F423664

General Info

Members Datasets Scaffolds Average Seq Length
365 177 730 262

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10037505|Ga0105238_100375052
Length 320
Sequence VHDRPRADKGVDDRAAQRARAPGNDHLASFHHDAQDGATISALELAMSLRLXPEIPLYQVDAFTNHPFGGNPAAVCPLGAWLPAPLMQKIAAENNLSETAFFVPDAEGFALRWFTPTTEVDLCGHATLASAFVLMTELTPERKRVVFSTRSGPLVVERDGDKLTMDFPARPPTKLSTPFPVLAAALGKTPSAVWTARSLVAVFDDAETVRGLRPDFSKISALDTYGVIATAPGTGADADVDCVSRFFAPRQGVPEDPVTGSAHCTLTPYWAARLGRTRLRARQVSARGGEIDCELNGDRVSLSGNAVLLIRGTLRLPADA

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
94 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
95 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
96 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
97 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
98 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
108 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
117 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
125 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
174 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
177 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.27
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 0.27
Rhizoplane 0.55
Rhizosphere 97.81
Stem 0
Stem Tuber 0
Unclassified 1.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10037505 3300009551 Bacteria 4926
2 JGI24736J21556_1001113 3300001904 Bacteria 4914
3 JGI24741J21665_1019110 3300001915 Bacteria 1089
4 JGI24737J22298_10033998 3300001990 Bacteria 1582
5 Ga0070658_10000431 3300005327 Bacteria 36455
6 Ga0070658_10006937 3300005327 Bacteria 9149
7 Ga0070658_10037689 3300005327 Bacteria 3898
8 Ga0070658_10038869 3300005327 Bacteria 3838
9 Ga0070658_10046318 3300005327 Bacteria 3520
10 Ga0070658_10123956 3300005327 Bacteria 2149
11 Ga0070658_10191571 3300005327 Bacteria 1723
12 Ga0070658_10220912 3300005327 Bacteria 1602
13 Ga0070658_10383654 3300005327 Bacteria 1206
14 Ga0070658_10474989 3300005327 Bacteria 1079
15 Ga0070676_10228836 3300005328 Bacteria 1231
16 Ga0070683_100002329 3300005329 Bacteria 15071
17 Ga0070683_100003064 3300005329 Bacteria 13449
18 Ga0070683_100031687 3300005329 Bacteria 4811
19 Ga0068869_100382982 3300005334 Unclassified 1153
20 Ga0070680_100004013 3300005336 Bacteria 11011
21 Ga0070680_100006559 3300005336 Bacteria 8852
22 Ga0070680_100074071 3300005336 Bacteria 2801
23 Ga0070680_100136362 3300005336 Bacteria 2056
24 Ga0070680_100244277 3300005336 Bacteria 1518
25 Ga0070682_100004007 3300005337 Bacteria 8187
26 Ga0068868_100201881 3300005338 Bacteria 1658
27 Ga0070660_100000053 3300005339 Bacteria 67349
28 Ga0070660_100087238 3300005339 Bacteria 2456
29 Ga0070660_100132745 3300005339 Bacteria 1994
30 Ga0070687_100003040 3300005343 Bacteria 6454
31 Ga0070661_100028152 3300005344 Bacteria 4052
32 Ga0070692_10283418 3300005345 Bacteria 1005
33 Ga0070668_100376301 3300005347 Bacteria 1208
34 Ga0070674_100118042 3300005356 Bacteria 1960
35 Ga0070673_100018754 3300005364 Bacteria 4954
36 Ga0070659_100269819 3300005366 Bacteria 1413
37 Ga0070659_100353633 3300005366 Bacteria 1233
38 Ga0070667_100012164 3300005367 Bacteria 7122
39 Ga0070714_100008475 3300005435 Bacteria 8032
40 Ga0070705_100047191 3300005440 Bacteria 2488
41 Ga0070700_100206004 3300005441 Bacteria 1385
42 Ga0070694_100057911 3300005444 Bacteria 2635
43 Ga0070708_100058129 3300005445 Bacteria 3445
44 Ga0070663_100008434 3300005455 Bacteria 6340
45 Ga0070663_100023600 3300005455 Bacteria 4125
46 Ga0070663_100028929 3300005455 Bacteria 3779
47 Ga0070663_100104500 3300005455 Bacteria 2119
48 Ga0070681_10075373 3300005458 Bacteria 3334
