1004754 3300002773 Bacteria 4180
3 rootH2_10008161 3300003320 Bacteria 23559
4 Ga0055526_1000827 3300003771 Bacteria 23107
5 Ga0055537_1000035 3300003773 Bacteria 96274
6 Ga0055537_1000111 3300003773 Bacteria 61884
7 Ga0055524_1026068 3300003775 Bacteria 1817
8 Ga0055534_1000268 3300003784 Bacteria 35791
9 Ga0055528_1000178 3300003790 Bacteria 53709
10 Ga0055531_10000139 3300003794 Bacteria 82993
11 Ga0058692_1000001 3300003856 Bacteria 834230
12 Ga0058692_1000728 3300003856 Bacteria 13378
13 Ga0058692_1001769 3300003856 Bacteria 7653
14 Ga0058692_1003838 3300003856 Bacteria 4567
15 Ga0058692_1006117 3300003856 Bacteria 3342
16 Ga0065714_10065231 3300005288 Bacteria 11549
17 Ga0065714_10181164 3300005288 Bacteria 962
18 Ga0065704_10003561 3300005289 Bacteria 9011
19 Ga0065704_10003739 3300005289 Bacteria 4988
20 Ga0065704_10080398 3300005289 Bacteria 3954
21 Ga0070668_100024312 3300005347 Bacteria 4588
22 Ga0070665_100108306 3300005548 Bacteria 2781
23 Ga0070665_100837026 3300005548 Bacteria 933
24 Ga0068855_100001624 3300005563 Bacteria 28194
25 Ga0068857_100000333 3300005577 Bacteria 32544
26 Ga0068851_10097069 3300005834 Bacteria 1559
27 Ga0075366_10098557 3300006195 Bacteria 1753
28 Ga0079104_1000258 3300006946 Bacteria 70651
29 Ga0079104_1003423 3300006946 Bacteria 7391
30 Ga0079104_1004931 3300006946 Bacteria 5508
31 Ga0105251_10000800 3300009011 Bacteria 28497
32 Ga0105251_10001495 3300009011 Bacteria 20074
33 Ga0105251_10005825 3300009011 Bacteria 7986
34 Ga0105251_10018142 3300009011 Bacteria 3751
35 Ga0105251_10022148 3300009011 Bacteria 3306
36 Ga0105251_10188876 3300009011 Bacteria 928
37 Ga0105251_10190530 3300009011 Bacteria 924
38 Ga0105244_10000090 3300009036 Bacteria 97171
39 Ga0105244_10001926 3300009036 Bacteria 16136
40 Ga0105244_10007690 3300009036 Bacteria 6828
41 Ga0105244_10008894 3300009036 Bacteria 6225
42 Ga0105244_10018316 3300009036 Bacteria 3931
43 Ga0105244_10025275 3300009036 Bacteria 3229
44 Ga0105250_10001458 3300009092 Bacteria 12775
45 Ga0105250_10027636 3300009092 Bacteria 2287
46 Ga0105250_10074284 3300009092 Bacteria 1375
47 Ga0105250_10126551 3300009092 Bacteria 1053
48 Ga0105243_10000002 3300009148 Bacteria 856281
49 Ga0105243_10004216 3300009148 Bacteria 11391
50 Ga0105237_10122474 3300009545 Bacteria 2595
51 Ga0105246_10098624 3300011119 Bacteria 2123
52 Ga0157373_10189598 3300013100 Bacteria 1449
53 Ga0157371_10003088 3300013102 Bacteria 15429
54 Ga0157371_10008092 3300013102 Bacteria 8407
55 Ga0157371_10010301 3300013102 Bacteria 7294
56 Ga0157371_10131570 3300013102 Bacteria 1780
57 Ga0157371_10132561 3300013102 Bacteria 1773
58 Ga0157369_10005828 3300013105 Bacteria 14327
59 Ga0157369_10006742 3300013105 Bacteria 13253
60 Ga0157369_10126687 3300013105 Bacteria 2707
61 Ga0157369_10337929 3300013105 Bacteria 1564
62 Ga0163162_10190364 3300013306 Bacteria 2179
63 Ga0157372_10000207 3300013307 Bacteria 65483
64 Ga0157372_10383761 3300013307 Bacteria 1637
65 Ga0182005_1016327 3300015265 Bacteria 2066
66 Ga0163161_10093892 3300017792 Bacteria 2223
67 Ga0163161_10102872 3300017792 Bacteria 2128
68 Ga0213872_10041713 3300021361 Bacteria 2093
69 Ga0209566_105327 3300025225 Bacteria 1630
70 Ga0209563_100671 3300025230 Bacteria 10840
71 Ga0209129_1000037 3300025258 Bacteria 326534
72 Ga0209129_1002099 3300025258 Bacteria 10201
73 Ga0209565_1000009 3300025263 Bacteria 751701
74 Ga0209673_1000036 3300025273 Bacteria 323162
75 Ga0209130_1003682 3300025284 Bacteria 6326
76 Ga0209675_1000013 3300025291 Bacteria 448220
77 Ga0209025_1005473 3300025294 Bacteria 10336
78 Ga0209564_1000122 3300025295 Bacteria 203709
79 Ga0209758_1011850 3300025297 Bacteria 4975
80 Ga0209256_1000106 3300025299 Bacteria 187258
81 Ga0209257_1000025 3300025304 Bacteria 724838
82 Ga0207656_10064116 3300025321 Bacteria 1619
83 Ga0207696_1000532 3300025711 Bacteria 31151
84 Ga0207655_1000004 3300025728 Bacteria 1021221
85 Ga0207655_1000414 3300025728 Bacteria 58652
86 Ga0207655_1002982 3300025728 Bacteria 12980
87 Ga0207655_1018145 3300025728 Bacteria 3752
88 Ga0207655_1040479 3300025728 Bacteria 2010
89 Ga0207713_1000052 3300025735 Bacteria 222663
90 Ga0207713_1000084 3300025735 Bacteria 160822
91 Ga0207713_1000911 3300025735 Bacteria 26641
92 Ga0207713_1001772 3300025735 Bacteria 16539
93 Ga0207713_1024914 3300025735 Bacteria 2775
94 Ga0207713_1025688 3300025735 Bacteria 2713
95 Ga0207713_1027517 3300025735 Bacteria 2581
