F423374

General Info

Members Datasets Scaffolds Average Seq Length
364 240 306 224

Family's Representative Sequence

Representative Sequence 3300031838|Ga0307518_10407373|Ga0307518_104073731
Length 218
Sequence VRAVEAGTSTAFWAPGSQILWRYRENAGPRFHIARPVTVVRDDEELLAVWMAPGTECVKPVLADGTSVHGEPLETRYTKPRTVQLDRWFGTGVLKLARPGEPWSVWLFWEPGWRFKNWYVNLEEPLARWAGGVDSEDHFLDITVDPDRSWRFAQAQRDGLMDPQLAERVRKAGWSAVDVIRAWGAPFADGWQHWRPDPSWAVPSLPEDWDRTPAHMST

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
4 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
5 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
6 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
7 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
8 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
9 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
10 2643221714 Streptomyces sp. Root264 Isolate Unclassified
11 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
12 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
13 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
14 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
15 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
16 2808606448 Streptomyces sp. 193411 Isolate Unclassified
17 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
18 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
19 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
20 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
21 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
22 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
23 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
24 2862574272 Streptomyces sp. AcE210 Isolate Nodule
25 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
26 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
27 2867428634 Streptomyces sp. RP5T Isolate Unclassified
28 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
29 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
30 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
31 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
32 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
33 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
34 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
35 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
36 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
37 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
38 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
39 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
40 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
41 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
42 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
43 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
44 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
45 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
46 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
47 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
48 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
49 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
50 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
51 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
52 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
53 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
54 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
76 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
77 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
78 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
79 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
80 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
83 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
84 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
85 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
86 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
89 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
94 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
95 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
96 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
97 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
98 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
99 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
100 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
101 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
102 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
103 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
104 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
105 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
106 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
107 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
108 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
109 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
110 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
111 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
112 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
133 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
134 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
139 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
140 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
148 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
160 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
175 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