49 Ga0070681_10330001 3300005458 Bacteria 1435
50 Ga0070699_100161885 3300005518 Bacteria 1981
51 Ga0070679_100001057 3300005530 Bacteria 24020
52 Ga0070679_100034414 3300005530 Bacteria 5020
53 Ga0070679_100037097 3300005530 Bacteria 4840
54 Ga0070679_100062345 3300005530 Bacteria 3717
55 Ga0070679_100223702 3300005530 Bacteria 1842
56 Ga0070679_100415730 3300005530 Bacteria 1290
57 Ga0070679_100457520 3300005530 Bacteria 1221
58 Ga0070684_100052851 3300005535 Bacteria 3534
59 Ga0068853_100003926 3300005539 Bacteria 11414
60 Ga0068853_100034537 3300005539 Bacteria 4293
61 Ga0068853_100347686 3300005539 Bacteria 1379
62 Ga0070686_100083779 3300005544 Bacteria 2117
63 Ga0070704_100272421 3300005549 Bacteria 1399
64 Ga0068855_100000433 3300005563 Bacteria 51890
65 Ga0068855_100013172 3300005563 Bacteria 9974
66 Ga0068855_100127607 3300005563 Bacteria 2907
67 Ga0068855_100148977 3300005563 Bacteria 2661
68 Ga0068855_100186702 3300005563 Bacteria 2341
69 Ga0068857_100079294 3300005577 Bacteria 2931
70 Ga0068857_100297501 3300005577 Bacteria 1487
71 Ga0068854_100007774 3300005578 Bacteria 6857
72 Ga0068854_100032007 3300005578 Bacteria 3657
73 Ga0068856_100014558 3300005614 Bacteria 7599
74 Ga0068856_100418750 3300005614 Bacteria 1360
75 Ga0068856_100462908 3300005614 Bacteria 1289
76 Ga0068856_100533751 3300005614 Bacteria 1194
77 Ga0068856_100576040 3300005614 Bacteria 1147
78 Ga0068852_100003515 3300005616 Bacteria 10961
79 Ga0068852_100011580 3300005616 Bacteria 6651
80 Ga0068852_100026037 3300005616 Bacteria 4748
81 Ga0068852_100034580 3300005616 Bacteria 4206
82 Ga0068852_100167778 3300005616 Bacteria 2055
83 Ga0068859_100095550 3300005617 Bacteria 3024
84 Ga0068861_100496907 3300005719 Unclassified 1102
85 Ga0068863_100207262 3300005841 Bacteria 1887
86 Ga0068863_100268534 3300005841 Bacteria 1651
87 Ga0075365_10375063 3300006038 Bacteria 1003
88 Ga0068871_100192088 3300006358 Bacteria 1759
89 Ga0075428_100204779 3300006844 Bacteria 2132
90 Ga0075431_100017838 3300006847 Bacteria 7217
91 Ga0097620_100095543 3300006931 Bacteria 3024
92 Ga0105240_10000717 3300009093 Bacteria 60700
93 Ga0105240_10017309 3300009093 Bacteria 9717
94 Ga0105240_10027323 3300009093 Bacteria 7472
95 Ga0105240_10117509 3300009093 Bacteria 3206
96 Ga0111539_10038808 3300009094 Bacteria 5744
97 Ga0111539_10050866 3300009094 Bacteria 4936
98 Ga0111539_10133500 3300009094 Bacteria 2906
99 Ga0105247_10315142 3300009101 Unclassified 1090
100 Ga0114129_10075063 3300009147 Bacteria 4708
101 Ga0105237_10000235 3300009545 Bacteria 79122
102 Ga0105238_10095105 3300009551 Bacteria 2967
103 Ga0105238_10837955 3300009551 Bacteria 936
104 Ga0105239_10059512 3300010375 Bacteria 4193
105 Ga0157373_10008257 3300013100 Bacteria 7740
106 Ga0157373_10129529 3300013100 Bacteria 1774
107 Ga0157373_10176667 3300013100 Bacteria 1503
108 Ga0157373_10416773 3300013100 Bacteria 964
109 Ga0157371_10000468 3300013102 Bacteria 49508
110 Ga0157371_10055770 3300013102 Bacteria 2804
111 Ga0157371_10083052 3300013102 Bacteria 2268
112 Ga0157371_10425222 3300013102 Unclassified 974
113 Ga0157370_10067039 3300013104 Bacteria 3393
114 Ga0157370_10087646 3300013104 Bacteria 2924
115 Ga0157370_10146384 3300013104 Bacteria 2200
116 Ga0157370_10207792 3300013104 Bacteria 1815
117 Ga0157370_10388648 3300013104 Bacteria 1285
118 Ga0157370_10632720 3300013104 Bacteria 978
119 Ga0157370_10644175 3300013104 Bacteria 969
120 Ga0157369_10007345 3300013105 Bacteria 12686
121 Ga0157369_10013212 3300013105 Bacteria 9345
122 Ga0157369_10022126 3300013105 Bacteria 7103
123 Ga0157369_10113105 3300013105 Bacteria 2884
124 Ga0157369_10140820 3300013105 Bacteria 2552
