F423621

General Info

Members Datasets Scaffolds Average Seq Length
365 189 730 361

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100007184|Ga0070712_1000071849
Length 405
Sequence MSSPCTYARYVSPRFSMQDAIIRGSKTRFASPSTITTGMAAPASSLMTRVAYGMTQLPRLAWYLGHGLALRRLAEAARRNQRTKPRRRIHAAGPVPDRSRLYLDMGRLFLQDLANIEAGIYPLPADHDGSLFTLINRSRLFFTDLPEIHRRRQTGAHSEIFNTDTPAKRPRYYLQNFHFQSGGWMTDDSAERYDTQVEVLLNGTANAMRRQALPQLYELFAGRDQRQLRLLDIGCGTGRFLDFVKQAWPRLHTLGLDMSDAYIRHAKRHLSKRSRTSFVVSKAEAIPLPDSSQDAVTSIYLFHELPPKVRRSALRECARVLKPGGRLIVLDSLQRDDLPDYEGLLQLFPKNYHEPFYASYTKEDFPALALDCGLTHVRNVVAFVSKVMVFDKPPALNAADSHRGG

Samples

Sample ID Description Type Environment
1 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
55 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
93 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
94 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
95 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
119 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
120 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
123 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
124 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
130 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
137 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
140 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
145 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
146 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
147 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
186 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
189 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 17.53
Rhizosphere 80
Stem 0
Stem Tuber 0
Unclassified 6.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070712_100007184 3300006175 Bacteria 6944
2 JGI24751J29686_10009165 3300002459 Bacteria 2032
3 Ga0070670_100010997 3300005331 Bacteria 7731
4 Ga0068868_100233291 3300005338 Bacteria 1544
5 Ga0070660_100134350 3300005339 Bacteria 1982
6 Ga0070689_100030454 3300005340 Bacteria 4096
7 Ga0070692_10018863 3300005345 Bacteria 3324
8 Ga0070669_100271737 3300005353 Bacteria 1356
9 Ga0070671_100007474 3300005355 Bacteria 8733
10 Ga0070671_100017707 3300005355 Bacteria 5774
11 Ga0070671_100035241 3300005355 Bacteria 4146
12 Ga0070714_100071322 3300005435 Bacteria 3003
13 Ga0070713_100047429 3300005436 Bacteria 3531
14 Ga0070713_100050692 3300005436 Bacteria 3430
15 Ga0070713_100069943 3300005436 Bacteria 2962
16 Ga0070713_100158787 3300005436 Bacteria 2017
17 Ga0070711_100177548 3300005439 Bacteria 1628
18 Ga0070700_100014159 3300005441 Bacteria 4501
19 Ga0070708_100118969 3300005445 Bacteria 2434
20 Ga0070678_100014800 3300005456 Bacteria 4934
21 Ga0070678_100120476 3300005456 Bacteria 2068
22 Ga0070662_100162549 3300005457 Bacteria 1747
23 Ga0070698_100236046 3300005471 Bacteria 1762
24 Ga0070699_100003079 3300005518 Bacteria 14781
25 Ga0070672_100220588 3300005543 Bacteria 1590
26 Ga0070665_100203223 3300005548 Bacteria 1981
27 Ga0070704_100269164 3300005549 Bacteria 1407
28 Ga0068854_100011182 3300005578 Bacteria 5832
29 Ga0068856_100126511 3300005614 Bacteria 2559
30 Ga0068864_100010973 3300005618 Bacteria 7490
31 Ga0068863_100071955 3300005841 Bacteria 3272
32 Ga0068858_100003199 3300005842 Bacteria 16359
33 Ga0068858_100132834 3300005842 Bacteria 2335
34 Ga0081455_10011777 3300005937 Bacteria 8759
35 Ga0081455_10034985 3300005937 Bacteria 4495
36 Ga0081455_10057821 3300005937 Bacteria 3285
37 Ga0081455_10095770 3300005937 Bacteria 2395
38 Ga0081538_10061592 3300005981 Bacteria 2147
39 Ga0081539_10041594 3300005985 Bacteria 2684
40 Ga0075365_10140148 3300006038 Bacteria 1678
41 Ga0075432_10003369 3300006058 Bacteria 5403
42 Ga0070712_100138376 3300006175 Bacteria 1855
43 Ga0075428_100103411 3300006844 Bacteria 3106
44 Ga0075428_100208603 3300006844 Bacteria 2111
45 Ga0075430_100073047 3300006846 Bacteria 2876
46 Ga0075431_100060110 3300006847 Bacteria 3922
