F423629

General Info

Members Datasets Scaffolds Average Seq Length
365 228 730 251

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100052930|Ga0075430_1000529303
Length 261
Sequence MRRALRSVLYVCVVVLFTAAGVTVTATDWRSSSREPARLAPDPALVREAVVQVYGARAMGAKGLFGVHTWIAVKGTDAPTWTVYEVIGWRLRWAESVVVVRNRQPDARWFGGAPELYADKRGDIDLLIERIDKAARAYPYAAEYTLWPGPNSNTFTAWIGRAVPELEIDLPATAIGKDYLGSSVFAAAPSGSGFQISLGGVLGVAASGVEGLELNILGLTFGVGPSGVKLPLVGRIGAWRPMPVLKDAQAAISAPTRTAAD

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
125 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
126 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
127 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
128 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
129 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
130 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
131 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
132 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
133 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
134 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
139 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
140 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
223 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 0
Rhizosphere 99.45
Stem 0
Stem Tuber 0
Unclassified 7.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100052930 3300006846 Unclassified 3418
2 Ga0070676_10195404 3300005328 Bacteria 1323
3 Ga0070690_100001783 3300005330 Bacteria 11384
4 Ga0070690_100056158 3300005330 Bacteria 2524
5 Ga0070670_100079715 3300005331 Bacteria 2814
6 Ga0070677_10005859 3300005333 Bacteria 4069
7 Ga0068869_100002060 3300005334 Bacteria 12087
8 Ga0070680_100003307 3300005336 Bacteria 12031
9 Ga0070682_100058635 3300005337 Bacteria 2428
10 Ga0068868_100003770 3300005338 Bacteria 10581
11 Ga0070689_100001092 3300005340 Bacteria 17023
12 Ga0070691_10002036 3300005341 Bacteria 8921
13 Ga0070687_100000798 3300005343 Bacteria 10475
14 Ga0070669_100494532 3300005353 Bacteria 1014
15 Ga0070675_100023299 3300005354 Bacteria 4949
16 Ga0070675_100070358 3300005354 Bacteria 2900
17 Ga0070675_100086276 3300005354 Bacteria 2623
18 Ga0070675_100621222 3300005354 Unclassified 981
19 Ga0070671_100177326 3300005355 Bacteria 1804
20 Ga0070671_100299601 3300005355 Unclassified 1369
21 Ga0070674_100028993 3300005356 Bacteria 3639
22 Ga0070674_100078216 3300005356 Bacteria 2356
23 Ga0070673_100042189 3300005364 Bacteria 3516
24 Ga0070673_100411826 3300005364 Bacteria 1210
25 Ga0070673_100445484 3300005364 Bacteria 1164
26 Ga0070673_100831441 3300005364 Bacteria 854
27 Ga0070667_100194044 3300005367 Bacteria 1800
28 Ga0070667_100214474 3300005367 Bacteria 1712
29 Ga0070701_10000854 3300005438 Bacteria 10926
30 Ga0070705_100000473 3300005440 Bacteria 23135
31 Ga0070700_100008675 3300005441 Bacteria 5545
32 Ga0070694_100001201 3300005444 Bacteria 14934
33 Ga0070694_100084162 3300005444 Bacteria 2218
34 Ga0070662_100038273 3300005457 Bacteria 3407
35 Ga0070681_10040259 3300005458 Bacteria 4683
36 Ga0070681_10615741 3300005458 Bacteria 1000
37 Ga0068867_100006649 3300005459 Bacteria 8174
38 Ga0070699_100282077 3300005518 Bacteria 1488
39 Ga0070679_100007832 3300005530 Bacteria 10017
40 Ga0070679_100028416 3300005530 Bacteria 5514
41 Ga0070697_100090532 3300005536 Bacteria 2528
42 Ga0070697_100347716 3300005536 Unclassified 1280
43 Ga0070697_100393498 3300005536 Bacteria 1202
44 Ga0070672_100064459 3300005543 Bacteria 2895
45 Ga0070672_100085115 3300005543 Bacteria 2540
46 Ga0070672_100471291 3300005543 Bacteria 1083
47 Ga0070686_100002127 3300005544 Bacteria 10911