125 Ga0157369_10165759 3300013105 Bacteria 2330
126 Ga0157369_10445248 3300013105 Bacteria 1341
127 Ga0157369_10793550 3300013105 Bacteria 973
128 Ga0157372_10129387 3300013307 Bacteria 2904
129 Ga0157372_10167977 3300013307 Bacteria 2537
130 Ga0157372_10209488 3300013307 Bacteria 2259
131 Ga0157375_10017010 3300013308 Bacteria 6550
132 Ga0163163_10009276 3300014325 Bacteria 8778
133 Ga0157379_10159902 3300014968 Bacteria 2033
134 Ga0206353_10141028 3300020082 Bacteria 1247
135 Ga0213875_10004183 3300021388 Bacteria 7982
136 Ga0207647_10036029 3300025904 Bacteria 3147
137 Ga0207647_10054301 3300025904 Bacteria 2465
138 Ga0207647_10202349 3300025904 Bacteria 1148
139 Ga0207705_10000526 3300025909 Bacteria 32452
140 Ga0207705_10001929 3300025909 Bacteria 16208
141 Ga0207705_10002377 3300025909 Bacteria 14544
142 Ga0207705_10046708 3300025909 Bacteria 3112
143 Ga0207705_10079600 3300025909 Bacteria 2386
144 Ga0207705_10094885 3300025909 Bacteria 2188
145 Ga0207705_10114132 3300025909 Bacteria 1998
146 Ga0207705_10143350 3300025909 Bacteria 1785
147 Ga0207707_10191524 3300025912 Bacteria 1784
148 Ga0207707_10206513 3300025912 Bacteria 1712
149 Ga0207707_10328523 3300025912 Bacteria 1319
150 Ga0207695_10015302 3300025913 Bacteria 9039
151 Ga0207695_10016026 3300025913 Bacteria 8795
152 Ga0207695_10028165 3300025913 Bacteria 6238
153 Ga0207695_10079317 3300025913 Bacteria 3328
154 Ga0207671_10001281 3300025914 Bacteria 29556
155 Ga0207660_10001621 3300025917 Bacteria 15097
156 Ga0207660_10010517 3300025917 Bacteria 6010
157 Ga0207660_10110843 3300025917 Bacteria 2065
158 Ga0207660_10247185 3300025917 Bacteria 1407
159 Ga0207660_10491203 3300025917 Bacteria 995
160 Ga0207662_10110031 3300025918 Bacteria 1717
161 Ga0207657_10000058 3300025919 Bacteria 103811
162 Ga0207657_10000088 3300025919 Bacteria 88065
163 Ga0207657_10076240 3300025919 Bacteria 2829
164 Ga0207657_10140313 3300025919 Bacteria 1975
165 Ga0207649_10010803 3300025920 Bacteria 5020
166 Ga0207652_10000162 3300025921 Bacteria 72698
167 Ga0207652_10005175 3300025921 Bacteria 10589
168 Ga0207652_10047529 3300025921 Bacteria 3666
169 Ga0207652_10110964 3300025921 Bacteria 2432
170 Ga0207652_10218177 3300025921 Bacteria 1718
171 Ga0207652_10256242 3300025921 Bacteria 1578
172 Ga0207652_10283112 3300025921 Bacteria 1496
173 Ga0207652_10294313 3300025921 Bacteria 1465
174 Ga0207659_10162951 3300025926 Bacteria 1752
175 Ga0207664_10069597 3300025929 Bacteria 2830
176 Ga0207690_10214320 3300025932 Bacteria 1470
177 Ga0207690_10250622 3300025932 Bacteria 1368
178 Ga0207669_10099508 3300025937 Bacteria 1918
179 Ga0207691_10058717 3300025940 Bacteria 3499
180 Ga0207661_10044225 3300025944 Bacteria 3519
181 Ga0207661_10437312 3300025944 Bacteria 1190
182 Ga0207661_10628298 3300025944 Bacteria 987
183 Ga0207667_10000114 3300025949 Bacteria 128923
184 Ga0207667_10028908 3300025949 Bacteria 6017
185 Ga0207667_10063117 3300025949 Bacteria 3871
186 Ga0207667_10121008 3300025949 Bacteria 2697
187 Ga0207667_10190256 3300025949 Bacteria 2106
188 Ga0207667_10393186 3300025949 Bacteria 1412
189 Ga0207640_10004852 3300025981 Bacteria 7302
190 Ga0207640_10027664 3300025981 Bacteria 3458
191 Ga0207658_10166632 3300025986 Bacteria 1811
192 Ga0207677_10384421 3300026023 Bacteria 1186
193 Ga0207639_10003573 3300026041 Bacteria 10445
194 Ga0207639_10034072 3300026041 Bacteria 3761
195 Ga0207639_10140025 3300026041 Bacteria 2014
196 Ga0207678_10003213 3300026067 Bacteria 14771
197 Ga0207678_10011689 3300026067 Bacteria 7707
198 Ga0207678_10039611 3300026067 Bacteria 4089
199 Ga0207678_10666859 3300026067 Bacteria 914