47 Ga0075431_100111341 3300006847 Bacteria 2825
48 Ga0075433_10000374 3300006852 Bacteria 28158
49 Ga0075433_10093356 3300006852 Bacteria 2662
50 Ga0075433_10102316 3300006852 Bacteria 2537
51 Ga0075433_10191648 3300006852 Bacteria 1818
52 Ga0075434_100030772 3300006871 Bacteria 5288
53 Ga0075434_100048001 3300006871 Bacteria 4237
54 Ga0075434_100058585 3300006871 Bacteria 3828
55 Ga0075434_100083715 3300006871 Bacteria 3188
56 Ga0075434_100140247 3300006871 Bacteria 2437
57 Ga0075429_100079253 3300006880 Bacteria 2863
58 Ga0075429_100249295 3300006880 Bacteria 1555
59 Ga0075435_100023340 3300007076 Bacteria 4782
60 Ga0075435_100141830 3300007076 Bacteria 2016
61 Ga0099794_10042846 3300007265 Bacteria 2159
62 Ga0111539_10063769 3300009094 Bacteria 4360
63 Ga0111539_10092620 3300009094 Bacteria 3551
64 Ga0111539_10140132 3300009094 Bacteria 2831
65 Ga0105245_10168343 3300009098 Bacteria 2085
66 Ga0105247_10027559 3300009101 Bacteria 3435
67 Ga0105247_10068915 3300009101 Bacteria 2206
68 Ga0114129_10001978 3300009147 Bacteria 28018
69 Ga0114129_10043403 3300009147 Bacteria 6325
70 Ga0114129_10058628 3300009147 Bacteria 5385
71 Ga0114129_10148058 3300009147 Bacteria 3215
72 Ga0105242_10168315 3300009176 Bacteria 1924
73 Ga0105248_10133571 3300009177 Bacteria 2800
74 Ga0105249_10031443 3300009553 Bacteria 4801
75 Ga0105239_10011824 3300010375 Bacteria 9740
76 Ga0105246_10077247 3300011119 Bacteria 2362
77 Ga0157374_10009543 3300013296 Bacteria 8334
78 Ga0157380_10199324 3300014326 Unclassified 1774
79 Ga0157377_10008482 3300014745 Bacteria 5014
80 Ga0157379_10035304 3300014968 Bacteria 4458
81 Ga0157376_10029671 3300014969 Bacteria 4358
82 Ga0213875_10000396 3300021388 Bacteria 38430
83 Ga0207710_10021569 3300025900 Bacteria 2762
84 Ga0207645_10058538 3300025907 Bacteria 2460
85 Ga0207684_10010342 3300025910 Bacteria 8213
86 Ga0207693_10014081 3300025915 Bacteria 6440
87 Ga0207663_10235593 3300025916 Bacteria 1340
88 Ga0207662_10043607 3300025918 Bacteria 2646
89 Ga0207657_10062232 3300025919 Bacteria 3196
90 Ga0207650_10030325 3300025925 Bacteria 3894
91 Ga0207659_10008802 3300025926 Bacteria 6288
92 Ga0207659_10090367 3300025926 Bacteria 2285
93 Ga0207687_10064676 3300025927 Bacteria 2595
94 Ga0207700_10284380 3300025928 Bacteria 1424
95 Ga0207664_10066474 3300025929 Bacteria 2890
96 Ga0207644_10009979 3300025931 Bacteria 6251
97 Ga0207690_10036339 3300025932 Bacteria 3189
98 Ga0207706_10040985 3300025933 Bacteria 4105
99 Ga0207706_10199366 3300025933 Bacteria 1756
100 Ga0207686_10010070 3300025934 Bacteria 5143
101 Ga0207686_10111373 3300025934 Bacteria 1847
102 Ga0207670_10023870 3300025936 Bacteria 3813
103 Ga0207670_10090919 3300025936 Bacteria 2157
104 Ga0207669_10017529 3300025937 Bacteria 3676
105 Ga0207704_10034165 3300025938 Bacteria 2899
106 Ga0207665_10116425 3300025939 Bacteria 1884
107 Ga0207691_10033707 3300025940 Bacteria 4768
108 Ga0207711_10037243 3300025941 Bacteria 4131
109 Ga0207651_10010674 3300025960 Bacteria 5103
110 Ga0207712_10009508 3300025961 Bacteria 6150
111 Ga0207668_10166362 3300025972 Bacteria 1724
112 Ga0207677_10003640 3300026023 Bacteria 8176
113 Ga0207639_10233514 3300026041 Bacteria 1595
114 Ga0207678_10009355 3300026067 Bacteria 8626
115 Ga0207708_10056100 3300026075 Bacteria 3004
116 Ga0207641_10042930 3300026088 Bacteria 3795
117 Ga0207648_10005183 3300026089 Bacteria 13196
118 Ga0207676_10011465 3300026095 Bacteria 6336
119 Ga0207675_100015323 3300026118 Bacteria 7153
120 Ga0207683_10069242 3300026121 Bacteria 3116
121 Ga0207428_10069205 3300027907 Bacteria 2775
122 Ga0268266_10018431 3300028379 Bacteria 5948
123 Ga0268266_10072178 3300028379 Bacteria 2993
124 Ga0307410_10074863 3300031852 Bacteria 2359
125 Ga0373945_0037066 3300035116 Bacteria 1749
126 Ga0373957_0020125 3300035120 Bacteria 2355
127 Ga0373943_0034252 3300035170 Bacteria 2422
128 Ga0373943_0173227 3300035170 Bacteria 1182
129 Ga0373946_0009137 3300035171 Bacteria 3647
