F423411

General Info

Members Datasets Scaffolds Average Seq Length
364 205 728 260

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0154821|Ga0451577_0154821_505_1347
Length 280
Sequence MLAAAGQFVPGESCGEHIMIRALYTAASGMNAQQTNIDNIAHNLSNVNTTGFKKSRVEFEDLVYQQLVQAGSQTSTASEAPVGLEMGLGTRPVATARDFSAGNLKNTSGPLDLAIEGRGFFQVATPDGTTAYTRAGALHLSAEGNIVTADGYQIEPNITIPANATSVTISRQGIVSVALPGQSAAQQVGTIELATFSNPAGLSALGGNLFATTTASGEPTTGVPGTDGIGTIAQGFLEESNVSVVEEMVNMILGQRAYEANSRVVRAADDMLTQVNNMVR

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
124 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
189 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
190 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
200 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
201 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
202 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
203 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.49
Nodule 0
Rhizoplane 2.2
Rhizosphere 91.76
Stem 0
Stem Tuber 0
Unclassified 3.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0154821 3300042876 Bacteria 2063
2 MBSR1b_contig_14410295 2162886012 Bacteria 2045
3 JGI25406J46586_10000178 3300003203 Bacteria 28520
4 JGI25406J46586_10007382 3300003203 Bacteria 5018
5 JGI25406J46586_10009036 3300003203 Bacteria 4479
6 JGI25406J46586_10025253 3300003203 Bacteria 2309
7 Ga0065712_10101176 3300005290 Bacteria 2042
8 Ga0065712_10149574 3300005290 Bacteria 1380
9 Ga0065712_10170885 3300005290 Bacteria 1244
10 Ga0065715_10178299 3300005293 Bacteria 1495
11 Ga0070658_10218830 3300005327 Bacteria 1610
12 Ga0070676_10185252 3300005328 Bacteria 1356
13 Ga0070683_100593705 3300005329 Bacteria 1060
14 Ga0070690_100000287 3300005330 Bacteria 25877
15 Ga0070670_100000608 3300005331 Bacteria 28090
16 Ga0070670_100008401 3300005331 Bacteria 8802
17 Ga0070670_100218728 3300005331 Bacteria 1657
18 Ga0070677_10057099 3300005333 Bacteria 1599
19 Ga0068869_100055633 3300005334 Bacteria 2884
20 Ga0070666_10002792 3300005335 Bacteria 10545
21 Ga0070682_100262408 3300005337 Bacteria 1251
22 Ga0068868_100000406 3300005338 Bacteria 29103
23 Ga0068868_100016109 3300005338 Bacteria 5545
24 Ga0070689_100050396 3300005340 Bacteria 3217
25 Ga0070689_100113097 3300005340 Bacteria 2162
26 Ga0070689_100391452 3300005340 Bacteria 1173
27 Ga0070661_100010993 3300005344 Bacteria 6308
28 Ga0070661_100098597 3300005344 Bacteria 2170
29 Ga0070661_100137532 3300005344 Bacteria 1839
30 Ga0070669_100035138 3300005353 Bacteria 3630
31 Ga0070669_100041655 3300005353 Bacteria 3340
32 Ga0070669_100146163 3300005353 Bacteria 1827
33 Ga0070675_100010730 3300005354 Bacteria 7167
34 Ga0070675_100017022 3300005354 Bacteria 5777
35 Ga0070675_100093840 3300005354 Bacteria 2517
36 Ga0070671_100024665 3300005355 Bacteria 4926
37 Ga0070671_100029048 3300005355 Bacteria 4558
38 Ga0070671_100468053 3300005355 Bacteria 1082
39 Ga0070674_100001446 3300005356 Bacteria 12624
40 Ga0070674_100017018 3300005356 Bacteria 4564
41 Ga0070674_100025873 3300005356 Bacteria 3826
42 Ga0070673_100073687 3300005364 Bacteria 2749
43 Ga0070688_100077664 3300005365 Bacteria 2140
44 Ga0070688_100299300 3300005365 Bacteria 1162
45 Ga0070667_100001977 3300005367 Bacteria 18168
46 Ga0070701_10022959 3300005438 Bacteria 2998
47 Ga0070663_100056843 3300005455 Bacteria 2805
48 Ga0070678_100035946 3300005456 Bacteria 3464
49 Ga0070662_100126097 3300005457 Bacteria 1968
50 Ga0070681_10056116 3300005458 Bacteria 3920
51 Ga0070685_10124688 3300005466 Bacteria 1603
52 Ga0070685_10531764 3300005466 Bacteria 836
53 Ga0070707_100185000 3300005468 Unclassified 2031
54 Ga0070699_100004737 3300005518 Bacteria 12024
55 Ga0070679_100280390 3300005530 Bacteria 1619
56 Ga0070684_100205823 3300005535 Bacteria 1793
57 Ga0070672_100001656 3300005543 Bacteria 13874
58 Ga0070672_100061311 3300005543 Bacteria 2965