48 Ga0070686_100286939 3300005544 Bacteria 1216
49 Ga0070695_100000891 3300005545 Bacteria 16128
50 Ga0070695_100359793 3300005545 Bacteria 1093
51 Ga0070696_100000008 3300005546 Bacteria 101365
52 Ga0070696_100019639 3300005546 Bacteria 4577
53 Ga0070696_100058001 3300005546 Bacteria 2703
54 Ga0070696_100247437 3300005546 Bacteria 1347
55 Ga0070693_100000008 3300005547 Bacteria 80726
56 Ga0070693_100079956 3300005547 Bacteria 1946
57 Ga0070665_100340047 3300005548 Bacteria 1505
58 Ga0070704_100002526 3300005549 Bacteria 10298
59 Ga0070704_100128799 3300005549 Bacteria 1958
60 Ga0070704_100258675 3300005549 Unclassified 1433
61 Ga0070704_100407380 3300005549 Bacteria 1162
62 Ga0068855_100070235 3300005563 Bacteria 4075
63 Ga0070664_100177346 3300005564 Bacteria 1892
64 Ga0068854_100003486 3300005578 Bacteria 9827
65 Ga0068856_100007752 3300005614 Bacteria 10485
66 Ga0070702_100000062 3300005615 Bacteria 31206
67 Ga0068859_100003274 3300005617 Bacteria 16483
68 Ga0068861_100002708 3300005719 Bacteria 11594
69 Ga0068851_10176893 3300005834 Bacteria 1180
70 Ga0068870_10100408 3300005840 Bacteria 1634
71 Ga0068863_100410965 3300005841 Bacteria 1325
72 Ga0068858_100003684 3300005842 Bacteria 15183
73 Ga0068860_100011051 3300005843 Bacteria 8902
74 Ga0068862_100008658 3300005844 Bacteria 8417
75 Ga0068862_100087190 3300005844 Bacteria 2715
76 Ga0075366_10071349 3300006195 Bacteria 2069
77 Ga0097621_100012215 3300006237 Bacteria 6356
78 Ga0068871_100000682 3300006358 Bacteria 23114
79 Ga0068871_100019879 3300006358 Bacteria 5134
80 Ga0075428_100000615 3300006844 Bacteria 36398
81 Ga0075428_100083984 3300006844 Bacteria 3474
82 Ga0075430_100018223 3300006846 Bacteria 5975
83 Ga0075431_100002681 3300006847 Bacteria 17246
84 Ga0075431_100026728 3300006847 Bacteria 5920
85 Ga0075431_100051127 3300006847 Bacteria 4263
86 Ga0075433_10034452 3300006852 Bacteria 4349
87 Ga0075433_10138425 3300006852 Bacteria 2164
88 Ga0075434_100000002 3300006871 Bacteria 135661
89 Ga0075429_100000150 3300006880 Bacteria 43105
90 Ga0068865_100001702 3300006881 Bacteria 12899
91 Ga0075436_100000939 3300006914 Bacteria 19466
92 Ga0075436_100232778 3300006914 Bacteria 1309
93 Ga0097620_100003274 3300006931 Bacteria 16483
94 Ga0075435_100021533 3300007076 Bacteria 4960
95 Ga0075435_100033315 3300007076 Bacteria 4072
96 Ga0075435_100141667 3300007076 Bacteria 2017
97 Ga0099794_10045775 3300007265 Bacteria 2094
98 Ga0099794_10278426 3300007265 Bacteria 865
99 Ga0111539_10050332 3300009094 Bacteria 4962
100 Ga0111539_10099119 3300009094 Bacteria 3423
101 Ga0111539_10553555 3300009094 Bacteria 1340
102 Ga0105245_10000776 3300009098 Bacteria 28947
103 Ga0105245_10582165 3300009098 Bacteria 1144
104 Ga0114129_10000534 3300009147 Bacteria 46594
105 Ga0105243_10006740 3300009148 Bacteria 8861
106 Ga0105242_10013766 3300009176 Bacteria 6260
107 Ga0105248_10198731 3300009177 Unclassified 2259
108 Ga0105248_10450125 3300009177 Bacteria 1451
109 Ga0105249_10011784 3300009553 Bacteria 7686
110 Ga0105249_10021252 3300009553 Bacteria 5810
111 Ga0157378_10005811 3300013297 Bacteria 10814
112 Ga0163162_10308515 3300013306 Bacteria 1715
113 Ga0157375_10197034 3300013308 Bacteria 2169
114 Ga0157375_10272513 3300013308 Bacteria 1855
115 Ga0157380_10094056 3300014326 Bacteria 2480
116 Ga0157376_10006552 3300014969 Bacteria 8238
117 Ga0157376_10028031 3300014969 Bacteria 4472
118 Ga0157376_10459166 3300014969 Bacteria 1244
119 Ga0207682_10006030 3300025893 Bacteria 4900
120 Ga0207682_10125093 3300025893 Bacteria 1144
121 Ga0207682_10180236 3300025893 Unclassified 965
122 Ga0207642_10001205 3300025899 Bacteria 7991