130 Ga0373946_0040460 3300035171 Bacteria 1907
131 Ga0373955_0033676 3300035172 Bacteria 2700
132 Ga0373955_0035402 3300035172 Bacteria 2644
133 Ga0373924_0012877 3300035410 Bacteria 3133
134 Ga0373931_0035874 3300035691 Bacteria 2581
135 Ga0373931_0039553 3300035691 Bacteria 2471
136 Ga0373935_0037226 3300035692 Bacteria 3044
137 Ga0373935_0142556 3300035692 Unclassified 1620
138 Ga0373927_0008441 3300035695 Bacteria 6927
139 Ga0373927_0031897 3300035695 Plasmid 3432
140 Ga0373947_0025924 3300035725 Plasmid 3420
141 Ga0373947_0271549 3300035725 Unclassified 1126
142 Ga0373937_0001477 3300036401 Bacteria 19704
143 Ga0373937_0010109 3300036401 Bacteria 8229
144 Ga0373937_0038493 3300036401 Bacteria 4357
145 Ga0373925_0012163 3300037068 Bacteria 6230
146 Ga0373925_0031361 3300037068 Bacteria 3905
147 Ga0373925_0042968 3300037068 Unclassified 3353
148 Ga0373925_0110172 3300037068 Unclassified 2126
149 Ga0395898_0065266 3300037466 Bacteria 3529
150 Ga0395898_0301858 3300037466 Unclassified 1527
151 Ga0395905_0005509 3300037471 Bacteria 12917
152 Ga0436364_0326197 3300037853 Bacteria 29256
153 Ga0436364_1219069 3300037853 Bacteria 6946
154 Ga0395901_0010410 3300038443 Bacteria 9421
155 Ga0395901_0057200 3300038443 Bacteria 4056
156 Ga0436365_1024681 3300039437 Bacteria 4523
157 Ga0436365_1104008 3300039437 Bacteria 2043
158 Ga0436365_1814608 3300039437 Bacteria 1315
159 Ga0436360_1209691 3300039438 Bacteria 1946
160 Ga0436361_0500930 3300039447 Bacteria 4731
161 Ga0495603_0024227 3300046455 Bacteria 3670
162 Ga0495603_0028968 3300046455 Plasmid 3340
163 Ga0495629_0009334 3300046459 Bacteria 7177
164 Ga0495629_0016437 3300046459 Bacteria 5312
165 Ga0495629_0027702 3300046459 Bacteria 4023
166 Ga0495629_0036013 3300046459 Plasmid 3496
167 Ga0495638_0015579 3300046460 Bacteria 5105
168 Ga0495638_0022106 3300046460 Bacteria 4178
169 Ga0495641_0050055 3300046461 Unclassified 1911
170 Ga0495651_0067723 3300046462 Unclassified 2723
171 Ga0495651_0070819 3300046462 Bacteria 2652
172 Ga0495653_0021824 3300046463 Bacteria 5182
173 Ga0495653_0023189 3300046463 Bacteria 5019
174 Ga0495653_0057048 3300046463 Bacteria 2975
175 Ga0495653_0072704 3300046463 Bacteria 2567
176 Ga0495580_0041873 3300046472 Bacteria 3264
177 Ga0495580_0124754 3300046472 Bacteria 1787
178 Ga0495582_0052470 3300046473 Bacteria 2249
179 Ga0495639_0022979 3300046475 Bacteria 2738
180 Ga0495662_0020572 3300046476 Bacteria 3193
181 Ga0495662_0030297 3300046476 Bacteria 2611
182 Ga0495662_0045308 3300046476 Bacteria 2123
183 Ga0495662_0074779 3300046476 Bacteria 1644
184 Ga0495664_0005157 3300046477 Bacteria 7169
185 Ga0495664_0015660 3300046477 Plasmid 4313
186 Ga0495664_0082697 3300046477 Bacteria 1926
187 Ga0495585_0062515 3300046492 Bacteria 2045
188 Ga0495594_0015859 3300046499 Bacteria 3963
189 Ga0495594_0035221 3300046499 Bacteria 2726
190 Ga0495607_0054038 3300046501 Bacteria 2316
191 Ga0495608_0027242 3300046511 Bacteria 3889
192 Ga0495608_0031570 3300046511 Bacteria 3581
193 Ga0495618_0011963 3300046514 Bacteria 5266
194 Ga0495618_0024679 3300046514 Bacteria 3725
195 Ga0495628_0012179 3300046516 Bacteria 7249
196 Ga0495630_0043895 3300046517 Bacteria 3340
197 Ga0495663_0024064 3300046525 Bacteria 1769
198 Ga0495666_0029416 3300046526 Bacteria 2702
199 Ga0495666_0045973 3300046526 Unclassified 2105
200 Ga0495652_0036470 3300046529 Unclassified 4275
201 Ga0495652_0054069 3300046529 Bacteria 3420
202 Ga0495652_0059774 3300046529 Bacteria 3224
203 Ga0495665_0071770 3300046531 Bacteria 1823
204 Ga0495640_0002378 3300046533 Bacteria 15099
205 Ga0495640_0013991 3300046533 Bacteria 6088
206 Ga0495640_0085272 3300046533 Bacteria 2093
207 Ga0495667_0020351 3300046559 Bacteria 4478
208 Ga0495667_0029216 3300046559 Unclassified 3710
209 Ga0495667_0043626 3300046559 Bacteria 2971
210 Ga0495635_0005126 3300046663 Bacteria 9116
211 Ga0495635_0013707 3300046663 Bacteria 5671
212 Ga0495635_0037891 3300046663 Bacteria 3338