200 Ga0207708_10285063 3300026075 Bacteria 1339
201 Ga0207702_10017757 3300026078 Bacteria 5889
202 Ga0207702_10447162 3300026078 Bacteria 1253
203 Ga0207641_10162099 3300026088 Bacteria 2034
204 Ga0207641_10173248 3300026088 Bacteria 1971
205 Ga0207674_10016312 3300026116 Bacteria 8136
206 Ga0207675_100756657 3300026118 Unclassified 983
207 Ga0207698_10000412 3300026142 Bacteria 24694
208 Ga0207698_10002621 3300026142 Bacteria 10691
209 Ga0207698_10017857 3300026142 Bacteria 4822
210 Ga0207698_10055708 3300026142 Bacteria 3049
211 Ga0207428_10085831 3300027907 Bacteria 2450
212 Ga0268266_10015757 3300028379 Bacteria 6474
213 Ga0265326_10014713 3300028558 Bacteria 2278
214 Ga0265318_10000014 3300028577 Bacteria 208921
215 Ga0265330_10000214 3300031235 Bacteria 44995
216 Ga0265332_10000244 3300031238 Bacteria 43234
217 Ga0265328_10004641 3300031239 Bacteria 5945
218 Ga0265320_10000036 3300031240 Bacteria 136231
219 Ga0265325_10002487 3300031241 Bacteria 12420
220 Ga0265325_10204572 3300031241 Bacteria 909
221 Ga0265329_10005076 3300031242 Bacteria 5371
222 Ga0265339_10018044 3300031249 Bacteria 4168
223 Ga0265339_10111885 3300031249 Bacteria 1412
224 Ga0265331_10000205 3300031250 Bacteria 71426
225 Ga0265331_10023531 3300031250 Bacteria 3129
226 Ga0265316_10003320 3300031344 Bacteria 16304
227 Ga0265316_10065004 3300031344 Bacteria 2825
228 Ga0265316_10181771 3300031344 Bacteria 1566
229 Ga0265316_10243418 3300031344 Bacteria 1322
230 Ga0265313_10000327 3300031595 Bacteria 51611
231 Ga0265314_10000296 3300031711 Bacteria 71336
232 Ga0265314_10105565 3300031711 Bacteria 1801
233 Ga0265342_10006564 3300031712 Bacteria 8651
234 Ga0265342_10066411 3300031712 Bacteria 2112
235 Ga0316576_10059553 3300031727 Bacteria 2796
236 Ga0316576_10101772 3300031727 Bacteria 2148
237 Ga0316577_10083221 3300031733 Bacteria 1790
238 Ga0307410_10031020 3300031852 Bacteria 3424
239 Ga0307406_10098585 3300031901 Bacteria 1985
240 Ga0307407_10344466 3300031903 Bacteria 1053
241 Ga0307409_100077354 3300031995 Bacteria 2672
242 Ga0307416_100241359 3300032002 Bacteria 1751
243 Ga0307411_10351727 3300032005 Bacteria 1201
244 Ga0307415_100019595 3300032126 Bacteria 4111
245 Ga0307415_100108604 3300032126 Bacteria 2053
246 Ga0373934_0122951 3300035086 Bacteria 1056
247 Ga0373954_0095408 3300035118 Bacteria 1432
248 Ga0373956_0022156 3300035119 Bacteria 2716
249 Ga0373943_0261172 3300035170 Bacteria 975
250 Ga0316574_0151066 3300035398 Bacteria 1496
251 Ga0373931_0215497 3300035691 Bacteria 1154
252 Ga0373933_0080914 3300035724 Bacteria 1992
253 Ga0373937_0008331 3300036401 Bacteria 8999
254 Ga0373937_0018810 3300036401 Bacteria 6175
255 Ga0373937_0039727 3300036401 Bacteria 4288
256 Ga0316582_0081290 3300036647 Bacteria 2116
257 Ga0316584_0058141 3300036712 Bacteria 2895
258 Ga0316584_0067262 3300036712 Bacteria 2686
259 Ga0395899_0017389 3300037312 Bacteria 5477
260 Ga0395899_0032111 3300037312 Bacteria 3944
261 Ga0395899_0033317 3300037312 Bacteria 3868
262 Ga0395899_0096660 3300037312 Bacteria 2135
263 Ga0395899_0156158 3300037312 Bacteria 1614
264 Ga0395899_0222057 3300037312 Bacteria 1308
265 Ga0395899_0259424 3300037312 Bacteria 1189
266 Ga0395899_0327569 3300037312 Bacteria 1030
267 Ga0395900_0000124 3300037418 Bacteria 133210
268 Ga0395900_0001090 3300037418 Bacteria 34516
269 Ga0395900_0006790 3300037418 Bacteria 11878
270 Ga0395900_0033053 3300037418 Bacteria 5324
271 Ga0395900_0033884 3300037418 Bacteria 5255
272 Ga0395900_0111480 3300037418 Bacteria 2810
273 Ga0395900_0129757 3300037418 Bacteria 2584
274 Ga0395900_0220349 3300037418 Bacteria 1912
275 Ga0395900_0330545 3300037418 Bacteria 1502
