F423402

General Info

Members Datasets Scaffolds Average Seq Length
364 310 728 330

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_142133|Ga0400483_142133_6339_7433
Length 364
Sequence MMGKGLGDWAMASQKKPMIALAMGDPAGIGAELAAKLLADDEITQAADLLLLGDRRVWAMGLEQAGLSHRLGDLDGFVEHGQALSDFGHLDPADIQVGQSSRAGGDFALVNFRIALKMGALGVADAVAFTPFNKHSMRLAEEDYVDEIGFIRRTIGAAKDGSEFNILDEVWNARVTSHIPLGEVVEHITLERIEKAIDLTIESMEAAGFQRPRLAVAGLNPHAGDGGNFGREEIEVIEPAVRAAANRQLAVEGPFSPDTVFLRAKAGLHDAVLTMYHDQGQIAMKLMGFDRGITLIGGYPFPITTPAHGTAFDIAGQGKANPGAAKRALTIGADMARRFAGKSDFPDRETRLDAIRKFFRGGHA

Samples

Sample ID Description Type Environment
1 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
37 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
50 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
52 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
56 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
83 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
84 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
85 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
92 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
98 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
99 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
100 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
112 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
113 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
114 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
115 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
116 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
121 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
131 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
132 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
133 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
134 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
137 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
138 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
139 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
140 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
173 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
174 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
194 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
198 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
199 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
200 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
201 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
202 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
203 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
204 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
205 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
206 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
207 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
208 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
209 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
210 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
211 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
212 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
213 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
214 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
215 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
216 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
217 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
218 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
219 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
220 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
221 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
222 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
223 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
224 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
225 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
226 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
227 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
228 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
229 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
230 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
231 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
232 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
233 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