123 Ga0207647_10069742 3300025904 Bacteria 2125
124 Ga0207699_10183491 3300025906 Bacteria 1408
125 Ga0207645_10103860 3300025907 Bacteria 1835
126 Ga0207645_10104126 3300025907 Bacteria 1833
127 Ga0207645_10182951 3300025907 Bacteria 1375
128 Ga0207707_10044178 3300025912 Bacteria 3885
129 Ga0207707_10455708 3300025912 Bacteria 1094
130 Ga0207662_10075693 3300025918 Bacteria 2045
131 Ga0207652_10014237 3300025921 Bacteria 6442
132 Ga0207652_10109894 3300025921 Unclassified 2444
133 Ga0207681_10169307 3300025923 Bacteria 1655
134 Ga0207650_10001506 3300025925 Bacteria 16663
135 Ga0207650_10017853 3300025925 Bacteria 4971
136 Ga0207650_10273632 3300025925 Bacteria 1373
137 Ga0207659_10048393 3300025926 Bacteria 3011
138 Ga0207659_10130032 3300025926 Bacteria 1942
139 Ga0207687_10004203 3300025927 Bacteria 9630
140 Ga0207664_10158168 3300025929 Bacteria 1930
141 Ga0207644_10441708 3300025931 Bacteria 1068
142 Ga0207706_10033949 3300025933 Bacteria 4541
143 Ga0207686_10001994 3300025934 Bacteria 11251
144 Ga0207709_10036830 3300025935 Unclassified 2902
145 Ga0207709_10263352 3300025935 Bacteria 1265
146 Ga0207670_10002287 3300025936 Bacteria 10036
147 Ga0207669_10224559 3300025937 Bacteria 1381
148 Ga0207669_10396798 3300025937 Bacteria 1079
149 Ga0207704_10006990 3300025938 Bacteria 5300
150 Ga0207665_10070508 3300025939 Bacteria 2385
151 Ga0207691_10006240 3300025940 Bacteria 11513
152 Ga0207691_10019378 3300025940 Bacteria 6438
153 Ga0207691_10051428 3300025940 Bacteria 3767
154 Ga0207691_10082127 3300025940 Bacteria 2895
155 Ga0207691_10129024 3300025940 Bacteria 2235
156 Ga0207691_10279209 3300025940 Bacteria 1437
157 Ga0207691_10280804 3300025940 Bacteria 1433
158 Ga0207711_10281430 3300025941 Bacteria 1532
159 Ga0207689_10001217 3300025942 Bacteria 24753
160 Ga0207661_10065454 3300025944 Bacteria 2951
161 Ga0207679_10183559 3300025945 Bacteria 1733
162 Ga0207651_10039546 3300025960 Bacteria 3111
163 Ga0207712_10014988 3300025961 Bacteria 4995
164 Ga0207640_10007328 3300025981 Bacteria 6091
165 Ga0207658_10134648 3300025986 Bacteria 1990
166 Ga0207658_10305246 3300025986 Bacteria 1373
167 Ga0207678_10258654 3300026067 Bacteria 1492
168 Ga0207678_10702254 3300026067 Bacteria 890
169 Ga0207708_10005256 3300026075 Bacteria 9532
170 Ga0207702_10132146 3300026078 Unclassified 2247
171 Ga0207648_10000708 3300026089 Bacteria 37374
172 Ga0207648_10023879 3300026089 Bacteria 5467
173 Ga0207648_10170640 3300026089 Unclassified 1923
174 Ga0207648_10452263 3300026089 Bacteria 1170
175 Ga0207675_100001101 3300026118 Bacteria 26742
176 Ga0207683_10049701 3300026121 Bacteria 3672
177 Ga0207698_10460482 3300026142 Bacteria 1230
178 Ga0207428_10036635 3300027907 Bacteria 4000
179 Ga0268264_10015270 3300028381 Bacteria 6298
180 Ga0307408_100042598 3300031548 Bacteria 3226
181 Ga0307405_10006111 3300031731 Bacteria 5893
182 Ga0307405_10023640 3300031731 Bacteria 3496
183 Ga0307410_10004097 3300031852 Bacteria 7463
184 Ga0307410_10450500 3300031852 Bacteria 1050
185 Ga0307406_10015511 3300031901 Bacteria 4412
186 Ga0307407_10035172 3300031903 Bacteria 2750
187 Ga0307412_10009226 3300031911 Bacteria 5655
188 Ga0307412_10052138 3300031911 Bacteria 2708
189 Ga0307409_100001262 3300031995 Bacteria 12197
190 Ga0307409_100004368 3300031995 Bacteria 7933
191 Ga0307416_100003871 3300032002 Bacteria 8910
192 Ga0307416_100115166 3300032002 Bacteria 2380
193 Ga0307414_10056633 3300032004 Bacteria 2751
194 Ga0307414_10567508 3300032004 Unclassified 1014
195 Ga0307411_10016963 3300032005 Bacteria 4134
196 Ga0307411_10034428 3300032005 Bacteria 3153
197 Ga0307411_10383368 3300032005 Bacteria 1157