213 Ga0495635_0041080 3300046663 Bacteria 3195
214 Ga0495659_0097710 3300046664 Bacteria 1134
215 Ga0495588_0028935 3300046674 Bacteria 2777
216 Ga0495599_0006239 3300046678 Bacteria 7185
217 Ga0495646_0024643 3300046680 Bacteria 3788
218 Ga0495647_0020253 3300046681 Unclassified 2385
219 Ga0495658_0004484 3300046683 Bacteria 6870
220 Ga0495613_0014340 3300046689 Bacteria 5883
221 Ga0495613_0023494 3300046689 Bacteria 4593
222 Ga0495624_0066716 3300046690 Bacteria 2246
223 Ga0495670_0090090 3300046691 Bacteria 1569
224 Ga0495649_0027494 3300046694 Bacteria 3157
225 Ga0495600_0005324 3300046809 Bacteria 7752
226 Ga0495600_0010625 3300046809 Bacteria 5719
227 Ga0495600_0016593 3300046809 Bacteria 4677
228 Ga0495581_0012025 3300047315 Bacteria 5007
229 Ga0495581_0083334 3300047315 Unclassified 1852
230 Ga0495581_0159572 3300047315 Unclassified 1318
231 Ga0495604_0008408 3300047317 Bacteria 8156
232 Ga0495674_0005793 3300047319 Bacteria 11847
233 Ga0495674_0008978 3300047319 Bacteria 9498
234 Ga0495674_0022233 3300047319 Bacteria 5848
235 Ga0495674_0069054 3300047319 Plasmid 3056
236 Ga0495676_0019497 3300047321 Bacteria 5963
237 Ga0495676_0044948 3300047321 Bacteria 3600
238 Ga0495676_0146418 3300047321 Unclassified 1686
239 Ga0495680_0002106 3300047322 Bacteria 20671
240 Ga0495680_0010736 3300047322 Bacteria 8162
241 Ga0495680_0018759 3300047322 Bacteria 5863
242 Ga0495680_0067671 3300047322 Bacteria 2730
243 Ga0495684_0006124 3300047471 Bacteria 9360
244 Ga0495684_0014446 3300047471 Bacteria 6075
245 Ga0495684_0028719 3300047471 Bacteria 4270
246 Ga0495593_0022328 3300047673 Bacteria 3527
247 Ga0495602_0018832 3300048088 Bacteria 6875
248 Ga0495602_0135991 3300048088 Bacteria 1952
249 Ga0495614_0045843 3300048089 Bacteria 1875
250 Ga0495614_0073562 3300048089 Bacteria 1475
251 Ga0496100_0004586 3300048903 Bacteria 7342
252 Ga0496100_0007129 3300048903 Bacteria 6140
253 Ga0496101_0001219 3300048904 Bacteria 15403
254 Ga0496101_0008021 3300048904 Bacteria 6882
255 Ga0496102_0005386 3300048905 Bacteria 10864
256 Ga0496102_0017615 3300048905 Bacteria 6259
257 Ga0496102_0040093 3300048905 Bacteria 4235
258 Ga0496102_0170377 3300048905 Bacteria 2050
259 Ga0496103_0001824 3300048906 Bacteria 13872
260 Ga0496103_0026720 3300048906 Bacteria 3493
261 Ga0496104_0000736 3300048907 Bacteria 28143
262 Ga0496104_0002119 3300048907 Bacteria 17227
263 Ga0496104_0006427 3300048907 Bacteria 10332
264 Ga0496104_0007253 3300048907 Bacteria 9782
265 Ga0496104_0072953 3300048907 Bacteria 3265
266 Ga0496104_0096388 3300048907 Bacteria 2830
267 Ga0496104_0192730 3300048907 Unclassified 1950
268 Ga0496105_0001573 3300048908 Bacteria 16183
269 Ga0496105_0015334 3300048908 Bacteria 6104
270 Ga0496105_0029636 3300048908 Bacteria 4480
271 Ga0496105_0031753 3300048908 Bacteria 4331
272 Ga0496105_0123726 3300048908 Bacteria 2132
273 Ga0496105_0127023 3300048908 Bacteria 2102
274 Ga0496105_0143680 3300048908 Bacteria 1963
275 Ga0496106_0003428 3300048909 Bacteria 11817
276 Ga0496106_0025766 3300048909 Bacteria 4376
277 Ga0496106_0270889 3300048909 Bacteria 1359
278 Ga0496107_0002637 3300048910 Bacteria 11729
279 Ga0496107_0005150 3300048910 Bacteria 8922
280 Ga0496108_0003138 3300048911 Bacteria 13287
281 Ga0496108_0040271 3300048911 Bacteria 3894
282 Ga0496108_0043286 3300048911 Bacteria 3761
283 Ga0496108_0132080 3300048911 Bacteria 2146
284 Ga0496108_0307283 3300048911 Bacteria 1382
285 Ga0496109_0003820 3300048912 Bacteria 12580
286 Ga0496109_0015495 3300048912 Bacteria 6646
287 Ga0496109_0038458 3300048912 Bacteria 4325
288 Ga0496109_0086816 3300048912 Bacteria 2889
289 Ga0496110_0007853 3300048913 Bacteria 8547
290 Ga0496110_0008039 3300048913 Bacteria 8458
291 Ga0496110_0025750 3300048913 Bacteria 5028
292 Ga0496110_0052812 3300048913 Bacteria 3571
293 Ga0496110_0075290 3300048913 Bacteria 2999
294 Ga0496110_0092710 3300048913 Unclassified 2703
295 Ga0496111_0000763 3300048914 Bacteria 17195
296 Ga0496111_0010670 3300048914 Bacteria 6177