234 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
235 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
236 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
237 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
238 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
239 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
240 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
241 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
242 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
243 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
244 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
245 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
246 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
247 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
248 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
249 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
250 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
251 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
252 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
253 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
254 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
255 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
256 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
257 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
258 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
259 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
260 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
261 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
262 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
263 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
264 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
265 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
266 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
267 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
268 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
269 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
270 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
271 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
272 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
273 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
274 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
275 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
276 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
277 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
278 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
279 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
280 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
281 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
282 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
283 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
284 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
285 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
286 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
287 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
288 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
289 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
290 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
291 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
292 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
293 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
294 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
295 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
296 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
297 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
298 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
299 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
300 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
301 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
302 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
303 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
304 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
305 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
306 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
307 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
308 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
309 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
310 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.55
Metatranscriptomes 0
Isolates 24.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.38
Nodule 19.23
Rhizoplane 3.02
Rhizosphere 49.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400483_142133 3300039062 Bacteria 14037
2 JGI25153J46596_10001142 3300003215 Bacteria 16071
3 JGI25153J46596_10006286 3300003215 Bacteria 6056
4 JGI25153J46596_10006906 3300003215 Bacteria 5666
5 JGI25160J50197_1002554 3300003354 Bacteria 8423
6 Ga0055539_1009527 3300003752 Bacteria 1205
7 Ga0055531_10024052 3300003794 Bacteria 2261
8 Ga0055543_1003973 3300004625 Bacteria 4162
9 Ga0065165_1000788 3300005262 Bacteria 42403
10 Ga0070658_10024998 3300005327 Bacteria 4789
11 Ga0068869_100193429 3300005334 Bacteria 1601
12 Ga0070682_100099893 3300005337 Bacteria 1914
13 Ga0068868_100240435 3300005338 Bacteria 1521
14 Ga0070660_100044142 3300005339 Bacteria 3408
15 Ga0070687_100208067 3300005343 Bacteria 1190
16 Ga0070661_100028597 3300005344 Bacteria 4021
17 Ga0070661_100176154 3300005344 Bacteria 1626
18 Ga0070692_10004612 3300005345 Bacteria 5773
19 Ga0070668_100092261 3300005347 Bacteria 2388
20 Ga0070669_100006585 3300005353 Bacteria 8360
21 Ga0070667_100085681 3300005367 Bacteria 2702
22 Ga0070700_100004545 3300005441 Bacteria 7257
23 Ga0070700_100067542 3300005441 Bacteria 2271
24 Ga0070663_100024053 3300005455 Bacteria 4092
25 Ga0070663_100087650 3300005455 Bacteria 2300
26 Ga0070662_100080879 3300005457 Bacteria 2419
27 Ga0070662_100363090 3300005457 Bacteria 1188
28 Ga0070681_10045425 3300005458 Bacteria 4394
29 Ga0068867_100005538 3300005459 Bacteria 8941
30 Ga0070685_10074769 3300005466 Bacteria 2017
31 Ga0070706_100238998 3300005467 Bacteria 1696
32 Ga0070679_100066768 3300005530 Bacteria 3586
33 Ga0070665_100021506 3300005548 Bacteria 6485
34 Ga0068861_100001093 3300005719 Bacteria 16774
35 Ga0068862_100011126 3300005844 Bacteria 7429
36 Ga0075364_10075403 3300006051 Bacteria 2225
37 Ga0075364_10103914 3300006051 Bacteria 1892
38 Ga0075369_10020728 3300006186 Bacteria 2694
39 Ga0075366_10102252 3300006195 Bacteria 1720
40 Ga0075366_10149942 3300006195 Bacteria 1412
41 Ga0075430_100025427 3300006846 Bacteria 5037
42 Ga0075431_100202560 3300006847 Bacteria 2030
43 Ga0068865_100003322 3300006881 Bacteria 9635
44 Ga0099824_1007647 3300006942 Bacteria 14203
45 Ga0099824_1009152 3300006942 Bacteria 12314
46 Ga0099822_1001874 3300006943 Bacteria 25366
47 Ga0099822_1056087 3300006943 Bacteria 1443
48 Ga0111539_10011235 3300009094 Bacteria 11250
49 Ga0111539_10082154 3300009094 Bacteria 3789
50 Ga0105245_10536727 3300009098 Bacteria 1190
51 Ga0105243_10016362 3300009148 Bacteria 5611
52 Ga0105241_10024416 3300009174 Bacteria 4488
53 Ga0105248_10166890 3300009177 Bacteria 2481
54 Ga0105237_10007705 3300009545 Bacteria 11762
55 Ga0105249_10019281 3300009553 Bacteria 6083
56 Ga0105249_10245062 3300009553 Bacteria 1774
57 Ga0105239_10013635 3300010375 Bacteria 9023
58 Ga0105239_10025536 3300010375 Bacteria 6503
59 Ga0157369_10006614 3300013105 Bacteria 13409
60 Ga0157369_10037813 3300013105 Bacteria 5282
61 Ga0157374_10181553 3300013296 Bacteria 2056
62 Ga0157375_10397129 3300013308 Bacteria 1546
63 Ga0207425_1030463 3300025245 Bacteria 1081
64 Ga0209677_101250 3300025253 Bacteria 11450
65 Ga0209233_1001020 3300025261 Bacteria 11938
66 Ga0209455_1007266 3300025272 Bacteria 3149
67 Ga0209758_1000021 3300025297 Bacteria 697691
68 Ga0209758_1000612 3300025297 Bacteria 55194
69 Ga0209758_1000626 3300025297 Bacteria 54157
70 Ga0209758_1001904 3300025297 Bacteria 22783
71 Ga0209758_1001907 3300025297 Bacteria 22714
72 Ga0209256_1002656 3300025299 Bacteria 14040
73 Ga0207426_1000430 3300025302 Bacteria 68540
74 Ga0207426_1020994 3300025302 Bacteria 2262
75 Ga0209257_1002171 3300025304 Bacteria 20335
76 Ga0209257_1012653 3300025304 Bacteria 3867
77 Ga0207688_10032463 3300025901 Bacteria 2885
78 Ga0207647_10024012 3300025904 Bacteria 4023
79 Ga0207645_10100382 3300025907 Bacteria 1867
80 Ga0207705_10035535 3300025909 Bacteria 3565
81 Ga0207705_10057575 3300025909 Bacteria 2803
82 Ga0207684_10285377 3300025910 Bacteria 1423
83 Ga0207695_10000015 3300025913 Bacteria 803205
84 Ga0207671_10005964 3300025914 Bacteria 11041
85 Ga0207657_10104296 3300025919 Bacteria 2349
86 Ga0207652_10127299 3300025921 Bacteria 2269
87 Ga0207681_10004157 3300025923 Bacteria 8974