96 Ga0207713_1075548 3300025735 Bacteria 1229
97 Ga0207706_10290103 3300025933 Bacteria 1426
98 Ga0207709_10000003 3300025935 Bacteria 1050072
99 Ga0207709_10037916 3300025935 Bacteria 2867
100 Ga0207709_10059499 3300025935 Bacteria 2378
101 Ga0207667_10013911 3300025949 Bacteria 9192
102 Ga0207668_10039926 3300025972 Bacteria 3163
103 Ga0207674_10000573 3300026116 Bacteria 48332
104 Ga0209281_1000014 3300027111 Bacteria 643021
105 Ga0209281_1000694 3300027111 Bacteria 34337
106 Ga0209281_1000749 3300027111 Bacteria 31356
107 Ga0209371_1000001 3300027312 Bacteria 2771503
108 Ga0209371_1000008 3300027312 Bacteria 1024606
109 Ga0209371_1000015 3300027312 Bacteria 659640
110 Ga0209371_1000206 3300027312 Bacteria 84144
111 Ga0209371_1001282 3300027312 Bacteria 17695
112 Ga0209371_1001555 3300027312 Bacteria 15130
113 Ga0209371_1015048 3300027312 Bacteria 2096
114 Ga0209371_1025945 3300027312 Bacteria 1340
115 Ga0268266_10230715 3300028379 Bacteria 1705
116 Ga0268266_10754289 3300028379 Bacteria 939
117 Ga0268256_1000001 3300030500 Bacteria 2771065
118 Ga0268256_1000009 3300030500 Bacteria 1022625
119 Ga0268256_1000018 3300030500 Bacteria 594572
120 Ga0268256_1000241 3300030500 Bacteria 57706
121 Ga0268256_1000572 3300030500 Bacteria 29655
122 Ga0268256_1001329 3300030500 Bacteria 15134
123 Ga0268256_1016663 3300030500 Bacteria 2096
124 Ga0268256_1033340 3300030500 Bacteria 1217
125 Ga0307507_10033000 3300033179 Bacteria 5386
126 Ga0316584_0056435 3300036712 Unclassified 2940
127 Ga0395900_0019439 3300037418 Bacteria 6925
128 Ga0395905_0222105 3300037471 Unclassified 1768
129 Ga0436361_0257013 3300039447 Bacteria 9304
130 Ga0439438_000075 3300041405 Bacteria 46559
131 Ga0439438_000279 3300041405 Bacteria 22963
132 Ga0439438_003733 3300041405 Bacteria 6045
133 Ga0439438_008230 3300041405 Bacteria 3481
134 Ga0439447_000370 3300041407 Bacteria 16339
135 Ga0439466_0001766 3300041411 Bacteria 8455
136 Ga0439432_009716 3300042006 Bacteria 3345
137 Ga0439432_034315 3300042006 Bacteria 1629
138 Ga0439452_000037 3300042010 Bacteria 150659
139 Ga0439464_0008035 3300042439 Bacteria 2767
140 Ga0466981_0000003 3300044669 Bacteria 248458
141 Ga0453684_0218252 3300044712 Bacteria 2211
142 Ga0495590_0000715 3300046457 Bacteria 15153
143 Ga0495590_0001370 3300046457 Bacteria 10593
144 Ga0495638_0003671 3300046460 Bacteria 11955
145 Ga0495650_0004533 3300046471 Bacteria 9487
146 Ga0495584_0016819 3300046491 Bacteria 3728
147 Ga0495607_0000259 3300046501 Bacteria 56558
148 Ga0495607_0000686 3300046501 Bacteria 32666
149 Ga0495606_0025332 3300046507 Bacteria 4251
150 Ga0495610_0000437 3300046512 Bacteria 42948
151 Ga0495616_0000156 3300046513 Bacteria 59558
152 Ga0495637_0001229 3300046520 Bacteria 15531
153 Ga0495654_0002777 3300046530 Bacteria 11034
154 Ga0495654_0007160 3300046530 Bacteria 6262
155 Ga0495654_0019684 3300046530 Bacteria 3528
156 Ga0495597_0001721 3300046542 Bacteria 15108
157 Ga0495671_0004862 3300046692 Bacteria 7947
158 Ga0495660_0007494 3300046810 Bacteria 6406
159 Ga0495660_0008905 3300046810 Bacteria 5866
160 Ga0495672_0000009 3300047320 Bacteria 557755
161 Ga0495672_0000037 3300047320 Bacteria 278588
162 Ga0495679_027137 3300047446 Bacteria 1894
163 Ga0495679_032251 3300047446 Bacteria 1682
164 Ga0495681_0000109 3300047470 Bacteria 71558
165 Ga0496104_0000385 3300048907 Bacteria 38635
166 Ga0496105_0015233 3300048908 Bacteria 6123
167 Ga0496105_0033175 3300048908 Bacteria 4239
168 Ga0496116_0000073 3300048919 Bacteria 237590
169 Ga0496116_0002044 3300048919 Bacteria 21624
170 Ga0496116_0012729 3300048919 Bacteria 6842
171 Ga0496116_0066349 3300048919 Bacteria 2309
172 Ga0496116_0085731 3300048919 Bacteria 1935
173 Ga0496117_0000624 3300048920 Bacteria 57349
174 Ga0496117_0001145 3300048920 Bacteria 39906
175 Ga0496117_0012245 3300048920 Bacteria 7585
176 Ga0496117_0012974 3300048920 Bacteria 7298
177 Ga0496117_0025021 3300048920 Bacteria 4702
178 Ga0496117_0071438 3300048920 Bacteria 2325
179 Ga0496117_0116980 3300048920 Bacteria 1646
180 Ga0496117_0120114 3300048920 Bacteria 1616
181 Ga0496118_0001021 3300048921 Bacteria 43537
182 Ga0496118_0005871 3300048921 Bacteria 13756
183 Ga0496118_0013305 3300048921 Bacteria 7795
184 Ga0496118_0073552 3300048921 Bacteria 2447
185 Ga0496118_0083986 3300048921 Bacteria 2224
186 Ga0496118_0109948 3300048921 Bacteria 1832
187 Ga0496118_0279695 3300048921 Bacteria 929
188 Ga0496118_0283588 3300048921 Bacteria 920