59 Ga0070672_100300677 3300005543 Bacteria 1360
60 Ga0070672_100464343 3300005543 Bacteria 1092
61 Ga0070686_100008115 3300005544 Bacteria 5870
62 Ga0070686_100021957 3300005544 Bacteria 3799
63 Ga0070686_100186210 3300005544 Bacteria 1479
64 Ga0070665_100070800 3300005548 Bacteria 3494
65 Ga0070665_100551819 3300005548 Bacteria 1164
66 Ga0068855_100211995 3300005563 Bacteria 2176
67 Ga0070664_100008308 3300005564 Bacteria 8396
68 Ga0070664_100033476 3300005564 Bacteria 4305
69 Ga0070664_100091781 3300005564 Bacteria 2629
70 Ga0070664_100171207 3300005564 Bacteria 1926
71 Ga0070664_100250286 3300005564 Bacteria 1593
72 Ga0070664_100462150 3300005564 Bacteria 1166
73 Ga0070664_100577126 3300005564 Bacteria 1041
74 Ga0070702_100124661 3300005615 Bacteria 1618
75 Ga0068859_100031557 3300005617 Bacteria 5321
76 Ga0068859_100079021 3300005617 Bacteria 3330
77 Ga0068859_100334855 3300005617 Bacteria 1608
78 Ga0068859_100400703 3300005617 Unclassified 1468
79 Ga0068864_100001040 3300005618 Bacteria 23282
80 Ga0068864_100006337 3300005618 Bacteria 9703
81 Ga0068864_100013181 3300005618 Bacteria 6844
82 Ga0068864_100109979 3300005618 Bacteria 2453
83 Ga0068861_100158346 3300005719 Bacteria 1865
84 Ga0068870_10022866 3300005840 Bacteria 3076
85 Ga0068870_10049302 3300005840 Bacteria 2221
86 Ga0068870_10050455 3300005840 Bacteria 2199
87 Ga0068863_100028320 3300005841 Bacteria 5348
88 Ga0068863_100092810 3300005841 Bacteria 2865
89 Ga0068858_100006588 3300005842 Bacteria 11297
90 Ga0068858_100011471 3300005842 Bacteria 8362
91 Ga0068858_100350347 3300005842 Bacteria 1414
92 Ga0068858_100671649 3300005842 Bacteria 1007
93 Ga0068860_100478841 3300005843 Bacteria 1240
94 Ga0081455_10169382 3300005937 Bacteria 1665
95 Ga0081539_10000013 3300005985 Bacteria 432395
96 Ga0081539_10000746 3300005985 Bacteria 64662
97 Ga0081539_10001672 3300005985 Bacteria 35884
98 Ga0081539_10002236 3300005985 Bacteria 28174
99 Ga0081539_10030581 3300005985 Bacteria 3338
100 Ga0075368_10013650 3300006042 Bacteria 2986
101 Ga0075368_10086547 3300006042 Bacteria 1279
102 Ga0075364_10125345 3300006051 Bacteria 1721
103 Ga0075367_10007190 3300006178 Bacteria 5683
104 Ga0075367_10210944 3300006178 Unclassified 1214
105 Ga0075366_10015173 3300006195 Bacteria 4412
106 Ga0097621_100215275 3300006237 Bacteria 1672
107 Ga0097621_100301516 3300006237 Bacteria 1415
108 Ga0097621_100381142 3300006237 Unclassified 1259
109 Ga0075370_10089331 3300006353 Bacteria 1777
110 Ga0075370_10308954 3300006353 Bacteria 941
111 Ga0068871_100062273 3300006358 Unclassified 3048
112 Ga0068871_100304601 3300006358 Unclassified 1399
113 Ga0075428_100518365 3300006844 Bacteria 1275
114 Ga0075430_100003084 3300006846 Bacteria 13918
115 Ga0075431_100000739 3300006847 Bacteria 28210
116 Ga0075431_100063675 3300006847 Bacteria 3806
117 Ga0075433_10268825 3300006852 Bacteria 1511
118 Ga0068865_100024978 3300006881 Bacteria 3925
119 Ga0068865_100071087 3300006881 Bacteria 2467
120 Ga0068865_100081407 3300006881 Bacteria 2325
121 Ga0068865_100281192 3300006881 Bacteria 1325
122 Ga0097620_100031557 3300006931 Bacteria 5321
123 Ga0097620_100079014 3300006931 Bacteria 3330
124 Ga0097620_100334888 3300006931 Bacteria 1608
125 Ga0097620_100400691 3300006931 Unclassified 1468
126 Ga0111539_10017236 3300009094 Bacteria 8938
127 Ga0111539_10065386 3300009094 Bacteria 4297
128 Ga0111539_10099216 3300009094 Bacteria 3420
129 Ga0111539_10543595 3300009094 Bacteria 1353
130 Ga0105245_10426138 3300009098 Bacteria 1331
131 Ga0105247_10023167 3300009101 Bacteria 3741
132 Ga0114129_10112586 3300009147 Bacteria 3753
133 Ga0105243_10233057 3300009148 Bacteria 1634
134 Ga0105241_10309937 3300009174 Bacteria 1357
135 Ga0105241_10546283 3300009174 Bacteria 1039
136 Ga0105242_10386095 3300009176 Bacteria 1303
137 Ga0105248_10000396 3300009177 Bacteria 50386
138 Ga0105248_10014138 3300009177 Bacteria 8787