88 Ga0207659_10040104 3300025926 Bacteria 3271
89 Ga0207706_10165079 3300025933 Bacteria 1946
90 Ga0207709_10302301 3300025935 Bacteria 1190
91 Ga0207711_10327119 3300025941 Bacteria 1417
92 Ga0207689_10094897 3300025942 Bacteria 2450
93 Ga0207689_10207483 3300025942 Bacteria 1618
94 Ga0207712_10005358 3300025961 Bacteria 8101
95 Ga0207712_10148087 3300025961 Bacteria 1810
96 Ga0207668_10011215 3300025972 Bacteria 5440
97 Ga0207668_10149830 3300025972 Bacteria 1804
98 Ga0207677_10242446 3300026023 Bacteria 1459
99 Ga0207639_10243235 3300026041 Bacteria 1566
100 Ga0207678_10155683 3300026067 Bacteria 1951
101 Ga0207708_10001723 3300026075 Bacteria 16174
102 Ga0207648_10009994 3300026089 Bacteria 9026
103 Ga0207675_100008289 3300026118 Bacteria 9789
104 Ga0207683_10010836 3300026121 Bacteria 7775
105 Ga0207683_10063895 3300026121 Bacteria 3243
106 Ga0207698_10370235 3300026142 Bacteria 1360
107 Ga0209389_1000264 3300027296 Bacteria 33236
108 Ga0209389_1000409 3300027296 Bacteria 25484
109 Ga0209589_1000003 3300027357 Bacteria 629130
110 Ga0209589_1000514 3300027357 Bacteria 55043
111 Ga0209489_100003 3300027361 Bacteria 663105
112 Ga0209489_100616 3300027361 Bacteria 69009
113 Ga0209700_100003 3300027363 Bacteria 663105
114 Ga0209700_100036 3300027363 Bacteria 187888
115 Ga0207428_10090779 3300027907 Bacteria 2372
116 Ga0207428_10113722 3300027907 Bacteria 2080
117 Ga0268266_10059009 3300028379 Bacteria 3305
118 Ga0268265_10008634 3300028380 Bacteria 6886
119 Ga0268265_10166010 3300028380 Bacteria 1881
120 Ga0307517_10000066 3300028786 Bacteria 141370
121 Ga0307515_10012922 3300028794 Bacteria 15660
122 Ga0265313_10017310 3300031595 Bacteria 4101
123 Ga0307508_10083279 3300031616 Bacteria 2781
124 Ga0265314_10021839 3300031711 Bacteria 4912
125 Ga0265342_10000319 3300031712 Bacteria 54575
126 Ga0316576_10033030 3300031727 Bacteria 3681
127 Ga0307416_100140022 3300032002 Bacteria 2197
128 Ga0307510_10033915 3300033180 Bacteria 5724
129 Ga0373939_0015872 3300035114 Bacteria 1977
130 Ga0373960_0019072 3300035121 Bacteria 1797
131 Ga0316574_0020919 3300035398 Bacteria 3878
132 Ga0373931_0030686 3300035691 Bacteria 2769
133 Ga0373935_0008726 3300035692 Bacteria 6072
134 Ga0373927_0013524 3300035695 Bacteria 5423
135 Ga0373927_0032314 3300035695 Bacteria 3409
136 Ga0316584_0058474 3300036712 Bacteria 2887
137 Ga0373925_0029169 3300037068 Bacteria 4047
138 Ga0395898_0015500 3300037466 Bacteria 7817
139 Ga0395905_0006402 3300037471 Bacteria 11857
140 Ga0436364_0681229 3300037853 Bacteria 4651
141 Ga0395901_0092999 3300038443 Bacteria 3157
142 Ga0400483_061614 3300039062 Bacteria 9279
143 Ga0400483_142796 3300039062 Bacteria 1539
144 Ga0400483_191556 3300039062 Bacteria 7263
145 Ga0400483_256427 3300039062 Bacteria 6697
146 Ga0436365_1099415 3300039437 Bacteria 1208
147 Ga0451807_2099978 3300041486 Bacteria 1897
148 Ga0439441_001225 3300042001 Bacteria 3278
149 Ga0450913_001226 3300042117 Bacteria 1363
150 Ga0439435_0014396 3300042436 Bacteria 1953
151 Ga0466969_0024200 3300044656 Bacteria 3124
152 Ga0466972_0000186 3300044658 Bacteria 48162
153 Ga0466972_0026814 3300044658 Bacteria 2854
154 Ga0466966_0000182 3300044684 Bacteria 41581
155 Ga0466961_0002402 3300044693 Bacteria 11638
156 Ga0466963_0052131 3300044694 Bacteria 2714
157 Ga0466971_0137636 3300044719 Bacteria 1136
158 Ga0466968_0009541 3300044735 Bacteria 3735
159 Ga0466970_0098031 3300044765 Bacteria 1595
160 Ga0466959_0083485 3300045049 Bacteria 2300
161 Ga0466967_0020735 3300045976 Bacteria 5321
162 Ga0495592_0057100 3300046454 Bacteria 2882
163 Ga0495590_0049016 3300046457 Bacteria 1473
164 Ga0495629_0014337 3300046459 Bacteria 5703
165 Ga0495629_0180091 3300046459 Bacteria 1465
166 Ga0495638_0002010 3300046460 Bacteria 17376
167 Ga0495638_0176422 3300046460 Bacteria 1222
168 Ga0495651_0060991 3300046462 Bacteria 2887
169 Ga0495664_0134245 3300046477 Bacteria 1499
170 Ga0495584_0058725 3300046491 Bacteria 1935
171 Ga0495606_0024371 3300046507 Bacteria 4361
172 Ga0495606_0043594 3300046507 Bacteria 2990
173 Ga0495608_0017088 3300046511 Bacteria 5021
174 Ga0495616_0034720 3300046513 Bacteria 2616
175 Ga0495628_0076319 3300046516 Bacteria 2608
176 Ga0495631_0046740 3300046518 Bacteria 1902
177 Ga0495632_0053011 3300046519 Bacteria 1993
178 Ga0495643_0037229 3300046522 Bacteria 2670
179 Ga0495648_0062774 3300046524 Bacteria 2198