189 Ga0496119_0000013 3300048922 Bacteria 323820
190 Ga0496119_0004545 3300048922 Bacteria 13747
191 Ga0496119_0011998 3300048922 Bacteria 7093
192 Ga0496119_0031020 3300048922 Bacteria 3591
193 Ga0496119_0034563 3300048922 Bacteria 3325
194 Ga0496119_0086401 3300048922 Bacteria 1792
195 Ga0496120_0000026 3300048923 Bacteria 235131
196 Ga0496120_0001499 3300048923 Bacteria 27638
197 Ga0496120_0005227 3300048923 Bacteria 10438
198 Ga0496120_0005709 3300048923 Bacteria 9818
199 Ga0496120_0016028 3300048923 Bacteria 4913
200 Ga0496120_0018001 3300048923 Bacteria 4564
201 Ga0496120_0029137 3300048923 Bacteria 3372
202 Ga0496120_0207152 3300048923 Bacteria 945
203 Ga0496120_0223405 3300048923 Bacteria 898
204 Ga0496121_0000055 3300048924 Bacteria 304572
205 Ga0496121_0012570 3300048924 Bacteria 9209
206 Ga0496121_0013774 3300048924 Bacteria 8656
207 Ga0496121_0027839 3300048924 Bacteria 5278
208 Ga0496121_0056126 3300048924 Bacteria 3274
209 Ga0496121_0097149 3300048924 Unclassified 2283
210 Ga0496121_0195286 3300048924 Unclassified 1447
211 Ga0496122_0000409 3300048925 Bacteria 91249
212 Ga0496122_0007744 3300048925 Bacteria 11817
213 Ga0496122_0014459 3300048925 Bacteria 7628
214 Ga0496122_0015209 3300048925 Bacteria 7365
215 Ga0496122_0016996 3300048925 Bacteria 6833
216 Ga0496122_0022061 3300048925 Bacteria 5672
217 Ga0496122_0030077 3300048925 Bacteria 4560
218 Ga0496122_0030898 3300048925 Bacteria 4474
219 Ga0496122_0047998 3300048925 Bacteria 3289
220 Ga0496122_0106195 3300048925 Bacteria 1859
221 Ga0496122_0196889 3300048925 Bacteria 1182
222 Ga0496122_0351289 3300048925 Bacteria 769
223 Ga0496123_0000334 3300048926 Bacteria 89471
224 Ga0496123_0002199 3300048926 Bacteria 24807
225 Ga0496123_0004052 3300048926 Bacteria 15790
226 Ga0496123_0008144 3300048926 Bacteria 9677
227 Ga0496123_0024064 3300048926 Bacteria 4640
228 Ga0496123_0068856 3300048926 Bacteria 2226
229 Ga0496123_0087247 3300048926 Bacteria 1867
230 Ga0496123_0154506 3300048926 Bacteria 1232
231 Ga0496123_0190235 3300048926 Bacteria 1062
232 Ga0496123_0210563 3300048926 Bacteria 988
233 Ga0496124_0000060 3300048927 Bacteria 239933
234 Ga0496124_0000611 3300048927 Bacteria 60081
235 Ga0496124_0006982 3300048927 Bacteria 12112
236 Ga0496124_0034364 3300048927 Bacteria 4451
237 Ga0496124_0039674 3300048927 Bacteria 4078
238 Ga0496124_0129347 3300048927 Bacteria 2008
239 Ga0496124_0133705 3300048927 Bacteria 1966
240 Ga0496124_0169281 3300048927 Bacteria 1694
241 Ga0496124_0190108 3300048927 Bacteria 1572
242 Ga0496124_0398829 3300048927 Bacteria 955
243 Ga0496124_0494892 3300048927 Bacteria 821
244 Ga0496125_0000253 3300048928 Bacteria 109929
245 Ga0496125_0002641 3300048928 Bacteria 22925
246 Ga0496125_0002762 3300048928 Bacteria 22212
247 Ga0496125_0013114 3300048928 Bacteria 8171
248 Ga0496125_0034259 3300048928 Bacteria 4478
249 Ga0496125_0034491 3300048928 Bacteria 4460
250 Ga0496125_0125140 3300048928 Bacteria 1823
251 Ga0496125_0224869 3300048928 Bacteria 1205
252 Ga0496126_0000313 3300048929 Bacteria 103014
253 Ga0496126_0004089 3300048929 Bacteria 17673
254 Ga0496126_0012235 3300048929 Bacteria 8802
255 Ga0496126_0014195 3300048929 Bacteria 8061
256 Ga0496126_0038825 3300048929 Bacteria 4426
257 Ga0496126_0053862 3300048929 Bacteria 3647
258 Ga0496126_0090174 3300048929 Bacteria 2697
259 Ga0496126_0138644 3300048929 Bacteria 2095
260 Ga0496126_0259819 3300048929 Bacteria 1444
261 Ga0496126_0583716 3300048929 Bacteria 882
262 Ga0495682_0000427 3300049460 Bacteria 29525
263 Ga0501031_0146152 3300049568 Bacteria 1545
264 Ga0501031_0224514 3300049568 Bacteria 1223
265 Ga0501034_0300847 3300049571 Bacteria 1541
266 Ga0501034_0334160 3300049571 Bacteria 1446
267 Ga0501037_0026522 3300049573 Bacteria 4283
268 Ga0501035_0597134 3300049822 Bacteria 900
269 nmdc:mga0k408_4824_c1 3300050493 Bacteria 7152

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048924 Ga0496121_0097149 Ga0496121_0097149_999_1568 189
2 3300044712 Ga0453684_0218252 Ga0453684_0218252_1268_1963 229
3 iso_pu_bacteria 2547132416 2548649455 230
4 iso_pu_bacteria 2916178963 2916182054 230
5 iso_pu_bacteria 2554235234 2555259956 231
6 iso_pu_bacteria 2919108558 2919111072 231
7 iso_pu_bacteria 2971820967 2971822394 231
8 3300017792 Ga0163161_10102872 Ga0163161_101028722 232
9 3300037418 Ga0395900_0019439 Ga0395900_0019439_552_1253 232
10 3300037471 Ga0395905_0222105 Ga0395905_0222105_405_1106 232