297 Ga0496111_0014383 3300048914 Bacteria 5404
298 Ga0496111_0059788 3300048914 Bacteria 2761
299 Ga0496112_0001423 3300048915 Bacteria 18322
300 Ga0496112_0002328 3300048915 Bacteria 15243
301 Ga0496112_0002901 3300048915 Bacteria 13961
302 Ga0496112_0063049 3300048915 Bacteria 3656
303 Ga0496112_0067801 3300048915 Bacteria 3522
304 Ga0496113_0010683 3300048916 Bacteria 6081
305 Ga0496113_0012978 3300048916 Bacteria 5621
306 Ga0496113_0032348 3300048916 Bacteria 3802
307 Ga0496113_0122678 3300048916 Bacteria 2033
308 Ga0496113_0224346 3300048916 Bacteria 1498
309 Ga0496114_0003793 3300048917 Bacteria 11648
310 Ga0496114_0081059 3300048917 Bacteria 2741
311 Ga0496115_0008748 3300048918 Bacteria 7505
312 Ga0496115_0068355 3300048918 Bacteria 2876
313 Ga0496115_0198646 3300048918 Unclassified 1657
314 Ga0496115_0312882 3300048918 Bacteria 1286
315 Ga0501077_0111448 3300049593 Bacteria 1734
316 Ga0501081_0093985 3300049743 Bacteria 2112
317 nmdc:mga0yw44_152524_c1 3300050492 Bacteria 1508
318 nmdc:mga05p37_122159_c1 3300050507 Bacteria 3199
319 nmdc:mga05p37_127801_c1 3300050507 Bacteria 3120
320 nmdc:mga05p37_21096_c1 3300050507 Bacteria 7886
321 nmdc:mga05p37_22563_c1 3300050507 Bacteria 7632
322 nmdc:mga05p37_531_c1 3300050507 Bacteria 42040
323 nmdc:mga09592_58178_c1 3300050508 Bacteria 3269
324 nmdc:mga09592_8311_c1 3300050508 Bacteria 8442
325 nmdc:mga0qj67_34_c1 3300050509 Bacteria 96663
326 nmdc:mga0qj67_403945_c1 3300050509 Bacteria 1102
327 nmdc:mga0qj67_413_c1 3300050509 Bacteria 29228
328 nmdc:mga0qj67_70401_c1 3300050509 Bacteria 2790
329 nmdc:mga06r32_103402_c1 3300050510 Bacteria 2797
330 nmdc:mga06r32_165784_c1 3300050510 Bacteria 2192
331 nmdc:mga06r32_1915_c1 3300050510 Bacteria 18535
332 nmdc:mga06r32_61346_c1 3300050510 Bacteria 3619
333 nmdc:mga08y16_112455_c1 3300050511 Bacteria 2835
334 nmdc:mga08y16_15797_c1 3300050511 Bacteria 7938
335 nmdc:mga08y16_167096_c1 3300050511 Unclassified 2285
336 nmdc:mga08y16_178196_c1 3300050511 Unclassified 2208
337 nmdc:mga08y16_78474_c1 3300050511 Bacteria 3442
338 nmdc:mga0n895_144346_c1 3300050512 Bacteria 2409
339 nmdc:mga0n895_209_c1 3300050512 Bacteria 36635
340 nmdc:mga0n895_63847_c1 3300050512 Bacteria 3642
341 nmdc:mga0n895_77113_c1 3300050512 Bacteria 3315
342 nmdc:mga0n895_98337_c1 3300050512 Bacteria 2933
343 nmdc:mga0n895_98609_c1 3300050512 Bacteria 2929
344 nmdc:mga0rr50_591_c1 3300050513 Bacteria 19417
345 nmdc:mga08x19_112760_c1 3300050514 Unclassified 1815
346 nmdc:mga0a205_1233_c1 3300050515 Bacteria 21462
347 nmdc:mga0a205_184360_c1 3300050515 Bacteria 1981
348 nmdc:mga0a205_267225_c1 3300050515 Bacteria 1588
349 nmdc:mga0a205_36946_c1 3300050515 Bacteria 4695
350 Ga0495601_0000692 3300053077 Bacteria 18079
351 Ga0495601_0021841 3300053077 Bacteria 3923
352 Ga0495601_0048875 3300053077 Bacteria 2665
353 Ga0495601_0082307 3300053077 Bacteria 2066
354 Ga0495601_0137629 3300053077 Unclassified 1592
355 Ga0495612_0005215 3300053078 Bacteria 5370
356 Ga0495612_0008126 3300053078 Bacteria 4268
357 Ga0495612_0032553 3300053078 Bacteria 2107
358 Ga0495595_0005953 3300053084 Bacteria 4949
359 Ga0495595_0048575 3300053084 Unclassified 1960
360 Ga0495619_0000275 3300053085 Bacteria 37064
361 Ga0495619_0000753 3300053085 Bacteria 21116
362 Ga0495619_0001559 3300053085 Bacteria 15073
363 Ga0495619_0026042 3300053085 Bacteria 3760
364 Ga0530510_0083797 3300061734 Bacteria 2322
365 2882462842 2882456835 Bacteria 6863978
366 Ga0070712_100007184
367 JGI24751J29686_10009165
368 Ga0070670_100010997
369 Ga0068868_100233291
370 Ga0070660_100134350
371 Ga0070689_100030454
372 Ga0070692_10018863
373 Ga0070669_100271737
374 Ga0070671_100007474
375 Ga0070671_100017707
376 Ga0070671_100035241
377 Ga0070714_100071322
378 Ga0070713_100047429
379 Ga0070713_100050692
380 Ga0070713_100069943
381 Ga0070713_100158787
382 Ga0070711_100177548
383 Ga0070700_100014159
384 Ga0070708_100118969
385 Ga0070678_100014800