276 Ga0395900_0407680 3300037418 Bacteria 1322
277 Ga0395900_0712443 3300037418 Bacteria 936
278 Ga0395898_0003043 3300037466 Bacteria 18995
279 Ga0395898_0014234 3300037466 Bacteria 8177
280 Ga0395898_0042803 3300037466 Bacteria 4466
281 Ga0395898_0060620 3300037466 Bacteria 3677
282 Ga0395898_0068791 3300037466 Bacteria 3426
283 Ga0395898_0107525 3300037466 Bacteria 2675
284 Ga0395898_0402908 3300037466 Bacteria 1304
285 Ga0395905_0001328 3300037471 Bacteria 30188
286 Ga0395905_0071765 3300037471 Bacteria 3246
287 Ga0395905_0172795 3300037471 Bacteria 2029
288 Ga0395905_0234474 3300037471 Bacteria 1716
289 Ga0395905_0278207 3300037471 Bacteria 1559
290 Ga0395905_0280135 3300037471 Bacteria 1553
291 Ga0395905_0345510 3300037471 Bacteria 1379
292 Ga0395905_0595834 3300037471 Unclassified 1007
293 Ga0395905_0681249 3300037471 Bacteria 930
294 Ga0316581_0029103 3300037588 Bacteria 1658
295 Ga0436364_0293754 3300037853 Bacteria 44649
296 Ga0395901_0000031 3300038443 Bacteria 241733
297 Ga0395901_0000168 3300038443 Bacteria 85645
298 Ga0395901_0009746 3300038443 Bacteria 9739
299 Ga0395901_0016719 3300038443 Bacteria 7475
300 Ga0395901_0108331 3300038443 Bacteria 2916
301 Ga0395901_0176000 3300038443 Bacteria 2244
302 Ga0395901_0324629 3300038443 Bacteria 1592
303 Ga0395901_0394929 3300038443 Bacteria 1421
304 Ga0395901_0984030 3300038443 Bacteria 820
305 Ga0451577_0039450 3300042876 Bacteria 4244
306 Ga0451577_0139504 3300042876 Bacteria 2178
307 Ga0451577_0213069 3300042876 Bacteria 1745
308 Ga0466969_0055649 3300044656 Bacteria 1934
309 Ga0466966_0025929 3300044684 Bacteria 3829
310 Ga0466966_0027598 3300044684 Bacteria 3701
311 Ga0466961_0039858 3300044693 Bacteria 3011
312 Ga0466961_0048820 3300044693 Bacteria 2706
313 Ga0466961_0122549 3300044693 Bacteria 1631
314 Ga0466961_0237994 3300044693 Bacteria 1119
315 Ga0466963_0012851 3300044694 Bacteria 5130
316 Ga0466963_0171992 3300044694 Bacteria 1510
317 Ga0453684_0001907 3300044712 Bacteria 54115
318 Ga0466971_0224154 3300044719 Bacteria 891
319 Ga0466970_0028839 3300044765 Bacteria 2919
320 Ga0466957_0164939 3300044842 Bacteria 1440
321 Ga0466959_0060717 3300045049 Bacteria 2750
322 Ga0466959_0129162 3300045049 Bacteria 1791
323 Ga0466959_0408907 3300045049 Bacteria 922
324 Ga0451576_0000247 3300045051 Bacteria 132668
325 Ga0451576_0501447 3300045051 Bacteria 1275
326 Ga0466958_0057999 3300045836 Bacteria 2353
327 Ga0466958_0133709 3300045836 Bacteria 1559
328 Ga0466967_0014427 3300045976 Bacteria 6155
329 Ga0466967_0022442 3300045976 Bacteria 5150
330 Ga0466967_0047781 3300045976 Bacteria 3733
331 Ga0466967_0573975 3300045976 Bacteria 1111
332 Ga0466967_1138020 3300045976 Bacteria 778
333 Ga0495592_0052985 3300046454 Bacteria 3010
334 Ga0495653_0298834 3300046463 Bacteria 1051
335 Ga0495594_0085363 3300046499 Bacteria 1766
336 Ga0495618_0052188 3300046514 Bacteria 2584
337 Ga0495640_0128784 3300046533 Bacteria 1639
338 Ga0495587_0099802 3300046536 Bacteria 1673
339 Ga0495667_0016660 3300046559 Bacteria 4962
340 Ga0495667_0065313 3300046559 Bacteria 2380
341 Ga0495635_0085873 3300046663 Bacteria 2153
342 Ga0495600_0111955 3300046809 Bacteria 1777
343 Ga0495604_0037451 3300047317 Bacteria 3820
344 Ga0495680_0011655 3300047322 Bacteria 7767
345 Ga0496100_0233873 3300048903 Bacteria 1353
346 Ga0496114_0000249 3300048917 Bacteria 39187
347 Ga0501032_0030562 3300049569 Bacteria 3696
348 Ga0501033_0140143 3300049570 Bacteria 1748
349 Ga0501037_0218637 3300049573 Bacteria 1341
350 Ga0501039_0490650 3300049575 Bacteria 964
351 Ga0501043_0153639 3300049579 Bacteria 1800
352 Ga0501077_0088732 3300049593 Bacteria 1960