11 iso_pu_bacteria 2602042047 2603644943 232
12 iso_pu_bacteria 2602042067 2603705275 232
13 iso_pu_bacteria 2775506706 2775541400 232
14 iso_pu_bacteria 2821118458 2821120947 232
15 3300041405 Ga0439438_000075 Ga0439438_000075_5276_5977 233
16 3300049568 Ga0501031_0224514 Ga0501031_0224514_322_1041 233
17 3300003771 Ga0055526_1000827 Ga0055526_100082714 234
18 3300003773 Ga0055537_1000035 Ga0055537_100003589 234
19 3300003773 Ga0055537_1000111 Ga0055537_10001115 234
20 3300003775 Ga0055524_1026068 Ga0055524_10260682 234
21 3300003784 Ga0055534_1000268 Ga0055534_100026812 234
22 3300003790 Ga0055528_1000178 Ga0055528_100017847 234
23 3300005563 Ga0068855_100001624 Ga0068855_1000016245 234
24 3300009036 Ga0105244_10000090 Ga0105244_100000909 234
25 3300025263 Ga0209565_1000009 Ga0209565_1000009594 234
26 3300025273 Ga0209673_1000036 Ga0209673_100003688 234
27 3300025291 Ga0209675_1000013 Ga0209675_100001388 234
28 3300025295 Ga0209564_1000122 Ga0209564_100012288 234
29 3300025299 Ga0209256_1000106 Ga0209256_100010687 234
30 3300025728 Ga0207655_1000004 Ga0207655_1000004145 234
31 3300025949 Ga0207667_10013911 Ga0207667_1001391114 234
32 3300046457 Ga0495590_0000715 Ga0495590_0000715_9865_10569 234
33 3300046491 Ga0495584_0016819 Ga0495584_0016819_522_1226 234
34 3300046507 Ga0495606_0025332 Ga0495606_0025332_2829_3533 234
35 3300046520 Ga0495637_0001229 Ga0495637_0001229_4960_5664 234
36 3300046530 Ga0495654_0019684 Ga0495654_0019684_2337_3041 234
37 3300046542 Ga0495597_0001721 Ga0495597_0001721_4557_5261 234
38 3300048922 Ga0496119_0011998 Ga0496119_0011998_1393_2097 234
39 3300048925 Ga0496122_0016996 Ga0496122_0016996_1393_2097 234
40 3300048926 Ga0496123_0190235 Ga0496123_0190235_114_818 234
41 3300049571 Ga0501034_0334160 Ga0501034_0334160_224_946 234
42 3300049573 Ga0501037_0026522 Ga0501037_0026522_2519_3241 234
43 iso_pu_bacteria 2602042109 2603867778 234
44 iso_pu_bacteria 2681812866 2681996315 234
45 iso_pu_bacteria 2751185917 2753856823 234
46 iso_pu_bacteria 2881359912 2881360118 234
47 iso_pu_bacteria 2927833300 2927837766 234
48 iso_pu_bacteria 2939573065 2939575479 234
49 3300009011 Ga0105251_10001495 Ga0105251_100014956 235
50 3300009011 Ga0105251_10022148 Ga0105251_100221484 235
51 3300025735 Ga0207713_1000052 Ga0207713_100005275 235
52 iso_pu_bacteria 2600255292 2601672260 235
53 iso_pu_bacteria 2609459761 2609913537 235
54 iso_pu_bacteria 2738543004 2739199837 235
55 iso_pu_bacteria 2751185905 2753808440 235
56 iso_pu_bacteria 2808606359 2808848385 235
57 iso_pu_bacteria 2932410948 2932416346 235
58 iso_pu_bacteria 2932416698 2932422261 235
59 iso_pu_bacteria 2939602548 2939603536 235
60 iso_pu_bacteria 2945874760 2945877629 235
61 iso_pu_bacteria 8056131705 8056134937 235
62 3300003856 Ga0058692_1000728 Ga0058692_100072812 236
63 3300006195 Ga0075366_10098557 Ga0075366_100985573 236
64 3300009092 Ga0105250_10074284 Ga0105250_100742841 236
65 3300025735 Ga0207713_1000911 Ga0207713_100091114 236
66 3300025735 Ga0207713_1001772 Ga0207713_100177210 236
67 3300025935 Ga0207709_10037916 Ga0207709_100379163 236
68 3300027312 Ga0209371_1000001 Ga0209371_10000012247 236
69 3300030500 Ga0268256_1000001 Ga0268256_1000001393 236
70 3300044669 Ga0466981_0000003 Ga0466981_0000003_192329_193039 236
71 3300048907 Ga0496104_0000385 Ga0496104_0000385_5817_6527 236
72 3300048908 Ga0496105_0015233 Ga0496105_0015233_1467_2177 236
73 3300048919 Ga0496116_0085731 Ga0496116_0085731_994_1704 236
74 3300048920 Ga0496117_0116980 Ga0496117_0116980_11_721 236
75 3300048920 Ga0496117_0120114 Ga0496117_0120114_582_1292 236
76 3300048921 Ga0496118_0005871 Ga0496118_0005871_4107_4817 236
77 3300048922 Ga0496119_0004545 Ga0496119_0004545_10648_11358 236
78 3300048923 Ga0496120_0001499 Ga0496120_0001499_7001_7711 236
79 3300048923 Ga0496120_0018001 Ga0496120_0018001_3653_4363 236
80 3300048925 Ga0496122_0007744 Ga0496122_0007744_10868_11578 236
81 3300048925 Ga0496122_0030077 Ga0496122_0030077_198_908 236
82 3300048925 Ga0496122_0351289 Ga0496122_0351289_17_727 236
83 3300048926 Ga0496123_0004052 Ga0496123_0004052_4886_5596 236
84 3300048926 Ga0496123_0154506 Ga0496123_0154506_198_908 236
85 3300048926 Ga0496123_0210563 Ga0496123_0210563_198_908 236
86 3300048927 Ga0496124_0398829 Ga0496124_0398829_48_758 236
87 3300048927 Ga0496124_0494892 Ga0496124_0494892_10_720 236
88 3300048928 Ga0496125_0002641 Ga0496125_0002641_9611_10321 236