139 Ga0105248_10128210 3300009177 Bacteria 2862
140 Ga0105248_10247087 3300009177 Bacteria 2008
141 Ga0105248_10289259 3300009177 Bacteria 1845
142 Ga0105237_10582475 3300009545 Bacteria 1126
143 Ga0105238_10192333 3300009551 Bacteria 2016
144 Ga0105239_10509350 3300010375 Bacteria 1369
145 Ga0105246_10201681 3300011119 Bacteria 1547
146 Ga0105246_10317481 3300011119 Bacteria 1265
147 Ga0157374_10232471 3300013296 Bacteria 1811
148 Ga0157375_10003809 3300013308 Bacteria 13074
149 Ga0157375_10080714 3300013308 Unclassified 3292
150 Ga0157375_10174658 3300013308 Bacteria 2297
151 Ga0157375_10422710 3300013308 Bacteria 1499
152 Ga0163163_10003913 3300014325 Bacteria 12705
153 Ga0163163_10007788 3300014325 Bacteria 9467
154 Ga0163163_10016637 3300014325 Bacteria 6838
155 Ga0163163_10021534 3300014325 Bacteria 6086
156 Ga0163163_10197413 3300014325 Bacteria 2060
157 Ga0163163_10319518 3300014325 Bacteria 1606
158 Ga0163163_10548282 3300014325 Bacteria 1219
159 Ga0157380_10013421 3300014326 Bacteria 5972
160 Ga0157380_10248587 3300014326 Bacteria 1608
161 Ga0157379_10140838 3300014968 Bacteria 2174
162 Ga0157376_10020141 3300014969 Bacteria 5155
163 Ga0157376_10263729 3300014969 Unclassified 1615
164 Ga0207697_10000174 3300025315 Bacteria 32858
165 Ga0207682_10017254 3300025893 Bacteria 2818
166 Ga0207682_10030041 3300025893 Bacteria 2175
167 Ga0207710_10043874 3300025900 Bacteria 1990
168 Ga0207688_10015203 3300025901 Bacteria 4175
169 Ga0207688_10294252 3300025901 Bacteria 992
170 Ga0207680_10013314 3300025903 Bacteria 4222
171 Ga0207645_10114818 3300025907 Bacteria 1745
172 Ga0207645_10155109 3300025907 Bacteria 1496
173 Ga0207705_10165711 3300025909 Bacteria 1662
174 Ga0207671_10063053 3300025914 Bacteria 2753
175 Ga0207660_10152342 3300025917 Bacteria 1777
176 Ga0207662_10150068 3300025918 Bacteria 1482
177 Ga0207649_10015277 3300025920 Bacteria 4314
178 Ga0207649_10235326 3300025920 Bacteria 1312
179 Ga0207649_10496377 3300025920 Bacteria 928
180 Ga0207652_10298312 3300025921 Bacteria 1454
181 Ga0207650_10004926 3300025925 Bacteria 9119
182 Ga0207650_10023130 3300025925 Bacteria 4406
183 Ga0207650_10516512 3300025925 Bacteria 999
184 Ga0207659_10031329 3300025926 Bacteria 3640
185 Ga0207659_10045612 3300025926 Bacteria 3092
186 Ga0207687_10125933 3300025927 Bacteria 1923
187 Ga0207644_10002313 3300025931 Bacteria 12347
188 Ga0207644_10043716 3300025931 Bacteria 3180
189 Ga0207644_10285109 3300025931 Bacteria 1327
190 Ga0207644_10571596 3300025931 Bacteria 937
191 Ga0207706_10072831 3300025933 Bacteria 3020
192 Ga0207706_10160936 3300025933 Bacteria 1973
193 Ga0207706_10313459 3300025933 Bacteria 1366
194 Ga0207686_10058369 3300025934 Bacteria 2432
195 Ga0207670_10128133 3300025936 Bacteria 1855
196 Ga0207670_10182654 3300025936 Bacteria 1581
197 Ga0207670_10261047 3300025936 Bacteria 1343
198 Ga0207670_10321423 3300025936 Bacteria 1218
199 Ga0207669_10004567 3300025937 Bacteria 6105
200 Ga0207669_10349388 3300025937 Bacteria 1142
201 Ga0207704_10111109 3300025938 Bacteria 1853
202 Ga0207704_10281909 3300025938 Bacteria 1264
203 Ga0207704_10410014 3300025938 Bacteria 1071
204 Ga0207704_10502683 3300025938 Bacteria 977
205 Ga0207691_10001598 3300025940 Bacteria 22526
206 Ga0207691_10014537 3300025940 Bacteria 7508
207 Ga0207691_10072176 3300025940 Bacteria 3114
208 Ga0207691_10303252 3300025940 Bacteria 1372
209 Ga0207711_10002353 3300025941 Bacteria 16942
210 Ga0207711_10331009 3300025941 Bacteria 1408
211 Ga0207689_10019005 3300025942 Bacteria 5795
212 Ga0207689_10069483 3300025942 Bacteria 2894
213 Ga0207689_10091066 3300025942 Bacteria 2506
214 Ga0207689_10115423 3300025942 Bacteria 2207
215 Ga0207661_10478903 3300025944 Bacteria 1136
216 Ga0207679_10182026 3300025945 Bacteria 1739
217 Ga0207679_10195214 3300025945 Bacteria 1687
218 Ga0207679_10347851 3300025945 Bacteria 1291