353 Ga0501079_0263095 3300049741 Bacteria 1348
354 Ga0501035_0068041 3300049822 Bacteria 3158
355 Ga0501044_0004929 3300049823 Bacteria 14924
356 nmdc:mga0yw44_358629_c1 3300050492 Bacteria 982
357 nmdc:mga05p37_199345_c1 3300050507 Bacteria 2425
358 nmdc:mga09592_144095_c1 3300050508 Bacteria 2054
359 nmdc:mga06r32_474973_c1 3300050510 Bacteria 1229
360 nmdc:mga08y16_42847_c1 3300050511 Bacteria 4741
361 Ga0495601_0005248 3300053077 Bacteria 7539
362 Ga0495595_0049639 3300053084 Bacteria 1941
363 Ga0495619_0008326 3300053085 Bacteria 6556
364 Ga0500566_0001132 3300053094 Bacteria 15471
365 2842337549 2842333319 Bacteria 8899485
366 Ga0105238_10037505
367 JGI24736J21556_1001113
368 JGI24741J21665_1019110
369 JGI24737J22298_10033998
370 Ga0070658_10000431
371 Ga0070658_10006937
372 Ga0070658_10037689
373 Ga0070658_10038869
374 Ga0070658_10046318
375 Ga0070658_10123956
376 Ga0070658_10191571
377 Ga0070658_10220912
378 Ga0070658_10383654
379 Ga0070658_10474989
380 Ga0070676_10228836
381 Ga0070683_100002329
382 Ga0070683_100003064
383 Ga0070683_100031687
384 Ga0068869_100382982
385 Ga0070680_100004013
386 Ga0070680_100006559
387 Ga0070680_100074071
388 Ga0070680_100136362
389 Ga0070680_100244277
390 Ga0070682_100004007
391 Ga0068868_100201881
392 Ga0070660_100000053
393 Ga0070660_100087238
394 Ga0070660_100132745
395 Ga0070687_100003040
396 Ga0070661_100028152
397 Ga0070692_10283418
398 Ga0070668_100376301
399 Ga0070674_100118042
400 Ga0070673_100018754
401 Ga0070659_100269819
402 Ga0070659_100353633
403 Ga0070667_100012164
404 Ga0070714_100008475
405 Ga0070705_100047191
406 Ga0070700_100206004
407 Ga0070694_100057911
408 Ga0070708_100058129
409 Ga0070663_100008434
410 Ga0070663_100023600
411 Ga0070663_100028929
412 Ga0070663_100104500
413 Ga0070681_10075373
414 Ga0070681_10330001
415 Ga0070699_100161885
416 Ga0070679_100001057
417 Ga0070679_100034414
418 Ga0070679_100037097
419 Ga0070679_100062345
420 Ga0070679_100223702
421 Ga0070679_100415730
422 Ga0070679_100457520
423 Ga0070684_100052851
424 Ga0068853_100003926
425 Ga0068853_100034537
426 Ga0068853_100347686
427 Ga0070686_100083779
428 Ga0070704_100272421
429 Ga0068855_100000433
430 Ga0068855_100013172
431 Ga0068855_100127607
432 Ga0068855_100148977
433 Ga0068855_100186702
434 Ga0068857_100079294
435 Ga0068857_100297501
436 Ga0068854_100007774
437 Ga0068854_100032007
438 Ga0068856_100014558
439 Ga0068856_100418750
440 Ga0068856_100462908
441 Ga0068856_100533751
442 Ga0068856_100576040
443 Ga0068852_100003515
444 Ga0068852_100011580
445 Ga0068852_100026037
446 Ga0068852_100034580
447 Ga0068852_100167778
448 Ga0068859_100095550
449 Ga0068861_100496907
450 Ga0068863_100207262
451 Ga0068863_100268534
452 Ga0075365_10375063
453 Ga0068871_100192088
454 Ga0075428_100204779
455 Ga0075431_100017838
456 Ga0097620_100095543
457 Ga0105240_10000717
458 Ga0105240_10017309
459 Ga0105240_10027323
460 Ga0105240_10117509
461 Ga0111539_10038808
462 Ga0111539_10050866
463 Ga0111539_10133500
464 Ga0105247_10315142
465 Ga0114129_10075063
466 Ga0105237_10000235
467 Ga0105238_10095105
468 Ga0105238_10837955
469 Ga0105239_10059512
470 Ga0157373_10008257
471 Ga0157373_10129529
472 Ga0157373_10176667
473 Ga0157373_10416773
474 Ga0157371_10000468
475 Ga0157371_10055770
476 Ga0157371_10083052
477 Ga0157371_10425222
478 Ga0157370_10067039
479 Ga0157370_10087646
480 Ga0157370_10146384
481 Ga0157370_10207792
482 Ga0157370_10388648
483 Ga0157370_10632720
484 Ga0157370_10644175
485 Ga0157369_10007345
486 Ga0157369_10013212
487 Ga0157369_10022126
488 Ga0157369_10113105
489 Ga0157369_10140820
490 Ga0157369_10165759
491 Ga0157369_10445248
492 Ga0157369_10793550