89 3300048928 Ga0496125_0013114 Ga0496125_0013114_3653_4363 236
90 3300048929 Ga0496126_0583716 Ga0496126_0583716_130_840 236
91 3300050493 nmdc:mga0k408_4824_c1 nmdc:mga0k408_4824_c1_4859_5569 236
92 iso_pu_bacteria 2523231067 2523470675 236
93 iso_pu_bacteria 2551306352 2552746967 236
94 iso_pu_bacteria 2968558590 2968560926 236
95 iso_pu_bacteria 8055592153 8055595301 236
96 iso_pu_bacteria 2593339239 2595452191 237
97 iso_pu_bacteria 2599185169 2599409286 237
98 iso_pu_bacteria 2600255254 2601522205 237
99 iso_pu_bacteria 2600255255 2601527230 237
100 iso_pu_bacteria 2600255280 2601614060 237
101 iso_pu_bacteria 2600255281 2601618783 237
102 iso_pu_bacteria 2600255287 2601642612 237
103 iso_pu_bacteria 2600255288 2601647460 237
104 iso_pu_bacteria 2600255289 2601652208 237
105 iso_pu_bacteria 2600255290 2601657535 237
106 iso_pu_bacteria 2600255291 2601662433 237
107 iso_pu_bacteria 2600255298 2601695390 237
108 iso_pu_bacteria 2600255299 2601700066 237
109 iso_pu_bacteria 2600255300 2601705332 237
110 iso_pu_bacteria 2600255301 2601710361 237
111 iso_pu_bacteria 2600255302 2601715373 237
112 iso_pu_bacteria 2600255303 2601720417 237
113 iso_pu_bacteria 2600255304 2601725779 237
114 iso_pu_bacteria 2600255305 2601730321 237
115 iso_pu_bacteria 2600255306 2601735338 237
116 iso_pu_bacteria 2600255307 2601740038 237
117 iso_pu_bacteria 2600255309 2601750527 237
118 iso_pu_bacteria 2600255392 2602017780 237
119 iso_pu_bacteria 2602042052 2603659803 237
120 iso_pu_bacteria 2602042053 2603665079 237
121 iso_pu_bacteria 2602042103 2603837709 237
122 iso_pu_bacteria 2602042104 2603842785 237
123 iso_pu_bacteria 2602042105 2603847858 237
124 iso_pu_bacteria 2602042106 2603852929 237
125 iso_pu_bacteria 2602042110 2603870982 237
126 iso_pu_bacteria 2602042111 2603875896 237
127 iso_pu_bacteria 2603880178 2606048173 237
128 iso_pu_bacteria 2603880184 2606069509 237
129 iso_pu_bacteria 2603880202 2606145321 237
130 iso_pu_bacteria 2603880211 2606175575 237
131 iso_pu_bacteria 2636415599 2637225188 237
132 iso_pu_bacteria 2675903046 2676406430 237
133 iso_pu_bacteria 2775507074 2777022805 237
134 iso_pu_bacteria 2844528606 2844529541 237
135 iso_pu_bacteria 2847085930 2847088751 237
136 iso_pu_bacteria 2865014394 2865014617 237
137 iso_pu_bacteria 2904513164 2904513925 237
138 iso_pu_bacteria 2908669403 2908673721 237
139 iso_pu_bacteria 2961170736 2961175820 237
140 iso_pu_bacteria 2969079654 2969082182 237
141 iso_pu_bacteria 2970503327 2970508485 237
142 iso_pu_bacteria 2979808191 2979811866 237
143 iso_pu_bacteria 2984559226 2984564626 237
144 iso_pu_bacteria 2984595703 2984597355 237
145 iso_pu_bacteria 3007395558 3007397028 237
146 3300003856 Ga0058692_1001769 Ga0058692_10017693 238
147 3300005288 Ga0065714_10065231 Ga0065714_100652314 238
148 3300005289 Ga0065704_10003561 Ga0065704_100035617 238
149 3300005577 Ga0068857_100000333 Ga0068857_10000033314 238
150 3300005834 Ga0068851_10097069 Ga0068851_100970692 238
151 3300006946 Ga0079104_1000258 Ga0079104_100025865 238
152 3300006946 Ga0079104_1003423 Ga0079104_10034232 238
153 3300006946 Ga0079104_1004931 Ga0079104_10049314 238
154 3300009011 Ga0105251_10000800 Ga0105251_100008007 238
155 3300009011 Ga0105251_10188876 Ga0105251_101888761 238
156 3300009011 Ga0105251_10190530 Ga0105251_101905301 238
157 3300009036 Ga0105244_10001926 Ga0105244_1000192613 238
158 3300009092 Ga0105250_10001458 Ga0105250_100014585 238
159 3300009148 Ga0105243_10004216 Ga0105243_1000421613 238
160 3300013102 Ga0157371_10008092 Ga0157371_100080923 238
161 3300013102 Ga0157371_10132561 Ga0157371_101325612 238
162 3300025321 Ga0207656_10064116 Ga0207656_100641162 238
163 3300025711 Ga0207696_1000532 Ga0207696_100053224 238
164 3300025728 Ga0207655_1040479 Ga0207655_10404792 238
165 3300025735 Ga0207713_1000084 Ga0207713_100008446 238
166 3300025735 Ga0207713_1025688 Ga0207713_10256882 238
167 3300025735 Ga0207713_1027517 Ga0207713_10275171 238
168 3300025935 Ga0207709_10059499 Ga0207709_100594993 238
169 3300026116 Ga0207674_10000573 Ga0207674_1000057325 238
170 3300027111 Ga0209281_1000014 Ga0209281_1000014249 238
171 3300027111 Ga0209281_1000694 Ga0209281_10006948 238
172 3300027111 Ga0209281_1000749 Ga0209281_100074926 238
173 3300027312 Ga0209371_1001282 Ga0209371_10012823 238
174 3300027312 Ga0209371_1015048 Ga0209371_10150483 238
175 3300030500 Ga0268256_1000572 Ga0268256_100057225 238
176 3300030500 Ga0268256_1016663 Ga0268256_10166633 238