198 Ga0307415_100001682 3300032126 Bacteria 10742
199 Ga0373930_0000956 3300034816 Bacteria 4135
200 Ga0373948_0006956 3300034817 Bacteria 1888
201 Ga0373926_0007570 3300035083 Bacteria 3616
202 Ga0373928_0007436 3300035084 Bacteria 2112
203 Ga0373944_0013313 3300035089 Unclassified 2279
204 Ga0373949_0005142 3300035090 Bacteria 2936
205 Ga0373951_0000936 3300035091 Bacteria 7850
206 Ga0373952_0028633 3300035092 Bacteria 1223
207 Ga0373953_0011942 3300035117 Bacteria 3061
208 Ga0373954_0000082 3300035118 Bacteria 33880
209 Ga0373960_0015419 3300035121 Unclassified 1951
210 Ga0373943_0017396 3300035170 Bacteria 3288
211 Ga0373946_0012329 3300035171 Bacteria 3198
212 Ga0373946_0036009 3300035171 Bacteria 2004
213 Ga0373955_0007680 3300035172 Bacteria 4966
214 Ga0373955_0117787 3300035172 Bacteria 1541
215 Ga0373942_0002904 3300035207 Bacteria 4065
216 Ga0373961_0006014 3300035241 Bacteria 2913
217 Ga0373924_0008352 3300035410 Bacteria 3758
218 Ga0373924_0042535 3300035410 Bacteria 1864
219 Ga0373931_0000123 3300035691 Bacteria 34923
220 Ga0373931_0005277 3300035691 Bacteria 5957
221 Ga0373931_0049370 3300035691 Bacteria 2235
222 Ga0373935_0013373 3300035692 Bacteria 4951
223 Ga0373935_0080060 3300035692 Bacteria 2121
224 Ga0373927_0063881 3300035695 Bacteria 2381
225 Ga0373933_0001013 3300035724 Bacteria 17051
226 Ga0373947_0108734 3300035725 Bacteria 1749
227 Ga0373937_0000696 3300036401 Bacteria 29326
228 Ga0373937_0011742 3300036401 Bacteria 7682
229 Ga0373937_0018426 3300036401 Bacteria 6235
230 Ga0373937_0028530 3300036401 Bacteria 5051
231 Ga0373937_0174774 3300036401 Bacteria 2016
232 Ga0373925_0021284 3300037068 Bacteria 4725
233 Ga0373925_0112746 3300037068 Unclassified 2102
234 Ga0395905_0209697 3300037471 Bacteria 1825
235 Ga0439464_0000635 3300042439 Bacteria 7462
236 Ga0451576_0026616 3300045051 Bacteria 6219
237 Ga0451576_0043218 3300045051 Bacteria 4755
238 Ga0451576_0102487 3300045051 Bacteria 2977
239 Ga0495592_0031573 3300046454 Bacteria 4002
240 Ga0495603_0007405 3300046455 Bacteria 6599
241 Ga0495629_0025371 3300046459 Bacteria 4214
242 Ga0495580_0008226 3300046472 Bacteria 8300
243 Ga0495580_0196059 3300046472 Bacteria 1392
244 Ga0495594_0055156 3300046499 Bacteria 2191
245 Ga0495608_0030379 3300046511 Bacteria 3657
246 Ga0495618_0017009 3300046514 Bacteria 4456
247 Ga0495628_0004277 3300046516 Bacteria 12699
248 Ga0495630_0010914 3300046517 Bacteria 6562
249 Ga0495666_0004404 3300046526 Bacteria 7119
250 Ga0495652_0042663 3300046529 Bacteria 3911
251 Ga0495586_0003458 3300046535 Bacteria 8466
252 Ga0495586_0006032 3300046535 Bacteria 6480
253 Ga0495587_0012604 3300046536 Bacteria 5316
254 Ga0495587_0333287 3300046536 Bacteria 847
255 Ga0495598_0027164 3300046537 Unclassified 1576
256 Ga0495667_0083007 3300046559 Bacteria 2081
257 Ga0495634_0011436 3300046642 Bacteria 6464
258 Ga0495635_0097748 3300046663 Bacteria 2007
259 Ga0495588_0001118 3300046674 Bacteria 11547
260 Ga0495599_0026712 3300046678 Bacteria 3619
261 Ga0495647_0000296 3300046681 Bacteria 13906
262 Ga0495647_0078355 3300046681 Bacteria 1336
263 Ga0495658_0003865 3300046683 Bacteria 7413
264 Ga0495658_0006613 3300046683 Bacteria 5696
265 Ga0495613_0002300 3300046689 Bacteria 14468
266 Ga0495624_0209057 3300046690 Bacteria 1184
267 Ga0495600_0012090 3300046809 Bacteria 5391
268 Ga0495581_0094314 3300047315 Bacteria 1737
269 Ga0495604_0001661 3300047317 Bacteria 18303
270 Ga0495674_0405660 3300047319 Bacteria 1100
271 Ga0495676_0121086 3300047321 Bacteria 1903
272 Ga0495680_0005343 3300047322 Bacteria 12118
273 Ga0495680_0299846 3300047322 Bacteria 1128