493 Ga0157372_10129387
494 Ga0157372_10167977
495 Ga0157372_10209488
496 Ga0157375_10017010
497 Ga0163163_10009276
498 Ga0157379_10159902
499 Ga0206353_10141028
500 Ga0213875_10004183
501 Ga0207647_10036029
502 Ga0207647_10054301
503 Ga0207647_10202349
504 Ga0207705_10000526
505 Ga0207705_10001929
506 Ga0207705_10002377
507 Ga0207705_10046708
508 Ga0207705_10079600
509 Ga0207705_10094885
510 Ga0207705_10114132
511 Ga0207705_10143350
512 Ga0207707_10191524
513 Ga0207707_10206513
514 Ga0207707_10328523
515 Ga0207695_10015302
516 Ga0207695_10016026
517 Ga0207695_10028165
518 Ga0207695_10079317
519 Ga0207671_10001281
520 Ga0207660_10001621
521 Ga0207660_10010517
522 Ga0207660_10110843
523 Ga0207660_10247185
524 Ga0207660_10491203
525 Ga0207662_10110031
526 Ga0207657_10000058
527 Ga0207657_10000088
528 Ga0207657_10076240
529 Ga0207657_10140313
530 Ga0207649_10010803
531 Ga0207652_10000162
532 Ga0207652_10005175
533 Ga0207652_10047529
534 Ga0207652_10110964
535 Ga0207652_10218177
536 Ga0207652_10256242
537 Ga0207652_10283112
538 Ga0207652_10294313
539 Ga0207659_10162951
540 Ga0207664_10069597
541 Ga0207690_10214320
542 Ga0207690_10250622
543 Ga0207669_10099508
544 Ga0207691_10058717
545 Ga0207661_10044225
546 Ga0207661_10437312
547 Ga0207661_10628298
548 Ga0207667_10000114
549 Ga0207667_10028908
550 Ga0207667_10063117
551 Ga0207667_10121008
552 Ga0207667_10190256
553 Ga0207667_10393186
554 Ga0207640_10004852
555 Ga0207640_10027664
556 Ga0207658_10166632
557 Ga0207677_10384421
558 Ga0207639_10003573
559 Ga0207639_10034072
560 Ga0207639_10140025
561 Ga0207678_10003213
562 Ga0207678_10011689
563 Ga0207678_10039611
564 Ga0207678_10666859
565 Ga0207708_10285063
566 Ga0207702_10017757
567 Ga0207702_10447162
568 Ga0207641_10162099
569 Ga0207641_10173248
570 Ga0207674_10016312
571 Ga0207675_100756657
572 Ga0207698_10000412
573 Ga0207698_10002621
574 Ga0207698_10017857
575 Ga0207698_10055708
576 Ga0207428_10085831
577 Ga0268266_10015757
578 Ga0265326_10014713
579 Ga0265318_10000014
580 Ga0265330_10000214
581 Ga0265332_10000244
582 Ga0265328_10004641
583 Ga0265320_10000036
584 Ga0265325_10002487
585 Ga0265325_10204572
586 Ga0265329_10005076
587 Ga0265339_10018044
588 Ga0265339_10111885
589 Ga0265331_10000205
590 Ga0265331_10023531
591 Ga0265316_10003320
592 Ga0265316_10065004
593 Ga0265316_10181771
594 Ga0265316_10243418
595 Ga0265313_10000327
596 Ga0265314_10000296
597 Ga0265314_10105565
598 Ga0265342_10006564
599 Ga0265342_10066411
600 Ga0316576_10059553
601 Ga0316576_10101772
602 Ga0316577_10083221
603 Ga0307410_10031020
604 Ga0307406_10098585
605 Ga0307407_10344466
606 Ga0307409_100077354
607 Ga0307416_100241359
608 Ga0307411_10351727
609 Ga0307415_100019595
610 Ga0307415_100108604
611 Ga0373934_0122951
612 Ga0373954_0095408
613 Ga0373956_0022156
614 Ga0373943_0261172
615 Ga0316574_0151066
616 Ga0373931_0215497
617 Ga0373933_0080914
618 Ga0373937_0008331
619 Ga0373937_0018810
620 Ga0373937_0039727
621 Ga0316582_0081290
622 Ga0316584_0058141
623 Ga0316584_0067262
624 Ga0395899_0017389
625 Ga0395899_0032111
626 Ga0395899_0033317
627 Ga0395899_0096660
628 Ga0395899_0156158
629 Ga0395899_0222057
630 Ga0395899_0259424
631 Ga0395899_0327569
632 Ga0395900_0000124
633 Ga0395900_0001090
634 Ga0395900_0006790
635 Ga0395900_0033053
636 Ga0395900_0033884
637 Ga0395900_0111480
638 Ga0395900_0129757
639 Ga0395900_0220349
640 Ga0395900_0330545
641 Ga0395900_0407680
642 Ga0395900_0712443
643 Ga0395898_0003043
644 Ga0395898_0014234
645 Ga0395898_0042803
646 Ga0395898_0060620
647 Ga0395898_0068791
648 Ga0395898_0107525
649 Ga0395898_0402908
650 Ga0395905_0001328
651 Ga0395905_0071765