219 Ga0207651_10061235 3300025960 Bacteria 2617
220 Ga0207651_10678374 3300025960 Bacteria 906
221 Ga0207640_10117273 3300025981 Bacteria 1900
222 Ga0207703_10014694 3300026035 Bacteria 6109
223 Ga0207703_10057542 3300026035 Bacteria 3171
224 Ga0207678_10048780 3300026067 Bacteria 3659
225 Ga0207678_10056655 3300026067 Bacteria 3373
226 Ga0207641_10104090 3300026088 Bacteria 2505
227 Ga0207648_10001127 3300026089 Bacteria 30008
228 Ga0207648_10049666 3300026089 Bacteria 3670
229 Ga0207648_10084061 3300026089 Bacteria 2776
230 Ga0207648_10531285 3300026089 Bacteria 1079
231 Ga0207676_10001662 3300026095 Bacteria 16392
232 Ga0207676_10050096 3300026095 Bacteria 3254
233 Ga0207676_10151026 3300026095 Bacteria 2000
234 Ga0207674_10396775 3300026116 Bacteria 1333
235 Ga0207675_100053892 3300026118 Bacteria 3752
236 Ga0207675_100953986 3300026118 Bacteria 875
237 Ga0207683_10020478 3300026121 Bacteria 5658
238 Ga0207698_10495506 3300026142 Bacteria 1188
239 Ga0209813_10004344 3300027866 Bacteria 3382
240 Ga0207428_10036822 3300027907 Bacteria 3986
241 Ga0207428_10328856 3300027907 Bacteria 1127
242 Ga0268266_10056647 3300028379 Bacteria 3372
243 Ga0268266_10227176 3300028379 Bacteria 1718
244 Ga0268265_10045094 3300028380 Bacteria 3288
245 Ga0268265_10149072 3300028380 Bacteria 1971
246 Ga0268265_10341880 3300028380 Bacteria 1363
247 Ga0268264_10035959 3300028381 Bacteria 4078
248 Ga0268264_10552843 3300028381 Bacteria 1129
249 Ga0265336_10061943 3300028666 Bacteria 1122
250 Ga0307511_10201435 3300030521 Bacteria 1033
251 Ga0265314_10038672 3300031711 Bacteria 3444
252 Ga0307405_10091585 3300031731 Bacteria 2015
253 Ga0307413_10508523 3300031824 Bacteria 969
254 Ga0307407_10167018 3300031903 Bacteria 1446
255 Ga0307412_10130888 3300031911 Bacteria 1822
256 Ga0307409_100673544 3300031995 Bacteria 1031
257 Ga0373946_0301951 3300035171 Bacteria 792
258 Ga0373955_0274945 3300035172 Bacteria 1013
259 Ga0373947_0449820 3300035725 Bacteria 872
260 Ga0373937_0005038 3300036401 Bacteria 11246
261 Ga0373937_0054803 3300036401 Unclassified 3659
262 Ga0373937_0138533 3300036401 Bacteria 2276
263 Ga0436363_0270631 3300039450 Bacteria 2154
264 Ga0451577_0005196 3300042876 Bacteria 13392
265 Ga0453684_1067862 3300044712 Bacteria 855
266 Ga0495592_0166690 3300046454 Bacteria 1511
267 Ga0495638_0005639 3300046460 Bacteria 9224
268 Ga0495580_0193938 3300046472 Bacteria 1401
269 Ga0495582_0181586 3300046473 Bacteria 1199
270 Ga0495594_0004489 3300046499 Bacteria 7175
271 Ga0495608_0013531 3300046511 Bacteria 5659
272 Ga0495618_0146840 3300046514 Bacteria 1507
273 Ga0495618_0241722 3300046514 Bacteria 1135
274 Ga0495628_0035226 3300046516 Bacteria 4024
275 Ga0495628_0343018 3300046516 Bacteria 1099
276 Ga0495630_0100751 3300046517 Unclassified 2185
277 Ga0495586_0077528 3300046535 Bacteria 1822
278 Ga0495667_0003939 3300046559 Bacteria 9952
279 Ga0495657_0000887 3300046675 Bacteria 26367
280 Ga0495658_0049213 3300046683 Bacteria 2380
281 Ga0495613_0021490 3300046689 Bacteria 4809
282 Ga0495604_0091943 3300047317 Bacteria 2249
283 Ga0495674_0065588 3300047319 Bacteria 3153
284 Ga0495672_0249649 3300047320 Bacteria 862
285 Ga0496104_0006460 3300048907 Bacteria 10306
286 Ga0496108_0200847 3300048911 Bacteria 1730
287 Ga0496109_0136727 3300048912 Bacteria 2290
288 Ga0496109_0278562 3300048912 Bacteria 1576
289 Ga0496109_0757321 3300048912 Bacteria 909
290 Ga0496110_0065430 3300048913 Bacteria 3214
291 Ga0496110_0071967 3300048913 Bacteria 3067
292 Ga0496112_0001048 3300048915 Bacteria 20366
293 Ga0501031_0002851 3300049568 Bacteria 11037
294 Ga0501032_0015574 3300049569 Bacteria 5363
295 Ga0501032_0267811 3300049569 Bacteria 1107
296 Ga0501033_0090183 3300049570 Bacteria 2242
297 Ga0501034_0008697 3300049571 Bacteria 10694
298 Ga0501034_0102631 3300049571 Bacteria 2853
299 Ga0501036_0205544 3300049572 Bacteria 1655