180 Ga0495648_0152425 3300046524 Bacteria 1204
181 Ga0495642_0099077 3300046528 Bacteria 1239
182 Ga0495652_0041933 3300046529 Bacteria 3947
183 Ga0495640_0058869 3300046533 Bacteria 2619
184 Ga0495587_0174139 3300046536 Bacteria 1221
185 Ga0495609_0058358 3300046538 Bacteria 1707
186 Ga0495645_0078593 3300046543 Bacteria 2371
187 Ga0495667_0014168 3300046559 Bacteria 5382
188 Ga0495668_0089193 3300046616 Bacteria 1690
189 Ga0495668_0192391 3300046616 Bacteria 1117
190 Ga0495634_0047564 3300046642 Bacteria 2890
191 Ga0495611_0085893 3300046648 Bacteria 1451
192 Ga0495625_0153397 3300046660 Bacteria 1547
193 Ga0495635_0071535 3300046663 Bacteria 2377
194 Ga0495657_0007197 3300046675 Bacteria 8628
195 Ga0495599_0007542 3300046678 Bacteria 6599
196 Ga0495623_0037923 3300046679 Bacteria 3082
197 Ga0495669_0041678 3300046684 Bacteria 2039
198 Ga0495669_0106545 3300046684 Bacteria 1306
199 Ga0495600_0065108 3300046809 Bacteria 2383
200 Ga0495581_0104617 3300047315 Bacteria 1645
201 Ga0495604_0002465 3300047317 Bacteria 14789
202 Ga0495604_0043810 3300047317 Bacteria 3500
203 Ga0495674_0106764 3300047319 Bacteria 2377
204 Ga0495676_0142734 3300047321 Bacteria 1714
205 Ga0495680_0004851 3300047322 Bacteria 12745
206 Ga0495683_0128859 3300047323 Bacteria 1195
207 Ga0495684_0090151 3300047471 Bacteria 2323
208 Ga0495602_0045584 3300048088 Bacteria 3967
209 Ga0495602_0081946 3300048088 Bacteria 2710
210 Ga0496102_0130644 3300048905 Bacteria 2350
211 Ga0496104_0161472 3300048907 Bacteria 2149
212 Ga0496105_0005664 3300048908 Bacteria 9505
213 Ga0496109_0207827 3300048912 Bacteria 1841
214 Ga0496109_0548853 3300048912 Bacteria 1090
215 Ga0496112_0000218 3300048915 Bacteria 37059
216 Ga0496112_0192536 3300048915 Bacteria 2000
217 Ga0496112_0421102 3300048915 Bacteria 1274
218 Ga0496113_0220007 3300048916 Bacteria 1513
219 Ga0496115_0073970 3300048918 Bacteria 2766
220 Ga0496117_0088065 3300048920 Bacteria 2010
221 Ga0496118_0013455 3300048921 Bacteria 7736
222 Ga0496118_0018681 3300048921 Bacteria 6233
223 Ga0496120_0062808 3300048923 Bacteria 2068
224 Ga0496121_0023562 3300048924 Bacteria 5922
225 Ga0496121_0203675 3300048924 Bacteria 1408
226 Ga0496125_0036123 3300048928 Bacteria 4320
227 Ga0496126_0273730 3300048929 Bacteria 1400
228 Ga0495682_0038618 3300049460 Bacteria 1754
229 Ga0501031_0090009 3300049568 Bacteria 2001
230 Ga0501036_0080255 3300049572 Bacteria 2758
231 Ga0501040_0045110 3300049576 Bacteria 3006
232 Ga0501041_0055030 3300049577 Bacteria 2428
233 Ga0501042_0148847 3300049578 Bacteria 1688
234 Ga0501042_0202489 3300049578 Bacteria 1431
235 Ga0501047_0057472 3300049581 Bacteria 3762
236 Ga0501072_0046476 3300049588 Bacteria 3417
237 Ga0501075_0135044 3300049591 Bacteria 1879
238 Ga0501079_0080400 3300049741 Bacteria 2520
239 Ga0501081_0130098 3300049743 Bacteria 1798
240 Ga0501083_0065241 3300049744 Bacteria 2425
241 Ga0501283_008656 3300049779 Bacteria 1471
242 Ga0501044_0086559 3300049823 Bacteria 3165
243 Ga0501045_0028778 3300049824 Bacteria 4010
244 nmdc:mga0yw44_83544_c1 3300050492 Bacteria 2006
245 nmdc:mga06z11_90549_c1 3300050494 Bacteria 1660
246 nmdc:mga0qj67_3865_c1 3300050509 Bacteria 10823
247 nmdc:mga08y16_39261_c1 3300050511 Bacteria 4967
248 Ga0495595_0087334 3300053084 Bacteria 1493
249 Ga0500643_000015 3300053087 Bacteria 310312
250 Ga0500651_0001088 3300053093 Bacteria 13425
251 Ga0500555_006743 3300053103 Bacteria 3262
252 Ga0500557_000002 3300053105 Bacteria 234207
253 Ga0500562_004019 3300053108 Bacteria 3710
254 Ga0500569_002399 3300053109 Bacteria 3683
255 Ga0500572_000075 3300053111 Bacteria 31631
256 Ga0500595_008957 3300053119 Bacteria 4065
257 Ga0500614_006102 3300053123 Bacteria 2535
258 Ga0500626_126230 3300053128 Bacteria 1089
259 Ga0500642_0000146 3300053130 Bacteria 31121
260 Ga0500642_0077787 3300053130 Bacteria 1519
261 Ga0500658_0012096 3300053134 Bacteria 3180
262 Ga0500658_0082487 3300053134 Bacteria 1377
263 Ga0500559_0000075 3300053136 Bacteria 77303
264 Ga0500559_0047371 3300053136 Bacteria 1887
265 Ga0500568_0051891 3300053139 Bacteria 1612
266 Ga0500589_037521 3300053147 Bacteria 2262
267 Ga0500616_0028098 3300053153 Bacteria 3102
268 Ga0500627_0090829 3300053158 Bacteria 1367
269 Ga0500634_0078082 3300053161 Bacteria 1714
270 Ga0500638_074465 3300053162 Bacteria 1619
271 Ga0500639_005468 3300053163 Bacteria 6498
272 Ga0500637_0117975 3300053178 Bacteria 1540