652 Ga0395905_0172795
653 Ga0395905_0234474
654 Ga0395905_0278207
655 Ga0395905_0280135
656 Ga0395905_0345510
657 Ga0395905_0595834
658 Ga0395905_0681249
659 Ga0316581_0029103
660 Ga0436364_0293754
661 Ga0395901_0000031
662 Ga0395901_0000168
663 Ga0395901_0009746
664 Ga0395901_0016719
665 Ga0395901_0108331
666 Ga0395901_0176000
667 Ga0395901_0324629
668 Ga0395901_0394929
669 Ga0395901_0984030
670 Ga0451577_0039450
671 Ga0451577_0139504
672 Ga0451577_0213069
673 Ga0466969_0055649
674 Ga0466966_0025929
675 Ga0466966_0027598
676 Ga0466961_0039858
677 Ga0466961_0048820
678 Ga0466961_0122549
679 Ga0466961_0237994
680 Ga0466963_0012851
681 Ga0466963_0171992
682 Ga0453684_0001907
683 Ga0466971_0224154
684 Ga0466970_0028839
685 Ga0466957_0164939
686 Ga0466959_0060717
687 Ga0466959_0129162
688 Ga0466959_0408907
689 Ga0451576_0000247
690 Ga0451576_0501447
691 Ga0466958_0057999
692 Ga0466958_0133709
693 Ga0466967_0014427
694 Ga0466967_0022442
695 Ga0466967_0047781
696 Ga0466967_0573975
697 Ga0466967_1138020
698 Ga0495592_0052985
699 Ga0495653_0298834
700 Ga0495594_0085363
701 Ga0495618_0052188
702 Ga0495640_0128784
703 Ga0495587_0099802
704 Ga0495667_0016660
705 Ga0495667_0065313
706 Ga0495635_0085873
707 Ga0495600_0111955
708 Ga0495604_0037451
709 Ga0495680_0011655
710 Ga0496100_0233873
711 Ga0496114_0000249
712 Ga0501032_0030562
713 Ga0501033_0140143
714 Ga0501037_0218637
715 Ga0501039_0490650
716 Ga0501043_0153639
717 Ga0501077_0088732
718 Ga0501079_0263095
719 Ga0501035_0068041
720 Ga0501044_0004929
721 nmdc:mga0yw44_358629_c1
722 nmdc:mga05p37_199345_c1
723 nmdc:mga09592_144095_c1
724 nmdc:mga06r32_474973_c1
725 nmdc:mga08y16_42847_c1
726 Ga0495601_0005248
727 Ga0495595_0049639
728 Ga0495619_0008326
729 Ga0500566_0001132
730 2842337549

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02567

PhzC-PhzF

Phenazine biosynthesis-like protein

60

312

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7j-assembly2.cif.gz_B crystal structure of phenazine biosynthesis protein phzf family (enterococcus faecalis) 0.9319 2 259
1s7j-assembly2.cif.gz_B crystal structure of phenazine biosynthesis protein phzf family (enterococcus faecalis) 0.9249 2 259
4dun-assembly1.cif.gz_A-2 1.76a x-ray crystal structure of a putative phenazine biosynthesis phzc/phzf protein from clostridium difficile (strain 630) 0.906 4 259
5iwe-assembly1.cif.gz_A-2 e45q mutant of phenazine biosynthesis protein phzf in complex with (5r,6r)-6-azaniumyl-5-ethoxycyclohexa-1,3-diene-1-carboxylate 0.9 2 259
1xub-assembly1.cif.gz_A-2 structure and function of the phenazine biosynthetic protein phzf from pseudomonas fluorescens 0.8971 4 259
ID Description Score Start End Superfamily
af_K7LH11_163_288_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9467 141 253 3.10.310.10
af_A0A1P8ARL5_195_308_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9467 148 253 3.10.310.10
af_I1JFB7_3_158_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9459 6 104 3.10.310.10
af_A0A2R8Q0H1_3_123_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.943 6 115 3.10.310.10
af_Q8NIL3_2_111_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9422 2 104 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A848SF56-F1-model_v4 deleted 0.9896 1 84
AF-A0A6J4SZT6-F1-model_v4 Phenazine biosynthesis protein PhzF like 0.9868 1 110 GO:0005737
GO:0009058
GO:0016853
AF-A0A7X3YAN9-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9865 146 259 GO:0005737
GO:0009058
GO:0016853
AF-A0A1M4ERE3-F1-model_v4 Phenazine biosynthesis protein PhzF like 0.9849 151 259 GO:0005737
GO:0009058
GO:0016853
AF-A0A7X5W2D9-F1-model_v4 deleted 0.9798 148 247

Map