177 3300042006 Ga0439432_034315 Ga0439432_034315_301_1017 238
178 3300046512 Ga0495610_0000437 Ga0495610_0000437_6202_7014 238
179 3300047446 Ga0495679_032251 Ga0495679_032251_613_1329 238
180 3300048920 Ga0496117_0012245 Ga0496117_0012245_1290_2006 238
181 3300048921 Ga0496118_0279695 Ga0496118_0279695_80_796 238
182 3300048922 Ga0496119_0031020 Ga0496119_0031020_1207_1923 238
183 3300048922 Ga0496119_0086401 Ga0496119_0086401_710_1426 238
184 3300048923 Ga0496120_0005227 Ga0496120_0005227_1314_2030 238
185 3300048923 Ga0496120_0207152 Ga0496120_0207152_21_737 238
186 3300048923 Ga0496120_0223405 Ga0496120_0223405_162_878 238
187 3300048924 Ga0496121_0012570 Ga0496121_0012570_5695_6411 238
188 3300048924 Ga0496121_0013774 Ga0496121_0013774_2872_3588 238
189 3300048925 Ga0496122_0015209 Ga0496122_0015209_5802_6518 238
190 3300048925 Ga0496122_0022061 Ga0496122_0022061_1290_2006 238
191 3300048925 Ga0496122_0047998 Ga0496122_0047998_2357_3073 238
192 3300048925 Ga0496122_0106195 Ga0496122_0106195_22_738 238
193 3300048926 Ga0496123_0002199 Ga0496123_0002199_5571_6287 238
194 3300048926 Ga0496123_0008144 Ga0496123_0008144_2357_3073 238
195 3300048926 Ga0496123_0068856 Ga0496123_0068856_963_1679 238
196 3300048927 Ga0496124_0000611 Ga0496124_0000611_36608_37324 238
197 3300048927 Ga0496124_0006982 Ga0496124_0006982_7719_8435 238
198 3300048927 Ga0496124_0129347 Ga0496124_0129347_1024_1740 238
199 3300048927 Ga0496124_0133705 Ga0496124_0133705_48_764 238
200 3300048927 Ga0496124_0190108 Ga0496124_0190108_843_1559 238
201 3300048928 Ga0496125_0002762 Ga0496125_0002762_3128_3844 238
202 3300048928 Ga0496125_0034259 Ga0496125_0034259_3551_4267 238
203 3300048929 Ga0496126_0053862 Ga0496126_0053862_2056_2772 238
204 3300048929 Ga0496126_0090174 Ga0496126_0090174_1453_2169 238
205 3300048929 Ga0496126_0138644 Ga0496126_0138644_18_734 238
206 3300048929 Ga0496126_0259819 Ga0496126_0259819_431_1147 238
207 iso_pu_bacteria 2511231011 2511293170 238
208 iso_pu_bacteria 2738543031 2739351992 238
209 iso_pu_bacteria 2818991456 2819657916 238
210 iso_pu_bacteria 2826581358 2826584400 238
211 iso_pu_bacteria 2842849001 2842849412 238
212 iso_pu_bacteria 2884086401 2884087740 238
213 iso_pu_bacteria 2919497567 2919498070 238
214 iso_pu_bacteria 3007419365 3007421742 238
215 3300005288 Ga0065714_10181164 Ga0065714_101811641 239
216 3300013102 Ga0157371_10010301 Ga0157371_100103012 239
217 3300013105 Ga0157369_10005828 Ga0157369_100058285 239
218 3300025225 Ga0209566_105327 Ga0209566_1053271 239
219 3300025284 Ga0209130_1003682 Ga0209130_10036823 239
220 3300025294 Ga0209025_1005473 Ga0209025_10054733 239
221 3300027312 Ga0209371_1025945 Ga0209371_10259452 239
222 3300030500 Ga0268256_1033340 Ga0268256_10333402 239
223 3300048919 Ga0496116_0000073 Ga0496116_0000073_51502_52221 239
224 3300048921 Ga0496118_0083986 Ga0496118_0083986_604_1323 239
225 3300048924 Ga0496121_0027839 Ga0496121_0027839_701_1420 239
226 3300048924 Ga0496121_0195286 Ga0496121_0195286_702_1421 239
227 3300048925 Ga0496122_0000409 Ga0496122_0000409_5230_5949 239
228 3300048926 Ga0496123_0000334 Ga0496123_0000334_83058_83777 239
229 3300048927 Ga0496124_0034364 Ga0496124_0034364_1353_2072 239
230 3300048928 Ga0496125_0000253 Ga0496125_0000253_50493_51212 239
231 3300048929 Ga0496126_0012235 Ga0496126_0012235_1541_2260 239
232 iso_pu_bacteria 2585427591 2585829253 239
233 iso_pu_bacteria 2585427592 2585834035 239
234 iso_pu_bacteria 2721755487 2722730018 239
235 iso_pu_bacteria 2935625433 2935625694 239
236 iso_pu_bacteria 2939617950 2939618562 239
237 iso_pu_bacteria 2974435778 2974439362 239
238 iso_pu_bacteria 8019504834 8019505100 239
239 iso_pu_bacteria 8056137416 8056139651 239
240 3300003320 rootH2_10008161 rootH2_1000816118 240
241 3300003794 Ga0055531_10000139 Ga0055531_1000013950 240
242 3300003856 Ga0058692_1000001 Ga0058692_1000001218 240
243 3300005548 Ga0070665_100108306 Ga0070665_1001083061 240
244 3300009011 Ga0105251_10018142 Ga0105251_100181421 240
245 3300009036 Ga0105244_10007690 Ga0105244_100076909 240
246 3300009036 Ga0105244_10008894 Ga0105244_1000889410 240
247 3300009092 Ga0105250_10126551 Ga0105250_101265511 240
248 3300009545 Ga0105237_10122474 Ga0105237_101224742 240
249 3300025304 Ga0209257_1000025 Ga0209257_100002555 240
250 3300025728 Ga0207655_1000414 Ga0207655_100041435 240
251 3300025728 Ga0207655_1002982 Ga0207655_100298218 240