274 Ga0495684_0105898 3300047471 Bacteria 2125
275 Ga0495684_0377383 3300047471 Bacteria 1001
276 Ga0501032_0025016 3300049569 Bacteria 4118
277 Ga0501032_0038092 3300049569 Bacteria 3276
278 Ga0501033_0004982 3300049570 Bacteria 10559
279 Ga0501034_0134601 3300049571 Bacteria 2453
280 Ga0501034_0142077 3300049571 Bacteria 2379
281 Ga0501036_0005335 3300049572 Bacteria 10402
282 Ga0501037_0008974 3300049573 Bacteria 7323
283 Ga0501037_0027004 3300049573 Bacteria 4242
284 Ga0501038_0000189 3300049574 Bacteria 53371
285 Ga0501039_0002605 3300049575 Bacteria 13470
286 Ga0501039_0007329 3300049575 Bacteria 8404
287 Ga0501040_0000641 3300049576 Bacteria 21409
288 Ga0501040_0045402 3300049576 Unclassified 2997
289 Ga0501041_0000419 3300049577 Bacteria 21489
290 Ga0501041_0006847 3300049577 Bacteria 6679
291 Ga0501041_0052399 3300049577 Bacteria 2488
292 Ga0501042_0236834 3300049578 Archaea 1317
293 Ga0501043_0155564 3300049579 Unclassified 1788
294 Ga0501043_0368210 3300049579 Unclassified 1089
295 Ga0501046_0000156 3300049580 Bacteria 70512
296 Ga0501046_0159029 3300049580 Unclassified 1700
297 Ga0501047_0452683 3300049581 Bacteria 1113
298 Ga0501048_0006934 3300049582 Bacteria 8608
299 Ga0501048_0091308 3300049582 Bacteria 2148
300 Ga0501068_0010284 3300049584 Bacteria 5254
301 Ga0501068_0208431 3300049584 Archaea 1241
302 Ga0501069_0427147 3300049585 Bacteria 786
303 Ga0501070_0065987 3300049586 Bacteria 2997
304 Ga0501071_0007763 3300049587 Bacteria 7075
305 Ga0501072_0001123 3300049588 Bacteria 19892
306 Ga0501072_0067345 3300049588 Bacteria 2825
307 Ga0501072_0126537 3300049588 Unclassified 2036
308 Ga0501072_0253255 3300049588 Bacteria 1402
309 Ga0501074_0056206 3300049590 Bacteria 2836
310 Ga0501074_0310926 3300049590 Bacteria 1119
311 Ga0501075_0000053 3300049591 Bacteria 49110
312 Ga0501075_0098447 3300049591 Bacteria 2220
313 Ga0501076_0000699 3300049592 Bacteria 21626
314 Ga0501076_0003919 3300049592 Bacteria 10494
315 Ga0501076_0029682 3300049592 Bacteria 4254
316 Ga0501077_0000543 3300049593 Bacteria 22905
317 Ga0501077_0164236 3300049593 Bacteria 1410
318 Ga0501077_0217464 3300049593 Archaea 1214
319 Ga0501253_045575 3300049683 Bacteria 901
320 Ga0501079_0000351 3300049741 Bacteria 29422
321 Ga0501079_0005720 3300049741 Bacteria 9291
322 Ga0501079_0147079 3300049741 Unclassified 1836
323 Ga0501080_0011696 3300049742 Bacteria 8040
324 Ga0501081_0000440 3300049743 Bacteria 22990
325 Ga0501081_0006480 3300049743 Bacteria 7599
326 Ga0501083_0199321 3300049744 Unclassified 1306
327 Ga0501035_0008001 3300049822 Bacteria 9852
328 Ga0501044_0090019 3300049823 Bacteria 3097
329 Ga0501045_0001147 3300049824 Bacteria 17545
330 Ga0501045_0021006 3300049824 Bacteria 4667
331 Ga0501045_0046239 3300049824 Bacteria 3169
332 Ga0501045_0447670 3300049824 Unclassified 960
333 nmdc:mga0k408_17273_c1 3300050493 Bacteria 4017
334 nmdc:mga05p37_453_c1 3300050507 Bacteria 44606
335 nmdc:mga09592_1204_c1 3300050508 Bacteria 20724
336 nmdc:mga09592_297336_c1 3300050508 Bacteria 1400
337 nmdc:mga0qj67_13543_c1 3300050509 Bacteria 6152
338 nmdc:mga06r32_169489_c1 3300050510 Unclassified 2167
339 nmdc:mga06r32_211989_c1 3300050510 Bacteria 1925
340 nmdc:mga06r32_266981_c1 3300050510 Unclassified 1699
341 nmdc:mga08y16_1936_c1 3300050511 Bacteria 21123
342 nmdc:mga08y16_417247_c1 3300050511 Bacteria 1372
343 nmdc:mga08y16_86766_c1 3300050511 Bacteria 3261
344 nmdc:mga0n895_738_c1 3300050512 Bacteria 23103
345 nmdc:mga0rr50_257115_c1 3300050513 Bacteria 1452
346 nmdc:mga0rr50_34745_c1 3300050513 Bacteria 3613
347 nmdc:mga0rr50_7308_c1 3300050513 Bacteria 6798