273 Ga0500625_001167 3300053729 Bacteria 8629
274 Ga0500609_003437 3300053731 Bacteria 2223
275 Ga0500596_006266 3300053735 Bacteria 2028
276 2507508735 2507262055 Bacteria 8048963
277 2508542827 2508501009 Bacteria 7784016
278 2511393870 2511231028 Bacteria 8046582
279 2513623182 2513237092 Bacteria 8341956
280 2513639133 2513237094 Bacteria 8789602
281 2513720850 2513237104 Bacteria 10034502
282 2515628222 2515154112 Bacteria 8294334
283 2524440424 2524023205 Bacteria 8918781
284 2617348877 2617270735 Bacteria 9163226
285 2745075307 2744054633 Bacteria 8678936
286 2793064256 2791355196 Bacteria 7323613
287 2819613424 2818991448 Bacteria 6772224
288 2824673219 2824671348 Bacteria 8369588
289 2824681862 2824679649 Bacteria 8248951
290 2824691292 2824687955 Bacteria 8360029
291 2824706855 2824704595 Bacteria 9667483
292 2824751488 2824746037 Bacteria 7911610
293 2824756825 2824753945 Bacteria 9787441
294 2824767418 2824763712 Bacteria 9792355
295 2824777727 2824773399 Bacteria 8360218
296 2838123899 2838122688 Bacteria 8803140
297 2841949996 2841949485 Bacteria 8680857
298 2841958526 2841957949 Bacteria 8652217
299 2841983279 2841983080 Bacteria 8395090
300 2842039216 2842038055 Bacteria 8002051
301 2842047837 2842045827 Bacteria 8006841
302 2842335738 2842333319 Bacteria 8899485
303 2844318949 2844315083 Bacteria 8138177
304 2847936073 2847930680 Bacteria 9342022
305 2849079459 2849076700 Bacteria 7039503
306 2854920765 2854916844 Bacteria 5725939
307 2868094302 2868088558 Bacteria 7609351
308 2874593465 2874590934 Bacteria 8299676
309 2874627253 2874620515 Bacteria 8290088
310 2874633253 2874628541 Bacteria 8630250
311 2874649019 2874645413 Bacteria 8214782
312 2876767114 2876761206 Bacteria 10111113
313 2876773118 2876771140 Bacteria 8287509
314 2876822008 2876818435 Bacteria 8274608
315 2879077163 2879074833 Bacteria 8279565
316 2879090051 2879083081 Bacteria 8587928
317 2879130068 2879127579 Bacteria 8294491
318 2879147015 2879142872 Bacteria 8267021
319 2881367082 2881364244 Bacteria 7710352
320 2881417437 2881412998 Bacteria 6492157
321 2881671033 2881665667 Bacteria 8175609
322 2885370410 2885366525 Bacteria 8326213
323 2903729127 2903727486 Bacteria 8281579
324 2904671228 2904666416 Bacteria 8226587
325 2904720684 2904711408 Bacteria 9771557
326 2906610172 2906602504 Bacteria 8295279
327 2906629876 2906626472 Bacteria 8826946
328 2922397844 2922393267 Bacteria 8285685
329 2932797638 2932794094 Bacteria 7915132
330 2932802956 2932801729 Bacteria 7987968
331 2935608733 2935608549 Bacteria 8203142
332 2935773154 2935769743 Bacteria 7878163
333 2935778402 2935777560 Bacteria 8077691
334 2935790481 2935785616 Bacteria 7962367
335 2935798210 2935793552 Bacteria 8012592
336 2935821894 2935819856 Bacteria 8261050
337 2935847476 2935847175 Bacteria 8228321
338 2935885295 2935883170 Bacteria 7964738
339 2935966337 2935959822 Bacteria 7869783
340 2935977161 2935975950 Bacteria 8347125
341 2941532597 2941531003 Bacteria 7653939
342 3005487203 3005483717 Bacteria 7877331
343 3005599090 3005594810 Bacteria 8716512
344 3005722183 3005718088 Bacteria 8283608
345 8005648567 8005645114 Bacteria 6950293
346 8016529760 8016522445 Bacteria 8156687
347 8016548196 8016539877 Bacteria 8155419
348 8016553934 8016548790 Bacteria 8155074
349 8016562310 8016557553 Bacteria 8154380
350 8016573328 8016566248 Bacteria 8158151
351 8016577465 8016575299 Bacteria 8154085
352 8016591959 8016583857 Bacteria 10421953
353 8016626691 8016622563 Bacteria 7999408
354 8019627978 8019619141 Bacteria 9218857
355 8019634623 8019629233 Bacteria 8687553
356 8019645092 8019638758 Bacteria 9062356
357 8019658233 8019648815 Bacteria 10014479
358 8019662516 8019659431 Bacteria 8577854
359 8019672014 8019668869 Bacteria 8791617
360 8019684081 8019678201 Bacteria 8863603
361 8019689907 8019687851 Bacteria 8712826
362 8054566705 8054563764 Bacteria 5592885
363 8056967892 8056967851 Bacteria 9038162
364 8057135780 8057132660 Bacteria 4061191
365 Ga0400483_142133
366 JGI25153J46596_10001142
367 JGI25153J46596_10006286
368 JGI25153J46596_10006906
369 JGI25160J50197_1002554
370 Ga0055539_1009527
371 Ga0055531_10024052
372 Ga0055543_1003973
373 Ga0065165_1000788
374 Ga0070658_10024998
375 Ga0068869_100193429
376 Ga0070682_100099893
377 Ga0068868_100240435
378 Ga0070660_100044142
379 Ga0070687_100208067
380 Ga0070661_100028597
381 Ga0070661_100176154