300 Ga0501037_0361872 3300049573 Bacteria 999
301 Ga0501038_0011177 3300049574 Bacteria 8198
302 Ga0501038_0449598 3300049574 Bacteria 991
303 Ga0501039_0001692 3300049575 Bacteria 16266
304 Ga0501040_0004777 3300049576 Bacteria 8790
305 Ga0501041_0235555 3300049577 Bacteria 1150
306 Ga0501042_0002878 3300049578 Bacteria 10678
307 Ga0501042_0079430 3300049578 Bacteria 2350
308 Ga0501042_0088941 3300049578 Bacteria 2216
309 Ga0501043_0098142 3300049579 Bacteria 2302
310 Ga0501046_0035050 3300049580 Bacteria 4045
311 Ga0501046_0117873 3300049580 Bacteria 2022
312 Ga0501047_0001716 3300049581 Bacteria 21305
313 Ga0501047_0210779 3300049581 Bacteria 1801
314 Ga0501048_0002216 3300049582 Bacteria 14801
315 Ga0501048_0117557 3300049582 Bacteria 1878
316 Ga0501067_0064943 3300049583 Bacteria 2020
317 Ga0501068_0002349 3300049584 Bacteria 10074
318 Ga0501069_0010010 3300049585 Bacteria 5012
319 Ga0501071_0000727 3300049587 Bacteria 17364
320 Ga0501072_0151773 3300049588 Bacteria 1847
321 Ga0501072_0239817 3300049588 Bacteria 1444
322 Ga0501074_0001087 3300049590 Bacteria 17734
323 Ga0501075_0135159 3300049591 Bacteria 1878
324 Ga0501076_0141260 3300049592 Bacteria 1956
325 Ga0501076_0220808 3300049592 Bacteria 1549
326 Ga0501076_0231630 3300049592 Bacteria 1510
327 Ga0501076_0248866 3300049592 Bacteria 1454
328 Ga0501079_0001524 3300049741 Bacteria 16398
329 Ga0501079_0287220 3300049741 Bacteria 1286
330 Ga0501080_0238405 3300049742 Bacteria 1661
331 Ga0501083_0174918 3300049744 Bacteria 1403
332 Ga0501035_0031452 3300049822 Bacteria 4833
333 Ga0501044_0007502 3300049823 Bacteria 11998
334 Ga0501045_0030610 3300049824 Bacteria 3896
335 Ga0501045_0319953 3300049824 Bacteria 1154
336 nmdc:mga0k408_19442_c1 3300050493 Bacteria 3797
337 nmdc:mga0k408_42096_c1 3300050493 Bacteria 2630
338 nmdc:mga0k408_90820_c1 3300050493 Bacteria 1794
339 nmdc:mga06z11_91943_c1 3300050494 Bacteria 1649
340 nmdc:mga07m45_21789_c1 3300050496 Bacteria 1989
341 nmdc:mga07m45_48898_c1 3300050496 Bacteria 2379
342 nmdc:mga05p37_232662_c1 3300050507 Bacteria 2219
343 nmdc:mga05p37_439621_c1 3300050507 Unclassified 1513
344 nmdc:mga0qj67_104898_c1 3300050509 Bacteria 2280
345 nmdc:mga0qj67_357172_c1 3300050509 Bacteria 1181
346 nmdc:mga0qj67_9169_c1 3300050509 Bacteria 7347
347 nmdc:mga06r32_347757_c1 3300050510 Bacteria 1467
348 nmdc:mga08y16_54821_c1 3300050511 Unclassified 4166
349 nmdc:mga08y16_559996_c1 3300050511 Bacteria 1156
350 nmdc:mga0n895_77264_c1 3300050512 Bacteria 3311
351 nmdc:mga0a205_598337_c1 3300050515 Eukaryota 956
352 Ga0495601_0317102 3300053077 Bacteria 1015
353 Ga0495619_0015618 3300053085 Bacteria 4805
354 Ga0495619_0022953 3300053085 Bacteria 3995
355 Ga0500641_0034162 3300053096 Bacteria 2022
356 Ga0500555_001453 3300053103 Bacteria 7235
357 Ga0500592_012448 3300053116 Bacteria 1362
358 Ga0500616_0000787 3300053153 Bacteria 36341
359 Ga0500645_002810 3300053730 Bacteria 7503
360 Ga0501084_0009441 3300054114 Bacteria 8073
361 Ga0501084_0024472 3300054114 Bacteria 5037
362 Ga0501084_0338539 3300054114 Bacteria 1271
363 Ga0501082_0003817 3300060353 Bacteria 13170
364 Ga0501082_0657299 3300060353 Bacteria 917
365 Ga0451577_0154821
366 MBSR1b_contig_14410295
367 JGI25406J46586_10000178
368 JGI25406J46586_10007382
369 JGI25406J46586_10009036
370 JGI25406J46586_10025253
371 Ga0065712_10101176
372 Ga0065712_10149574
373 Ga0065712_10170885
374 Ga0065715_10178299
375 Ga0070658_10218830
376 Ga0070676_10185252
377 Ga0070683_100593705
378 Ga0070690_100000287
379 Ga0070670_100000608
380 Ga0070670_100008401
381 Ga0070670_100218728
382 Ga0070677_10057099
383 Ga0068869_100055633
384 Ga0070666_10002792
385 Ga0070682_100262408
386 Ga0068868_100000406
387 Ga0068868_100016109
388 Ga0070689_100050396
389 Ga0070689_100113097
390 Ga0070689_100391452
391 Ga0070661_100010993
392 Ga0070661_100098597
393 Ga0070661_100137532
394 Ga0070669_100035138