348 nmdc:mga08x19_148542_c1 3300050514 Bacteria 1586
349 nmdc:mga0a205_56911_c1 3300050515 Bacteria 3775
350 nmdc:mga0a205_65426_c1 3300050515 Bacteria 3512
351 nmdc:mga0a205_98911_c1 3300050515 Bacteria 2815
352 Ga0495601_0069071 3300053077 Bacteria 2253
353 Ga0495601_0120387 3300053077 Bacteria 1704
354 Ga0495612_0096817 3300053078 Bacteria 1254
355 Ga0495619_0041501 3300053085 Bacteria 3010
356 Ga0495619_0167867 3300053085 Bacteria 1517
357 Ga0501084_0002898 3300054114 Bacteria 13881
358 Ga0501084_0212362 3300054114 Bacteria 1633
359 Ga0501084_0222744 3300054114 Bacteria 1592
360 Ga0501084_0417882 3300054114 Bacteria 1134
361 Ga0590077_008953 3300059426 Unclassified 2050
362 Ga0501082_0005532 3300060353 Bacteria 10968
363 Ga0501082_0006133 3300060353 Bacteria 10434
364 Ga0501082_0200453 3300060353 Unclassified 1736
365 Ga0530510_0000115 3300061734 Bacteria 45273
366 Ga0075430_100052930
367 Ga0070676_10195404
368 Ga0070690_100001783
369 Ga0070690_100056158
370 Ga0070670_100079715
371 Ga0070677_10005859
372 Ga0068869_100002060
373 Ga0070680_100003307
374 Ga0070682_100058635
375 Ga0068868_100003770
376 Ga0070689_100001092
377 Ga0070691_10002036
378 Ga0070687_100000798
379 Ga0070669_100494532
380 Ga0070675_100023299
381 Ga0070675_100070358
382 Ga0070675_100086276
383 Ga0070675_100621222
384 Ga0070671_100177326
385 Ga0070671_100299601
386 Ga0070674_100028993
387 Ga0070674_100078216
388 Ga0070673_100042189
389 Ga0070673_100411826
390 Ga0070673_100445484
391 Ga0070673_100831441
392 Ga0070667_100194044
393 Ga0070667_100214474
394 Ga0070701_10000854
395 Ga0070705_100000473
396 Ga0070700_100008675
397 Ga0070694_100001201
398 Ga0070694_100084162
399 Ga0070662_100038273
400 Ga0070681_10040259
401 Ga0070681_10615741
402 Ga0068867_100006649
403 Ga0070699_100282077
404 Ga0070679_100007832
405 Ga0070679_100028416
406 Ga0070697_100090532
407 Ga0070697_100347716
408 Ga0070697_100393498
409 Ga0070672_100064459
410 Ga0070672_100085115
411 Ga0070672_100471291
412 Ga0070686_100002127
413 Ga0070686_100286939
414 Ga0070695_100000891
415 Ga0070695_100359793
416 Ga0070696_100000008
417 Ga0070696_100019639
418 Ga0070696_100058001
419 Ga0070696_100247437
420 Ga0070693_100000008
421 Ga0070693_100079956
422 Ga0070665_100340047
423 Ga0070704_100002526
424 Ga0070704_100128799
425 Ga0070704_100258675
426 Ga0070704_100407380
427 Ga0068855_100070235
428 Ga0070664_100177346
429 Ga0068854_100003486
430 Ga0068856_100007752
431 Ga0070702_100000062
432 Ga0068859_100003274
433 Ga0068861_100002708
434 Ga0068851_10176893
435 Ga0068870_10100408
436 Ga0068863_100410965
437 Ga0068858_100003684
438 Ga0068860_100011051
439 Ga0068862_100008658
440 Ga0068862_100087190
441 Ga0075366_10071349
442 Ga0097621_100012215
443 Ga0068871_100000682
444 Ga0068871_100019879
445 Ga0075428_100000615
446 Ga0075428_100083984
447 Ga0075430_100018223
448 Ga0075431_100002681
449 Ga0075431_100026728
450 Ga0075431_100051127
451 Ga0075433_10034452
452 Ga0075433_10138425
453 Ga0075434_100000002
454 Ga0075429_100000150
455 Ga0068865_100001702
456 Ga0075436_100000939
457 Ga0075436_100232778
458 Ga0097620_100003274
459 Ga0075435_100021533
460 Ga0075435_100033315
461 Ga0075435_100141667
462 Ga0099794_10045775
463 Ga0099794_10278426
464 Ga0111539_10050332
465 Ga0111539_10099119
466 Ga0111539_10553555
467 Ga0105245_10000776
468 Ga0105245_10582165
469 Ga0114129_10000534
470 Ga0105243_10006740
471 Ga0105242_10013766
472 Ga0105248_10198731
473 Ga0105248_10450125
474 Ga0105249_10011784
475 Ga0105249_10021252
476 Ga0157378_10005811
477 Ga0163162_10308515
478 Ga0157375_10197034
479 Ga0157375_10272513
480 Ga0157380_10094056
481 Ga0157376_10006552
482 Ga0157376_10028031