252 3300025735 Ga0207713_1075548 Ga0207713_10755481 240
253 3300027312 Ga0209371_1000008 Ga0209371_1000008350 240
254 3300028379 Ga0268266_10230715 Ga0268266_102307153 240
255 3300030500 Ga0268256_1000009 Ga0268256_1000009350 240
256 3300033179 Ga0307507_10033000 Ga0307507_100330003 240
257 3300048924 Ga0496121_0000055 Ga0496121_0000055_166095_166817 240
258 3300048929 Ga0496126_0014195 Ga0496126_0014195_7279_8001 240
259 3300005347 Ga0070668_100024312 Ga0070668_1000243124 241
260 3300005548 Ga0070665_100837026 Ga0070665_1008370262 241
261 3300009011 Ga0105251_10005825 Ga0105251_100058259 241
262 3300009036 Ga0105244_10025275 Ga0105244_100252752 241
263 3300011119 Ga0105246_10098624 Ga0105246_100986243 241
264 3300013100 Ga0157373_10189598 Ga0157373_101895982 241
265 3300013102 Ga0157371_10003088 Ga0157371_100030887 241
266 3300013105 Ga0157369_10126687 Ga0157369_101266871 241
267 3300013105 Ga0157369_10337929 Ga0157369_103379291 241
268 3300013306 Ga0163162_10190364 Ga0163162_101903642 241
269 3300013307 Ga0157372_10383761 Ga0157372_103837612 241
270 3300017792 Ga0163161_10093892 Ga0163161_100938922 241
271 3300025258 Ga0209129_1002099 Ga0209129_100209911 241
272 3300025297 Ga0209758_1011850 Ga0209758_10118504 241
273 3300025728 Ga0207655_1018145 Ga0207655_10181453 241
274 3300025735 Ga0207713_1024914 Ga0207713_10249143 241
275 3300025933 Ga0207706_10290103 Ga0207706_102901032 241
276 3300025972 Ga0207668_10039926 Ga0207668_100399264 241
277 3300027312 Ga0209371_1000206 Ga0209371_100020651 241
278 3300027312 Ga0209371_1001555 Ga0209371_10015558 241
279 3300028379 Ga0268266_10754289 Ga0268266_107542892 241
280 3300030500 Ga0268256_1000241 Ga0268256_100024136 241
281 3300030500 Ga0268256_1001329 Ga0268256_10013298 241
282 3300041405 Ga0439438_000279 Ga0439438_000279_21718_22443 241
283 3300041405 Ga0439438_003733 Ga0439438_003733_1444_2169 241
284 3300041411 Ga0439466_0001766 Ga0439466_0001766_4249_4974 241
285 3300042006 Ga0439432_009716 Ga0439432_009716_1483_2208 241
286 3300042439 Ga0439464_0008035 Ga0439464_0008035_862_1587 241
287 3300046810 Ga0495660_0007494 Ga0495660_0007494_3646_4371 241
288 3300047320 Ga0495672_0000037 Ga0495672_0000037_166845_167570 241
289 3300047446 Ga0495679_027137 Ga0495679_027137_11_736 241
290 3300048919 Ga0496116_0012729 Ga0496116_0012729_4888_5613 241
291 3300048920 Ga0496117_0071438 Ga0496117_0071438_892_1617 241
292 3300048921 Ga0496118_0073552 Ga0496118_0073552_709_1434 241
293 3300048922 Ga0496119_0034563 Ga0496119_0034563_976_1701 241
294 3300048923 Ga0496120_0029137 Ga0496120_0029137_1924_2649 241
295 3300048924 Ga0496121_0056126 Ga0496121_0056126_2436_3161 241
296 3300048927 Ga0496124_0039674 Ga0496124_0039674_915_1640 241
297 3300048929 Ga0496126_0004089 Ga0496126_0004089_6928_7653 241
298 3300048929 Ga0496126_0038825 Ga0496126_0038825_1526_2251 241
299 3300021361 Ga0213872_10041713 Ga0213872_100417132 242
300 3300025230 Ga0209563_100671 Ga0209563_1006716 242
301 3300036712 Ga0316584_0056435 Ga0316584_0056435_1973_2701 242
302 3300039447 Ga0436361_0257013 Ga0436361_0257013_171_899 242
303 3300046457 Ga0495590_0001370 Ga0495590_0001370_4531_5259 242
304 3300046460 Ga0495638_0003671 Ga0495638_0003671_8394_9122 242
305 3300046471 Ga0495650_0004533 Ga0495650_0004533_3249_3977 242
306 3300046501 Ga0495607_0000259 Ga0495607_0000259_5269_5997 242
307 3300046530 Ga0495654_0002777 Ga0495654_0002777_7092_7820 242
308 3300049568 Ga0501031_0146152 Ga0501031_0146152_523_1251 242
309 3300002773 JGI25152J39213_1004754 JGI25152J39213_10047544 243
310 3300003856 Ga0058692_1003838 Ga0058692_10038382 243
311 3300003856 Ga0058692_1006117 Ga0058692_10061174 243
312 3300005289 Ga0065704_10003739 Ga0065704_100037391 243
313 3300005289 Ga0065704_10080398 Ga0065704_100803983 243
314 3300009092 Ga0105250_10027636 Ga0105250_100276362 243
315 3300009148 Ga0105243_10000002 Ga0105243_10000002181 243
316 3300013102 Ga0157371_10131570 Ga0157371_101315702 243
317 3300013307 Ga0157372_10000207 Ga0157372_1000020734 243
318 3300025258 Ga0209129_1000037 Ga0209129_1000037115 243
319 3300025935 Ga0207709_10000003 Ga0207709_10000003182 243
320 3300027312 Ga0209371_1000015 Ga0209371_1000015363 243
321 3300030500 Ga0268256_1000018 Ga0268256_1000018261 243
322 3300041405 Ga0439438_008230 Ga0439438_008230_564_1355 243
323 3300041407 Ga0439447_000370 Ga0439447_000370_8727_9518 243
324 3300046513 Ga0495616_0000156 Ga0495616_0000156_35284_36024 243