386 Ga0070678_100120476
387 Ga0070662_100162549
388 Ga0070698_100236046
389 Ga0070699_100003079
390 Ga0070672_100220588
391 Ga0070665_100203223
392 Ga0070704_100269164
393 Ga0068854_100011182
394 Ga0068856_100126511
395 Ga0068864_100010973
396 Ga0068863_100071955
397 Ga0068858_100003199
398 Ga0068858_100132834
399 Ga0081455_10011777
400 Ga0081455_10034985
401 Ga0081455_10057821
402 Ga0081455_10095770
403 Ga0081538_10061592
404 Ga0081539_10041594
405 Ga0075365_10140148
406 Ga0075432_10003369
407 Ga0070712_100138376
408 Ga0075428_100103411
409 Ga0075428_100208603
410 Ga0075430_100073047
411 Ga0075431_100060110
412 Ga0075431_100111341
413 Ga0075433_10000374
414 Ga0075433_10093356
415 Ga0075433_10102316
416 Ga0075433_10191648
417 Ga0075434_100030772
418 Ga0075434_100048001
419 Ga0075434_100058585
420 Ga0075434_100083715
421 Ga0075434_100140247
422 Ga0075429_100079253
423 Ga0075429_100249295
424 Ga0075435_100023340
425 Ga0075435_100141830
426 Ga0099794_10042846
427 Ga0111539_10063769
428 Ga0111539_10092620
429 Ga0111539_10140132
430 Ga0105245_10168343
431 Ga0105247_10027559
432 Ga0105247_10068915
433 Ga0114129_10001978
434 Ga0114129_10043403
435 Ga0114129_10058628
436 Ga0114129_10148058
437 Ga0105242_10168315
438 Ga0105248_10133571
439 Ga0105249_10031443
440 Ga0105239_10011824
441 Ga0105246_10077247
442 Ga0157374_10009543
443 Ga0157380_10199324
444 Ga0157377_10008482
445 Ga0157379_10035304
446 Ga0157376_10029671
447 Ga0213875_10000396
448 Ga0207710_10021569
449 Ga0207645_10058538
450 Ga0207684_10010342
451 Ga0207693_10014081
452 Ga0207663_10235593
453 Ga0207662_10043607
454 Ga0207657_10062232
455 Ga0207650_10030325
456 Ga0207659_10008802
457 Ga0207659_10090367
458 Ga0207687_10064676
459 Ga0207700_10284380
460 Ga0207664_10066474
461 Ga0207644_10009979
462 Ga0207690_10036339
463 Ga0207706_10040985
464 Ga0207706_10199366
465 Ga0207686_10010070
466 Ga0207686_10111373
467 Ga0207670_10023870
468 Ga0207670_10090919
469 Ga0207669_10017529
470 Ga0207704_10034165
471 Ga0207665_10116425
472 Ga0207691_10033707
473 Ga0207711_10037243
474 Ga0207651_10010674
475 Ga0207712_10009508
476 Ga0207668_10166362
477 Ga0207677_10003640
478 Ga0207639_10233514
479 Ga0207678_10009355
480 Ga0207708_10056100
481 Ga0207641_10042930
482 Ga0207648_10005183
483 Ga0207676_10011465
484 Ga0207675_100015323
485 Ga0207683_10069242
486 Ga0207428_10069205
487 Ga0268266_10018431
488 Ga0268266_10072178
489 Ga0307410_10074863
490 Ga0373945_0037066
491 Ga0373957_0020125
492 Ga0373943_0034252
493 Ga0373943_0173227
494 Ga0373946_0009137
495 Ga0373946_0040460
496 Ga0373955_0033676
497 Ga0373955_0035402
498 Ga0373924_0012877
499 Ga0373931_0035874
500 Ga0373931_0039553
501 Ga0373935_0037226
502 Ga0373935_0142556
503 Ga0373927_0008441
504 Ga0373927_0031897
505 Ga0373947_0025924
506 Ga0373947_0271549
507 Ga0373937_0001477
508 Ga0373937_0010109
509 Ga0373937_0038493
510 Ga0373925_0012163
511 Ga0373925_0031361
512 Ga0373925_0042968
513 Ga0373925_0110172
514 Ga0395898_0065266
515 Ga0395898_0301858
516 Ga0395905_0005509
517 Ga0436364_0326197
518 Ga0436364_1219069
519 Ga0395901_0010410
520 Ga0395901_0057200
521 Ga0436365_1024681
522 Ga0436365_1104008
523 Ga0436365_1814608
524 Ga0436360_1209691
525 Ga0436361_0500930
526 Ga0495603_0024227
527 Ga0495603_0028968
528 Ga0495629_0009334
529 Ga0495629_0016437
530 Ga0495629_0027702
531 Ga0495629_0036013
532 Ga0495638_0015579
533 Ga0495638_0022106
534 Ga0495641_0050055
535 Ga0495651_0067723
536 Ga0495651_0070819
537 Ga0495653_0021824
538 Ga0495653_0023189
539 Ga0495653_0057048
540 Ga0495653_0072704
541 Ga0495580_0041873
542 Ga0495580_0124754
543 Ga0495582_0052470
544 Ga0495639_0022979
545 Ga0495662_0020572
546 Ga0495662_0030297
547 Ga0495662_0045308
548 Ga0495662_0074779
549 Ga0495664_0005157
550 Ga0495664_0015660
551 Ga0495664_0082697
552 Ga0495585_0062515
553 Ga0495594_0015859
554 Ga0495594_0035221
555 Ga0495607_0054038
556 Ga0495608_0027242
557 Ga0495608_0031570
558 Ga0495618_0011963