382 Ga0070692_10004612
383 Ga0070668_100092261
384 Ga0070669_100006585
385 Ga0070667_100085681
386 Ga0070700_100004545
387 Ga0070700_100067542
388 Ga0070663_100024053
389 Ga0070663_100087650
390 Ga0070662_100080879
391 Ga0070662_100363090
392 Ga0070681_10045425
393 Ga0068867_100005538
394 Ga0070685_10074769
395 Ga0070706_100238998
396 Ga0070679_100066768
397 Ga0070665_100021506
398 Ga0068861_100001093
399 Ga0068862_100011126
400 Ga0075364_10075403
401 Ga0075364_10103914
402 Ga0075369_10020728
403 Ga0075366_10102252
404 Ga0075366_10149942
405 Ga0075430_100025427
406 Ga0075431_100202560
407 Ga0068865_100003322
408 Ga0099824_1007647
409 Ga0099824_1009152
410 Ga0099822_1001874
411 Ga0099822_1056087
412 Ga0111539_10011235
413 Ga0111539_10082154
414 Ga0105245_10536727
415 Ga0105243_10016362
416 Ga0105241_10024416
417 Ga0105248_10166890
418 Ga0105237_10007705
419 Ga0105249_10019281
420 Ga0105249_10245062
421 Ga0105239_10013635
422 Ga0105239_10025536
423 Ga0157369_10006614
424 Ga0157369_10037813
425 Ga0157374_10181553
426 Ga0157375_10397129
427 Ga0207425_1030463
428 Ga0209677_101250
429 Ga0209233_1001020
430 Ga0209455_1007266
431 Ga0209758_1000021
432 Ga0209758_1000612
433 Ga0209758_1000626
434 Ga0209758_1001904
435 Ga0209758_1001907
436 Ga0209256_1002656
437 Ga0207426_1000430
438 Ga0207426_1020994
439 Ga0209257_1002171
440 Ga0209257_1012653
441 Ga0207688_10032463
442 Ga0207647_10024012
443 Ga0207645_10100382
444 Ga0207705_10035535
445 Ga0207705_10057575
446 Ga0207684_10285377
447 Ga0207695_10000015
448 Ga0207671_10005964
449 Ga0207657_10104296
450 Ga0207652_10127299
451 Ga0207681_10004157
452 Ga0207659_10040104
453 Ga0207706_10165079
454 Ga0207709_10302301
455 Ga0207711_10327119
456 Ga0207689_10094897
457 Ga0207689_10207483
458 Ga0207712_10005358
459 Ga0207712_10148087
460 Ga0207668_10011215
461 Ga0207668_10149830
462 Ga0207677_10242446
463 Ga0207639_10243235
464 Ga0207678_10155683
465 Ga0207708_10001723
466 Ga0207648_10009994
467 Ga0207675_100008289
468 Ga0207683_10010836
469 Ga0207683_10063895
470 Ga0207698_10370235
471 Ga0209389_1000264
472 Ga0209389_1000409
473 Ga0209589_1000003
474 Ga0209589_1000514
475 Ga0209489_100003
476 Ga0209489_100616
477 Ga0209700_100003
478 Ga0209700_100036
479 Ga0207428_10090779
480 Ga0207428_10113722
481 Ga0268266_10059009
482 Ga0268265_10008634
483 Ga0268265_10166010
484 Ga0307517_10000066
485 Ga0307515_10012922
486 Ga0265313_10017310
487 Ga0307508_10083279
488 Ga0265314_10021839
489 Ga0265342_10000319
490 Ga0316576_10033030
491 Ga0307416_100140022
492 Ga0307510_10033915
493 Ga0373939_0015872
494 Ga0373960_0019072
495 Ga0316574_0020919
496 Ga0373931_0030686
497 Ga0373935_0008726
498 Ga0373927_0013524
499 Ga0373927_0032314
500 Ga0316584_0058474
501 Ga0373925_0029169
502 Ga0395898_0015500
503 Ga0395905_0006402
504 Ga0436364_0681229
505 Ga0395901_0092999
506 Ga0400483_061614
507 Ga0400483_142796
508 Ga0400483_191556
509 Ga0400483_256427
510 Ga0436365_1099415
511 Ga0451807_2099978
512 Ga0439441_001225
513 Ga0450913_001226
514 Ga0439435_0014396
515 Ga0466969_0024200
516 Ga0466972_0000186
517 Ga0466972_0026814
518 Ga0466966_0000182
519 Ga0466961_0002402
520 Ga0466963_0052131
521 Ga0466971_0137636
522 Ga0466968_0009541
523 Ga0466970_0098031
524 Ga0466959_0083485
525 Ga0466967_0020735
526 Ga0495592_0057100
527 Ga0495590_0049016
528 Ga0495629_0014337
529 Ga0495629_0180091
530 Ga0495638_0002010
531 Ga0495638_0176422
532 Ga0495651_0060991
533 Ga0495664_0134245
534 Ga0495584_0058725
535 Ga0495606_0024371
536 Ga0495606_0043594
537 Ga0495608_0017088
538 Ga0495616_0034720
539 Ga0495628_0076319
540 Ga0495631_0046740
541 Ga0495632_0053011
542 Ga0495643_0037229
543 Ga0495648_0062774
544 Ga0495648_0152425
545 Ga0495642_0099077
546 Ga0495652_0041933
547 Ga0495640_0058869
548 Ga0495587_0174139
549 Ga0495609_0058358
550 Ga0495645_0078593
551 Ga0495667_0014168
552 Ga0495668_0089193
553 Ga0495668_0192391
554 Ga0495634_0047564
555 Ga0495611_0085893
556 Ga0495625_0153397
557 Ga0495635_0071535
558 Ga0495657_0007197
559 Ga0495599_0007542
560 Ga0495623_0037923
561 Ga0495669_0041678
562 Ga0495669_0106545
563 Ga0495600_0065108
564 Ga0495581_0104617
565 Ga0495604_0002465
566 Ga0495604_0043810
567 Ga0495674_0106764
568 Ga0495676_0142734
569 Ga0495680_0004851
570 Ga0495683_0128859
571 Ga0495684_0090151
572 Ga0495602_0045584
573 Ga0495602_0081946
574 Ga0496102_0130644
575 Ga0496104_0161472
576 Ga0496105_0005664