483 Ga0157376_10459166
484 Ga0207682_10006030
485 Ga0207682_10125093
486 Ga0207682_10180236
487 Ga0207642_10001205
488 Ga0207647_10069742
489 Ga0207699_10183491
490 Ga0207645_10103860
491 Ga0207645_10104126
492 Ga0207645_10182951
493 Ga0207707_10044178
494 Ga0207707_10455708
495 Ga0207662_10075693
496 Ga0207652_10014237
497 Ga0207652_10109894
498 Ga0207681_10169307
499 Ga0207650_10001506
500 Ga0207650_10017853
501 Ga0207650_10273632
502 Ga0207659_10048393
503 Ga0207659_10130032
504 Ga0207687_10004203
505 Ga0207664_10158168
506 Ga0207644_10441708
507 Ga0207706_10033949
508 Ga0207686_10001994
509 Ga0207709_10036830
510 Ga0207709_10263352
511 Ga0207670_10002287
512 Ga0207669_10224559
513 Ga0207669_10396798
514 Ga0207704_10006990
515 Ga0207665_10070508
516 Ga0207691_10006240
517 Ga0207691_10019378
518 Ga0207691_10051428
519 Ga0207691_10082127
520 Ga0207691_10129024
521 Ga0207691_10279209
522 Ga0207691_10280804
523 Ga0207711_10281430
524 Ga0207689_10001217
525 Ga0207661_10065454
526 Ga0207679_10183559
527 Ga0207651_10039546
528 Ga0207712_10014988
529 Ga0207640_10007328
530 Ga0207658_10134648
531 Ga0207658_10305246
532 Ga0207678_10258654
533 Ga0207678_10702254
534 Ga0207708_10005256
535 Ga0207702_10132146
536 Ga0207648_10000708
537 Ga0207648_10023879
538 Ga0207648_10170640
539 Ga0207648_10452263
540 Ga0207675_100001101
541 Ga0207683_10049701
542 Ga0207698_10460482
543 Ga0207428_10036635
544 Ga0268264_10015270
545 Ga0307408_100042598
546 Ga0307405_10006111
547 Ga0307405_10023640
548 Ga0307410_10004097
549 Ga0307410_10450500
550 Ga0307406_10015511
551 Ga0307407_10035172
552 Ga0307412_10009226
553 Ga0307412_10052138
554 Ga0307409_100001262
555 Ga0307409_100004368
556 Ga0307416_100003871
557 Ga0307416_100115166
558 Ga0307414_10056633
559 Ga0307414_10567508
560 Ga0307411_10016963
561 Ga0307411_10034428
562 Ga0307411_10383368
563 Ga0307415_100001682
564 Ga0373930_0000956
565 Ga0373948_0006956
566 Ga0373926_0007570
567 Ga0373928_0007436
568 Ga0373944_0013313
569 Ga0373949_0005142
570 Ga0373951_0000936
571 Ga0373952_0028633
572 Ga0373953_0011942
573 Ga0373954_0000082
574 Ga0373960_0015419
575 Ga0373943_0017396
576 Ga0373946_0012329
577 Ga0373946_0036009
578 Ga0373955_0007680
579 Ga0373955_0117787
580 Ga0373942_0002904
581 Ga0373961_0006014
582 Ga0373924_0008352
583 Ga0373924_0042535
584 Ga0373931_0000123
585 Ga0373931_0005277
586 Ga0373931_0049370
587 Ga0373935_0013373
588 Ga0373935_0080060
589 Ga0373927_0063881
590 Ga0373933_0001013
591 Ga0373947_0108734
592 Ga0373937_0000696
593 Ga0373937_0011742
594 Ga0373937_0018426
595 Ga0373937_0028530
596 Ga0373937_0174774
597 Ga0373925_0021284
598 Ga0373925_0112746
599 Ga0395905_0209697
600 Ga0439464_0000635
601 Ga0451576_0026616
602 Ga0451576_0043218
603 Ga0451576_0102487
604 Ga0495592_0031573
605 Ga0495603_0007405
606 Ga0495629_0025371
607 Ga0495580_0008226
608 Ga0495580_0196059
609 Ga0495594_0055156
610 Ga0495608_0030379
611 Ga0495618_0017009
612 Ga0495628_0004277
613 Ga0495630_0010914
614 Ga0495666_0004404
615 Ga0495652_0042663
616 Ga0495586_0003458
617 Ga0495586_0006032
618 Ga0495587_0012604
619 Ga0495587_0333287
620 Ga0495598_0027164
621 Ga0495667_0083007
622 Ga0495634_0011436
623 Ga0495635_0097748
624 Ga0495588_0001118
625 Ga0495599_0026712
626 Ga0495647_0000296
627 Ga0495647_0078355
628 Ga0495658_0003865
629 Ga0495658_0006613
630 Ga0495613_0002300
631 Ga0495624_0209057
632 Ga0495600_0012090
633 Ga0495581_0094314
634 Ga0495604_0001661
635 Ga0495674_0405660
636 Ga0495676_0121086
637 Ga0495680_0005343
638 Ga0495680_0299846
639 Ga0495684_0105898
640 Ga0495684_0377383
641 Ga0501032_0025016
642 Ga0501032_0038092