559 Ga0495618_0024679
560 Ga0495628_0012179
561 Ga0495630_0043895
562 Ga0495663_0024064
563 Ga0495666_0029416
564 Ga0495666_0045973
565 Ga0495652_0036470
566 Ga0495652_0054069
567 Ga0495652_0059774
568 Ga0495665_0071770
569 Ga0495640_0002378
570 Ga0495640_0013991
571 Ga0495640_0085272
572 Ga0495667_0020351
573 Ga0495667_0029216
574 Ga0495667_0043626
575 Ga0495635_0005126
576 Ga0495635_0013707
577 Ga0495635_0037891
578 Ga0495635_0041080
579 Ga0495659_0097710
580 Ga0495588_0028935
581 Ga0495599_0006239
582 Ga0495646_0024643
583 Ga0495647_0020253
584 Ga0495658_0004484
585 Ga0495613_0014340
586 Ga0495613_0023494
587 Ga0495624_0066716
588 Ga0495670_0090090
589 Ga0495649_0027494
590 Ga0495600_0005324
591 Ga0495600_0010625
592 Ga0495600_0016593
593 Ga0495581_0012025
594 Ga0495581_0083334
595 Ga0495581_0159572
596 Ga0495604_0008408
597 Ga0495674_0005793
598 Ga0495674_0008978
599 Ga0495674_0022233
600 Ga0495674_0069054
601 Ga0495676_0019497
602 Ga0495676_0044948
603 Ga0495676_0146418
604 Ga0495680_0002106
605 Ga0495680_0010736
606 Ga0495680_0018759
607 Ga0495680_0067671
608 Ga0495684_0006124
609 Ga0495684_0014446
610 Ga0495684_0028719
611 Ga0495593_0022328
612 Ga0495602_0018832
613 Ga0495602_0135991
614 Ga0495614_0045843
615 Ga0495614_0073562
616 Ga0496100_0004586
617 Ga0496100_0007129
618 Ga0496101_0001219
619 Ga0496101_0008021
620 Ga0496102_0005386
621 Ga0496102_0017615
622 Ga0496102_0040093
623 Ga0496102_0170377
624 Ga0496103_0001824
625 Ga0496103_0026720
626 Ga0496104_0000736
627 Ga0496104_0002119
628 Ga0496104_0006427
629 Ga0496104_0007253
630 Ga0496104_0072953
631 Ga0496104_0096388
632 Ga0496104_0192730
633 Ga0496105_0001573
634 Ga0496105_0015334
635 Ga0496105_0029636
636 Ga0496105_0031753
637 Ga0496105_0123726
638 Ga0496105_0127023
639 Ga0496105_0143680
640 Ga0496106_0003428
641 Ga0496106_0025766
642 Ga0496106_0270889
643 Ga0496107_0002637
644 Ga0496107_0005150
645 Ga0496108_0003138
646 Ga0496108_0040271
647 Ga0496108_0043286
648 Ga0496108_0132080
649 Ga0496108_0307283
650 Ga0496109_0003820
651 Ga0496109_0015495
652 Ga0496109_0038458
653 Ga0496109_0086816
654 Ga0496110_0007853
655 Ga0496110_0008039
656 Ga0496110_0025750
657 Ga0496110_0052812
658 Ga0496110_0075290
659 Ga0496110_0092710
660 Ga0496111_0000763
661 Ga0496111_0010670
662 Ga0496111_0014383
663 Ga0496111_0059788
664 Ga0496112_0001423
665 Ga0496112_0002328
666 Ga0496112_0002901
667 Ga0496112_0063049
668 Ga0496112_0067801
669 Ga0496113_0010683
670 Ga0496113_0012978
671 Ga0496113_0032348
672 Ga0496113_0122678
673 Ga0496113_0224346
674 Ga0496114_0003793
675 Ga0496114_0081059
676 Ga0496115_0008748
677 Ga0496115_0068355
678 Ga0496115_0198646
679 Ga0496115_0312882
680 Ga0501077_0111448
681 Ga0501081_0093985
682 nmdc:mga0yw44_152524_c1
683 nmdc:mga05p37_122159_c1
684 nmdc:mga05p37_127801_c1
685 nmdc:mga05p37_21096_c1
686 nmdc:mga05p37_22563_c1
687 nmdc:mga05p37_531_c1
688 nmdc:mga09592_58178_c1
689 nmdc:mga09592_8311_c1
690 nmdc:mga0qj67_34_c1
691 nmdc:mga0qj67_403945_c1
692 nmdc:mga0qj67_413_c1
693 nmdc:mga0qj67_70401_c1
694 nmdc:mga06r32_103402_c1
695 nmdc:mga06r32_165784_c1
696 nmdc:mga06r32_1915_c1
697 nmdc:mga06r32_61346_c1
698 nmdc:mga08y16_112455_c1
699 nmdc:mga08y16_15797_c1
700 nmdc:mga08y16_167096_c1
701 nmdc:mga08y16_178196_c1
702 nmdc:mga08y16_78474_c1
703 nmdc:mga0n895_144346_c1
704 nmdc:mga0n895_209_c1
705 nmdc:mga0n895_63847_c1
706 nmdc:mga0n895_77113_c1
707 nmdc:mga0n895_98337_c1
708 nmdc:mga0n895_98609_c1
709 nmdc:mga0rr50_591_c1
710 nmdc:mga08x19_112760_c1
711 nmdc:mga0a205_1233_c1
712 nmdc:mga0a205_184360_c1
713 nmdc:mga0a205_267225_c1
714 nmdc:mga0a205_36946_c1
715 Ga0495601_0000692
716 Ga0495601_0021841
717 Ga0495601_0048875
718 Ga0495601_0082307
719 Ga0495601_0137629
720 Ga0495612_0005215
721 Ga0495612_0008126
722 Ga0495612_0032553
723 Ga0495595_0005953
724 Ga0495595_0048575
725 Ga0495619_0000275
726 Ga0495619_0000753
727 Ga0495619_0001559
728 Ga0495619_0026042
729 Ga0530510_0083797
730 2882462842