577 Ga0496109_0207827
578 Ga0496109_0548853
579 Ga0496112_0000218
580 Ga0496112_0192536
581 Ga0496112_0421102
582 Ga0496113_0220007
583 Ga0496115_0073970
584 Ga0496117_0088065
585 Ga0496118_0013455
586 Ga0496118_0018681
587 Ga0496120_0062808
588 Ga0496121_0023562
589 Ga0496121_0203675
590 Ga0496125_0036123
591 Ga0496126_0273730
592 Ga0495682_0038618
593 Ga0501031_0090009
594 Ga0501036_0080255
595 Ga0501040_0045110
596 Ga0501041_0055030
597 Ga0501042_0148847
598 Ga0501042_0202489
599 Ga0501047_0057472
600 Ga0501072_0046476
601 Ga0501075_0135044
602 Ga0501079_0080400
603 Ga0501081_0130098
604 Ga0501083_0065241
605 Ga0501283_008656
606 Ga0501044_0086559
607 Ga0501045_0028778
608 nmdc:mga0yw44_83544_c1
609 nmdc:mga06z11_90549_c1
610 nmdc:mga0qj67_3865_c1
611 nmdc:mga08y16_39261_c1
612 Ga0495595_0087334
613 Ga0500643_000015
614 Ga0500651_0001088
615 Ga0500555_006743
616 Ga0500557_000002
617 Ga0500562_004019
618 Ga0500569_002399
619 Ga0500572_000075
620 Ga0500595_008957
621 Ga0500614_006102
622 Ga0500626_126230
623 Ga0500642_0000146
624 Ga0500642_0077787
625 Ga0500658_0012096
626 Ga0500658_0082487
627 Ga0500559_0000075
628 Ga0500559_0047371
629 Ga0500568_0051891
630 Ga0500589_037521
631 Ga0500616_0028098
632 Ga0500627_0090829
633 Ga0500634_0078082
634 Ga0500638_074465
635 Ga0500639_005468
636 Ga0500637_0117975
637 Ga0500625_001167
638 Ga0500609_003437
639 Ga0500596_006266
640 2507508735
641 2508542827
642 2511393870
643 2513623182
644 2513639133
645 2513720850
646 2515628222
647 2524440424
648 2617348877
649 2745075307
650 2793064256
651 2819613424
652 2824673219
653 2824681862
654 2824691292
655 2824706855
656 2824751488
657 2824756825
658 2824767418
659 2824777727
660 2838123899
661 2841949996
662 2841958526
663 2841983279
664 2842039216
665 2842047837
666 2842335738
667 2844318949
668 2847936073
669 2849079459
670 2854920765
671 2868094302
672 2874593465
673 2874627253
674 2874633253
675 2874649019
676 2876767114
677 2876773118
678 2876822008
679 2879077163
680 2879090051
681 2879130068
682 2879147015
683 2881367082
684 2881417437
685 2881671033
686 2885370410
687 2903729127
688 2904671228
689 2904720684
690 2906610172
691 2906629876
692 2922397844
693 2932797638
694 2932802956
695 2935608733
696 2935773154
697 2935778402
698 2935790481
699 2935798210
700 2935821894
701 2935847476
702 2935885295
703 2935966337
704 2935977161
705 2941532597
706 3005487203
707 3005599090
708 3005722183
709 8005648567
710 8016529760
711 8016548196
712 8016553934
713 8016562310
714 8016573328
715 8016577465
716 8016591959
717 8016626691
718 8019627978
719 8019634623
720 8019645092
721 8019658233
722 8019662516
723 8019672014
724 8019684081
725 8019689907
726 8054566705
727 8056967892
728 8057135780

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04166

PdxA

Pyridoxal phosphate biosynthetic protein PdxA

45

332

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lxy-assembly1.cif.gz_A-2 crystal structure of 4-hydroxythreonine-4-phosphate dehydrogenase from yersinia pestis co92 0.9128 3 331
1ps6-assembly1.cif.gz_A crystal structure of e.coli pdxa 0.9059 2 332
1yxo-assembly1.cif.gz_B crystal structure of pyridoxal phosphate biosynthetic protein pdxa pa0593 0.9058 5 331
1ps6-assembly1.cif.gz_A crystal structure of e.coli pdxa 0.9007 2 332
3lxy-assembly1.cif.gz_A-2 crystal structure of 4-hydroxythreonine-4-phosphate dehydrogenase from yersinia pestis co92 0.8996 3 331
ID Description Score Start End Superfamily
1r8kA00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8848 3 332 3.40.718.10
1r8kA00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8796 3 332 3.40.718.10
2hi1B00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8486 5 327 3.40.718.10
2hi1B00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8412 5 327 3.40.718.10
4jqpB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8404 2 328 3.40.718.10
ID Description Score Start End GO Terms
AF-A0A7T8BMQ6-F1-model_v4 deleted 0.9922 1 331
AF-A0A7T8BMQ6-F1-model_v4 deleted 0.9805 1 331
AF-A0A848Y3N8-F1-model_v4 4-hydroxythreonine-4-phosphate dehydrogenase PdxA 0.9767 120 336 GO:0016491
GO:0046872
GO:0051287
AF-A0A2D7FE85-F1-model_v4 4-hydroxythreonine-4-phosphate dehydrogenase 0.9763 11 335 GO:0016491
GO:0046872
GO:0051287
AF-A0A848Y3N8-F1-model_v4 4-hydroxythreonine-4-phosphate dehydrogenase PdxA 0.9723 120 336 GO:0016491
GO:0046872
GO:0051287

Map