395 Ga0070669_100041655
396 Ga0070669_100146163
397 Ga0070675_100010730
398 Ga0070675_100017022
399 Ga0070675_100093840
400 Ga0070671_100024665
401 Ga0070671_100029048
402 Ga0070671_100468053
403 Ga0070674_100001446
404 Ga0070674_100017018
405 Ga0070674_100025873
406 Ga0070673_100073687
407 Ga0070688_100077664
408 Ga0070688_100299300
409 Ga0070667_100001977
410 Ga0070701_10022959
411 Ga0070663_100056843
412 Ga0070678_100035946
413 Ga0070662_100126097
414 Ga0070681_10056116
415 Ga0070685_10124688
416 Ga0070685_10531764
417 Ga0070707_100185000
418 Ga0070699_100004737
419 Ga0070679_100280390
420 Ga0070684_100205823
421 Ga0070672_100001656
422 Ga0070672_100061311
423 Ga0070672_100300677
424 Ga0070672_100464343
425 Ga0070686_100008115
426 Ga0070686_100021957
427 Ga0070686_100186210
428 Ga0070665_100070800
429 Ga0070665_100551819
430 Ga0068855_100211995
431 Ga0070664_100008308
432 Ga0070664_100033476
433 Ga0070664_100091781
434 Ga0070664_100171207
435 Ga0070664_100250286
436 Ga0070664_100462150
437 Ga0070664_100577126
438 Ga0070702_100124661
439 Ga0068859_100031557
440 Ga0068859_100079021
441 Ga0068859_100334855
442 Ga0068859_100400703
443 Ga0068864_100001040
444 Ga0068864_100006337
445 Ga0068864_100013181
446 Ga0068864_100109979
447 Ga0068861_100158346
448 Ga0068870_10022866
449 Ga0068870_10049302
450 Ga0068870_10050455
451 Ga0068863_100028320
452 Ga0068863_100092810
453 Ga0068858_100006588
454 Ga0068858_100011471
455 Ga0068858_100350347
456 Ga0068858_100671649
457 Ga0068860_100478841
458 Ga0081455_10169382
459 Ga0081539_10000013
460 Ga0081539_10000746
461 Ga0081539_10001672
462 Ga0081539_10002236
463 Ga0081539_10030581
464 Ga0075368_10013650
465 Ga0075368_10086547
466 Ga0075364_10125345
467 Ga0075367_10007190
468 Ga0075367_10210944
469 Ga0075366_10015173
470 Ga0097621_100215275
471 Ga0097621_100301516
472 Ga0097621_100381142
473 Ga0075370_10089331
474 Ga0075370_10308954
475 Ga0068871_100062273
476 Ga0068871_100304601
477 Ga0075428_100518365
478 Ga0075430_100003084
479 Ga0075431_100000739
480 Ga0075431_100063675
481 Ga0075433_10268825
482 Ga0068865_100024978
483 Ga0068865_100071087
484 Ga0068865_100081407
485 Ga0068865_100281192
486 Ga0097620_100031557
487 Ga0097620_100079014
488 Ga0097620_100334888
489 Ga0097620_100400691
490 Ga0111539_10017236
491 Ga0111539_10065386
492 Ga0111539_10099216
493 Ga0111539_10543595
494 Ga0105245_10426138
495 Ga0105247_10023167
496 Ga0114129_10112586
497 Ga0105243_10233057
498 Ga0105241_10309937
499 Ga0105241_10546283
500 Ga0105242_10386095
501 Ga0105248_10000396
502 Ga0105248_10014138
503 Ga0105248_10128210
504 Ga0105248_10247087
505 Ga0105248_10289259
506 Ga0105237_10582475
507 Ga0105238_10192333
508 Ga0105239_10509350
509 Ga0105246_10201681
510 Ga0105246_10317481
511 Ga0157374_10232471
512 Ga0157375_10003809
513 Ga0157375_10080714
514 Ga0157375_10174658
515 Ga0157375_10422710
516 Ga0163163_10003913
517 Ga0163163_10007788
518 Ga0163163_10016637
519 Ga0163163_10021534
520 Ga0163163_10197413
521 Ga0163163_10319518
522 Ga0163163_10548282
523 Ga0157380_10013421
524 Ga0157380_10248587
525 Ga0157379_10140838
526 Ga0157376_10020141
527 Ga0157376_10263729
528 Ga0207697_10000174
529 Ga0207682_10017254
530 Ga0207682_10030041
531 Ga0207710_10043874
532 Ga0207688_10015203
533 Ga0207688_10294252
534 Ga0207680_10013314
535 Ga0207645_10114818
536 Ga0207645_10155109
537 Ga0207705_10165711
538 Ga0207671_10063053
539 Ga0207660_10152342
540 Ga0207662_10150068
541 Ga0207649_10015277
542 Ga0207649_10235326
543 Ga0207649_10496377
544 Ga0207652_10298312
545 Ga0207650_10004926
546 Ga0207650_10023130
547 Ga0207650_10516512
548 Ga0207659_10031329
549 Ga0207659_10045612
550 Ga0207687_10125933
551 Ga0207644_10002313
552 Ga0207644_10043716
553 Ga0207644_10285109
554 Ga0207644_10571596
555 Ga0207706_10072831
556 Ga0207706_10160936
557 Ga0207706_10313459
558 Ga0207686_10058369
559 Ga0207670_10128133