643 Ga0501033_0004982
644 Ga0501034_0134601
645 Ga0501034_0142077
646 Ga0501036_0005335
647 Ga0501037_0008974
648 Ga0501037_0027004
649 Ga0501038_0000189
650 Ga0501039_0002605
651 Ga0501039_0007329
652 Ga0501040_0000641
653 Ga0501040_0045402
654 Ga0501041_0000419
655 Ga0501041_0006847
656 Ga0501041_0052399
657 Ga0501042_0236834
658 Ga0501043_0155564
659 Ga0501043_0368210
660 Ga0501046_0000156
661 Ga0501046_0159029
662 Ga0501047_0452683
663 Ga0501048_0006934
664 Ga0501048_0091308
665 Ga0501068_0010284
666 Ga0501068_0208431
667 Ga0501069_0427147
668 Ga0501070_0065987
669 Ga0501071_0007763
670 Ga0501072_0001123
671 Ga0501072_0067345
672 Ga0501072_0126537
673 Ga0501072_0253255
674 Ga0501074_0056206
675 Ga0501074_0310926
676 Ga0501075_0000053
677 Ga0501075_0098447
678 Ga0501076_0000699
679 Ga0501076_0003919
680 Ga0501076_0029682
681 Ga0501077_0000543
682 Ga0501077_0164236
683 Ga0501077_0217464
684 Ga0501253_045575
685 Ga0501079_0000351
686 Ga0501079_0005720
687 Ga0501079_0147079
688 Ga0501080_0011696
689 Ga0501081_0000440
690 Ga0501081_0006480
691 Ga0501083_0199321
692 Ga0501035_0008001
693 Ga0501044_0090019
694 Ga0501045_0001147
695 Ga0501045_0021006
696 Ga0501045_0046239
697 Ga0501045_0447670
698 nmdc:mga0k408_17273_c1
699 nmdc:mga05p37_453_c1
700 nmdc:mga09592_1204_c1
701 nmdc:mga09592_297336_c1
702 nmdc:mga0qj67_13543_c1
703 nmdc:mga06r32_169489_c1
704 nmdc:mga06r32_211989_c1
705 nmdc:mga06r32_266981_c1
706 nmdc:mga08y16_1936_c1
707 nmdc:mga08y16_417247_c1
708 nmdc:mga08y16_86766_c1
709 nmdc:mga0n895_738_c1
710 nmdc:mga0rr50_257115_c1
711 nmdc:mga0rr50_34745_c1
712 nmdc:mga0rr50_7308_c1
713 nmdc:mga08x19_148542_c1
714 nmdc:mga0a205_56911_c1
715 nmdc:mga0a205_65426_c1
716 nmdc:mga0a205_98911_c1
717 Ga0495601_0069071
718 Ga0495601_0120387
719 Ga0495612_0096817
720 Ga0495619_0041501
721 Ga0495619_0167867
722 Ga0501084_0002898
723 Ga0501084_0212362
724 Ga0501084_0222744
725 Ga0501084_0417882
726 Ga0590077_008953
727 Ga0501082_0005532
728 Ga0501082_0006133
729 Ga0501082_0200453
730 Ga0530510_0000115

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12570

DUF3750

Protein of unknown function (DUF3750)

48

179

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g29-assembly1.cif.gz_A structure of the catalytic domain of the salmonella virulence factor ssei 0.5386 41 92
6r99-assembly1.cif.gz_A crystal structure of human cln protein 5 (ceroid lipofuscinosis neuronal protein 5) 0.4775 23 126
7qng-assembly1.cif.gz_C structure of a mhc i-tapasin-erp57 complex 0.4734 38 95
8to0-assembly1.cif.gz_E1 48-nm repeating structure of doublets from mouse sperm flagella 0.4551 27 120
4g2b-assembly1.cif.gz_B structure of the catalytic domain of the salmonella virulence factor ssei 0.44 38 92
ID Description Score Start End Superfamily
af_Q9VH94_6_100_2.30.29.170 Mainly Beta;Roll;PH-domain like; 0.6345 35 74 2.30.29.170
2ofjD01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.5415 39 73 3.30.390.10
4g29A00 Alpha Beta;Roll;Secreted effector protein ssei fold;Secreted effector protein ssei. 0.5225 41 92 3.10.670.10
af_A4I1J2_267_409_2.30.29.170 Mainly Beta;Roll;PH-domain like; 0.509 36 124 2.30.29.170
af_I1KEN6_13_74_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.4658 42 95 2.30.30.140
ID Description Score Start End GO Terms
AF-A0A537CLQ0-F1-model_v4 DUF3750 domain-containing protein 0.9647 27 223
AF-A0A3N5PC53-F1-model_v4 DUF3750 domain-containing protein 0.9511 64 228
AF-A0A2H0QIL2-F1-model_v4 DUF3750 domain-containing protein 0.9387 27 230
AF-A0A4Q5W4V6-F1-model_v4 deleted 0.9374 42 232
AF-A0A7Z9PQU1-F1-model_v4 DUF3750 domain-containing protein 0.9344 24 229

Map