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

231

329

0.97

PF13649

Methyltransf_25

Methyltransferase domain

230

325

0.97

PF08242

Methyltransf_12

Methyltransferase domain

231

327

0.95

PF13847

Methyltransf_31

Methyltransferase domain

224

367

0.88

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

187

357

0.83

PF00891

Methyltransf_2

O-methyltransferase domain

167

346

0.79

PF13489

Methyltransf_23

Methyltransferase domain

205

378

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mgg-assembly1.cif.gz_A crystal structure of methyl transferase from methanosarcina mazei 0.8261 178 295
2gs9-assembly1.cif.gz_B crystal structure of tt1324 from thermus thermophilis hb8 0.8074 175 295
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.8027 152 354
6zxy-assembly1.cif.gz_B structure of archaeoglobus fulgidus trm11 m2g10 trna methyltransferase enzyme 0.7782 190 355
4r6x-assembly2.cif.gz_B plasmodium falciparum phosphoethanolamine methyltransferase d128a mutant in complex with s-adenosylhomocysteine and phosphoethanolamine 0.7758 138 343
ID Description Score Start End Superfamily
af_P9WK01_14_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9001 190 291 3.40.50.150
af_K7MNF0_25_231_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8671 176 284 3.40.50.150
af_A0A1D6QMW6_179_313_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8595 193 300 3.40.50.150
af_P71785_5_106_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8538 191 260 3.40.50.150
af_Q33AG7_179_362_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8404 179 353 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A524N5Z9-F1-model_v4 Class I SAM-dependent methyltransferase 0.9122 239 367 GO:0008757
GO:0032259
AF-A0A7S1HVI4-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.8996 12 360 GO:0008757
AF-A0A5E4L495-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) 0.8709 165 355 GO:0032259
GO:0043770
AF-A0A7W3N5T9-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methylase UbiE 0.8647 193 293 GO:0008757
GO:0032259
AF-A0A537DSS8-F1-model_v4 Class I SAM-dependent methyltransferase 0.862 173 299 GO:0008168
GO:0032259

Map