560 Ga0207670_10182654
561 Ga0207670_10261047
562 Ga0207670_10321423
563 Ga0207669_10004567
564 Ga0207669_10349388
565 Ga0207704_10111109
566 Ga0207704_10281909
567 Ga0207704_10410014
568 Ga0207704_10502683
569 Ga0207691_10001598
570 Ga0207691_10014537
571 Ga0207691_10072176
572 Ga0207691_10303252
573 Ga0207711_10002353
574 Ga0207711_10331009
575 Ga0207689_10019005
576 Ga0207689_10069483
577 Ga0207689_10091066
578 Ga0207689_10115423
579 Ga0207661_10478903
580 Ga0207679_10182026
581 Ga0207679_10195214
582 Ga0207679_10347851
583 Ga0207651_10061235
584 Ga0207651_10678374
585 Ga0207640_10117273
586 Ga0207703_10014694
587 Ga0207703_10057542
588 Ga0207678_10048780
589 Ga0207678_10056655
590 Ga0207641_10104090
591 Ga0207648_10001127
592 Ga0207648_10049666
593 Ga0207648_10084061
594 Ga0207648_10531285
595 Ga0207676_10001662
596 Ga0207676_10050096
597 Ga0207676_10151026
598 Ga0207674_10396775
599 Ga0207675_100053892
600 Ga0207675_100953986
601 Ga0207683_10020478
602 Ga0207698_10495506
603 Ga0209813_10004344
604 Ga0207428_10036822
605 Ga0207428_10328856
606 Ga0268266_10056647
607 Ga0268266_10227176
608 Ga0268265_10045094
609 Ga0268265_10149072
610 Ga0268265_10341880
611 Ga0268264_10035959
612 Ga0268264_10552843
613 Ga0265336_10061943
614 Ga0307511_10201435
615 Ga0265314_10038672
616 Ga0307405_10091585
617 Ga0307413_10508523
618 Ga0307407_10167018
619 Ga0307412_10130888
620 Ga0307409_100673544
621 Ga0373946_0301951
622 Ga0373955_0274945
623 Ga0373947_0449820
624 Ga0373937_0005038
625 Ga0373937_0054803
626 Ga0373937_0138533
627 Ga0436363_0270631
628 Ga0451577_0005196
629 Ga0453684_1067862
630 Ga0495592_0166690
631 Ga0495638_0005639
632 Ga0495580_0193938
633 Ga0495582_0181586
634 Ga0495594_0004489
635 Ga0495608_0013531
636 Ga0495618_0146840
637 Ga0495618_0241722
638 Ga0495628_0035226
639 Ga0495628_0343018
640 Ga0495630_0100751
641 Ga0495586_0077528
642 Ga0495667_0003939
643 Ga0495657_0000887
644 Ga0495658_0049213
645 Ga0495613_0021490
646 Ga0495604_0091943
647 Ga0495674_0065588
648 Ga0495672_0249649
649 Ga0496104_0006460
650 Ga0496108_0200847
651 Ga0496109_0136727
652 Ga0496109_0278562
653 Ga0496109_0757321
654 Ga0496110_0065430
655 Ga0496110_0071967
656 Ga0496112_0001048
657 Ga0501031_0002851
658 Ga0501032_0015574
659 Ga0501032_0267811
660 Ga0501033_0090183
661 Ga0501034_0008697
662 Ga0501034_0102631
663 Ga0501036_0205544
664 Ga0501037_0361872
665 Ga0501038_0011177
666 Ga0501038_0449598
667 Ga0501039_0001692
668 Ga0501040_0004777
669 Ga0501041_0235555
670 Ga0501042_0002878
671 Ga0501042_0079430
672 Ga0501042_0088941
673 Ga0501043_0098142
674 Ga0501046_0035050
675 Ga0501046_0117873
676 Ga0501047_0001716
677 Ga0501047_0210779
678 Ga0501048_0002216
679 Ga0501048_0117557
680 Ga0501067_0064943
681 Ga0501068_0002349
682 Ga0501069_0010010
683 Ga0501071_0000727
684 Ga0501072_0151773
685 Ga0501072_0239817
686 Ga0501074_0001087
687 Ga0501075_0135159
688 Ga0501076_0141260
689 Ga0501076_0220808
690 Ga0501076_0231630
691 Ga0501076_0248866
692 Ga0501079_0001524
693 Ga0501079_0287220
694 Ga0501080_0238405
695 Ga0501083_0174918
696 Ga0501035_0031452
697 Ga0501044_0007502
698 Ga0501045_0030610
699 Ga0501045_0319953
700 nmdc:mga0k408_19442_c1
701 nmdc:mga0k408_42096_c1
702 nmdc:mga0k408_90820_c1
703 nmdc:mga06z11_91943_c1
704 nmdc:mga07m45_21789_c1
705 nmdc:mga07m45_48898_c1
706 nmdc:mga05p37_232662_c1
707 nmdc:mga05p37_439621_c1
708 nmdc:mga0qj67_104898_c1
709 nmdc:mga0qj67_357172_c1
710 nmdc:mga0qj67_9169_c1
711 nmdc:mga06r32_347757_c1
712 nmdc:mga08y16_54821_c1
713 nmdc:mga08y16_559996_c1
714 nmdc:mga0n895_77264_c1
715 nmdc:mga0a205_598337_c1
716 Ga0495601_0317102
717 Ga0495619_0015618
718 Ga0495619_0022953
719 Ga0500641_0034162
720 Ga0500555_001453
721 Ga0500592_012448
722 Ga0500616_0000787
723 Ga0500645_002810
724 Ga0501084_0009441
725 Ga0501084_0024472
726 Ga0501084_0338539
727 Ga0501082_0003817
728 Ga0501082_0657299