325 3300046692 Ga0495671_0004862 Ga0495671_0004862_3205_3945 243
326 3300046810 Ga0495660_0008905 Ga0495660_0008905_1641_2432 243
327 3300047320 Ga0495672_0000009 Ga0495672_0000009_227265_227996 243
328 3300047470 Ga0495681_0000109 Ga0495681_0000109_65417_66157 243
329 3300048919 Ga0496116_0002044 Ga0496116_0002044_4716_5447 243
330 3300048919 Ga0496116_0066349 Ga0496116_0066349_110_847 243
331 3300048920 Ga0496117_0001145 Ga0496117_0001145_36066_36803 243
332 3300048920 Ga0496117_0012974 Ga0496117_0012974_6476_7207 243
333 3300048920 Ga0496117_0025021 Ga0496117_0025021_3105_3842 243
334 3300048921 Ga0496118_0001021 Ga0496118_0001021_29251_29988 243
335 3300048921 Ga0496118_0013305 Ga0496118_0013305_4396_5133 243
336 3300048925 Ga0496122_0014459 Ga0496122_0014459_2760_3491 243
337 3300048925 Ga0496122_0196889 Ga0496122_0196889_422_1159 243
338 3300048926 Ga0496123_0024064 Ga0496123_0024064_2383_3114 243
339 3300048927 Ga0496124_0000060 Ga0496124_0000060_51764_52501 243
340 3300048927 Ga0496124_0169281 Ga0496124_0169281_239_970 243
341 3300048928 Ga0496125_0034491 Ga0496125_0034491_54_785 243
342 3300048928 Ga0496125_0224869 Ga0496125_0224869_143_880 243
343 3300049460 Ga0495682_0000427 Ga0495682_0000427_23398_24138 243
344 3300049571 Ga0501034_0300847 Ga0501034_0300847_639_1397 243
345 3300049822 Ga0501035_0597134 Ga0501035_0597134_118_876 243
346 3300048920 Ga0496117_0000624 Ga0496117_0000624_45762_46499 245
347 3300048921 Ga0496118_0283588 Ga0496118_0283588_40_777 245
348 3300048929 Ga0496126_0000313 Ga0496126_0000313_49539_50276 245
349 3300046501 Ga0495607_0000686 Ga0495607_0000686_11645_12385 246
350 iso_pu_bacteria 8055097453 8055100921 247
351 3300046530 Ga0495654_0007160 Ga0495654_0007160_2041_2853 248
352 3300015265 Ga0182005_1016327 Ga0182005_10163273 249
353 3300009036 Ga0105244_10018316 Ga0105244_100183165 250
354 3300048923 Ga0496120_0000026 Ga0496120_0000026_97260_98018 250
355 2162886007 SwRhRL2b_contig_45605 SwRhRL2b_0876.00001360 254
356 3300013105 Ga0157369_10006742 Ga0157369_100067426 254
357 3300042010 Ga0439452_000037 Ga0439452_000037_96511_97350 254
358 3300048908 Ga0496105_0033175 Ga0496105_0033175_2555_3340 254
359 3300048921 Ga0496118_0109948 Ga0496118_0109948_744_1529 254
360 3300048922 Ga0496119_0000013 Ga0496119_0000013_56294_57079 254
361 3300048923 Ga0496120_0005709 Ga0496120_0005709_3211_3996 254
362 3300048923 Ga0496120_0016028 Ga0496120_0016028_4024_4809 254
363 3300048925 Ga0496122_0030898 Ga0496122_0030898_1989_2774 254
364 3300048926 Ga0496123_0087247 Ga0496123_0087247_311_1096 254
365 3300048928 Ga0496125_0125140 Ga0496125_0125140_681_1466 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07722

Peptidase_C26

Peptidase C26

33

162

0.85

PF00117

GATase

Glutamine amidotransferase class-I

51

230

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l7n-assembly1.cif.gz_A crystal structure of smu.1228c 0.9917 12 244
3l7n-assembly1.cif.gz_A crystal structure of smu.1228c 0.9833 12 244
1o1y-assembly1.cif.gz_A crystal structure of a glutamine amidotransferase (tm1158) from thermotoga maritima at 1.70 a resolution 0.8983 10 243
3m3p-assembly1.cif.gz_A crystal structure of glutamine amido transferase from methylobacillus flagellatus 0.8935 10 245
1o1y-assembly1.cif.gz_A crystal structure of a glutamine amidotransferase (tm1158) from thermotoga maritima at 1.70 a resolution 0.8799 10 243
ID Description Score Start End Superfamily
3l7nA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9917 12 244 3.40.50.880
3l7nA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9833 12 244 3.40.50.880
1o1yA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8918 10 243 3.40.50.880
1o1yA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.877 10 243 3.40.50.880
3l83A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8402 14 247 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7W7IZH6-F1-model_v4 GMP synthase (Glutamine-hydrolyzing) (EC 6.3.5.2) 0.9974 12 248 GO:0003922
GO:0005829
GO:0006541
AF-A0A7H8WDY2-F1-model_v4 Type 1 glutamine amidotransferase 0.9974 12 248 GO:0005829
GO:0006541
GO:0016740
AF-A0A379VMW0-F1-model_v4 Glutamine amidotransferase (EC 6.3.5.2) 0.9947 12 197 GO:0003922
GO:0005829
GO:0006541
GO:0016740
AF-A0A359YGI2-F1-model_v4 deleted 0.9944 58 244
AF-A0A154UDN3-F1-model_v4 deleted 0.9941 11 243

Feature Viewer

pLDDT pTM Quality
94.9 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map