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00460

Flg_bb_rod

Flagella basal body rod protein

23

53

0.99

PF22692

LlgE_F_G_D1

Flagellar hook protein FlgE/F/G D1 domain

114

177

0.99

PF06429

Flg_bbr_C

Flagellar basal body rod FlgEFG protein C-terminal

233

278

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jf2-assembly2.cif.gz_B crystal structure of a 20kda fragment of flgg 0.9742 82 224
6jf2-assembly1.cif.gz_A crystal structure of a 20kda fragment of flgg 0.9657 82 224
6jf2-assembly1.cif.gz_A crystal structure of a 20kda fragment of flgg 0.9464 82 224
6jf2-assembly2.cif.gz_B crystal structure of a 20kda fragment of flgg 0.8887 82 224
1wlg-assembly1.cif.gz_A crystal structure of flge31, a major fragment of the hook protein 0.8291 93 221
ID Description Score Start End Superfamily
af_Q07468_253_583_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6145 127 170 1.25.40.10
af_P21499_67_147_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6113 149 181 2.40.50.140
af_Q9EP82_11_138_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.513 112 170 2.130.10.10
af_Q80WC9_1033_1097_2.40.10.480 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.4732 120 170 2.40.10.480
af_A1ZB93_1337_1535_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.4682 109 170 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A4S0MRY4-F1-model_v4 Flagellar basal-body rod protein FlgG 0.987 109 208 GO:0009425
GO:0071978
AF-A0A659U7I6-F1-model_v4 Flagellar hook-basal body complex protein 0.9832 129 223 GO:0009425
GO:0071973
AF-A0A659U7I6-F1-model_v4 Flagellar hook-basal body complex protein 0.9731 129 223 GO:0009425
GO:0071973
AF-A0A142X9B5-F1-model_v4 Flagellar basal-body rod protein FlgG 0.9583 83 224 GO:0009288
GO:0071978
AF-A0A439BS56-F1-model_v4 deleted 0.958 99 228

Map