176 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
177 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
189 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
190 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
191 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
197 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
201 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
220 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
221 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
222 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
225 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
226 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
227 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
228 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
229 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
230 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
231 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
232 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
233 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
234 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
235 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
236 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
237 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
238 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
239 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
240 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.52
Metatranscriptomes 0.55
Isolates 15.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.67
Nodule 0.55
Rhizoplane 1.1
Rhizosphere 77.75
Stem 0
Stem Tuber 0
Unclassified 15.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10024070 3300001989 Bacteria 2150
2 JGI24738J21930_10008393 3300002075 Bacteria 2351
3 rootL2_10010335 3300003322 Bacteria 1689
4 rootL2_10010336 3300003322 Bacteria 2117
5 rootL2_10129193 3300003322 Bacteria 1233
6 rootH1_10024409 3300003323 Bacteria 1725
7 rootH1_10053824 3300003323 Bacteria 1505
8 Ga0006562J51391_1038744 3300003578 Bacteria 1840
9 Ga0006562J51391_1042226 3300003578 Bacteria 6420
10 Ga0070670_100759354 3300005331 Bacteria 874
11 Ga0070674_100306963 3300005356 Bacteria 1267
12 Ga0068855_100437501 3300005563 Bacteria 1429
13 Ga0068854_100415605 3300005578 Bacteria 1116
14 Ga0081455_10182755 3300005937 Bacteria 1586
15 Ga0075365_10050168 3300006038 Bacteria 2753
16 Ga0075368_10007990 3300006042 Bacteria 3752
17 Ga0075363_100024055 3300006048 Bacteria 3093
18 Ga0075367_10001478 3300006178 Bacteria 10147
19 Ga0075370_10094038 3300006353 Bacteria 1730
20 Ga0105243_10104939 3300009148 Bacteria 2353
21 Ga0105246_10011942 3300011119 Bacteria 5405
22 Ga0157372_10135234 3300013307 Bacteria 2838
23 Ga0182008_10008765 3300014497 Bacteria 5497
24 Ga0182006_1017237 3300015261 Bacteria 3071
25 Ga0182007_10000817 3300015262 Bacteria 17355
26 Ga0183367_1002 3300015688 Bacteria 1101531
27 Ga0207647_10052224 3300025904 Bacteria 2524
28 Ga0207709_10365455 3300025935 Bacteria 1094
29 Ga0207667_10441717 3300025949 Bacteria 1323
30 Ga0209371_1008853 3300027312 Bacteria 3279
31 Ga0209813_10003255 3300027866 Bacteria 3793
32 Ga0307517_10124205 3300028786 Bacteria 1891
33 Ga0307515_10000573 3300028794 Bacteria 86907
34 Ga0307515_10055445 3300028794 Bacteria 5791
35 Ga0307515_10209657 3300028794 Bacteria 1796
36 Ga0268256_1007986 3300030500 Bacteria 3684
37 Ga0307511_10040960 3300030521 Bacteria 3921
38 Ga0307512_10003826 3300030522 Bacteria 16969
39 Ga0307512_10044717 3300030522 Bacteria 3636
40 Ga0307513_10013013 3300031456 Bacteria 10234
41 Ga0307513_10179790 3300031456 Bacteria 1980
42 Ga0307509_10525986 3300031507 Bacteria 863
43 Ga0307508_10068782 3300031616 Bacteria 3111
44 Ga0307508_10240787 3300031616 Bacteria 1406
45 Ga0307514_10002934 3300031649 Bacteria 16969
46 Ga0307514_10073390 3300031649 Bacteria 2559
47 Ga0307516_10019613 3300031730 Bacteria 7000
48 Ga0307516_10067321 3300031730 Bacteria 3451
49 Ga0307518_10269122 3300031838 Bacteria 1065
50 Ga0307518_10407373 3300031838 Bacteria 754
51 Ga0307416_100354343 3300032002 Bacteria 1487
52 Ga0307416_100588834 3300032002 Bacteria 1191
53 Ga0307507_10049362 3300033179 Bacteria 4079
54 Ga0307510_10048062 3300033180 Bacteria 4558
55 Ga0307510_10048170 3300033180 Bacteria 4551
56 Ga0307510_10210981 3300033180 Bacteria 1464
57 Ga0395900_0130924 3300037418 Bacteria 2571
58 Ga0395898_0003080 3300037466 Bacteria 18879
59 Ga0395898_0063838 3300037466 Bacteria 3573
60 Ga0395898_0172696 3300037466 Bacteria 2066
61 Ga0395901_0246501 3300038443 Bacteria 1862
62 Ga0439436_0000677 3300041404 Bacteria 9155
63 Ga0439439_0002611 3300041406 Bacteria 3854
64 Ga0439439_0006242 3300041406 Bacteria 2753
65 Ga0439439_0037939 3300041406 Bacteria 1243
66 Ga0451793_1229270 3300041452 Bacteria 706
67 Ga0451795_0635336 3300041456 Bacteria 1454
68 Ga0451835_0654287 3300041492 Bacteria 1388
69 Ga0451843_1323335 3300041509 Bacteria 1250
70 Ga0451853_0275255 3300041512 Bacteria 3064
71 Ga0451853_1951995 3300041512 Bacteria 3810
72 Ga0439433_0009580 3300041999 Bacteria 2113
73 Ga0439442_012928 3300042002 Bacteria 1710
74 Ga0439449_0001239 3300042007 Bacteria 10006
75 Ga0439449_0056851 3300042007 Bacteria 1444
76 Ga0439449_0066988 3300042007 Bacteria 1324
77 Ga0439449_0123570 3300042007 Bacteria 961
78 Ga0439457_000434 3300042014 Bacteria 12041
79 Ga0439457_003468 3300042014 Bacteria 4290
80 Ga0439462_0006513 3300042015 Bacteria 2904
81 Ga0450894_001478 3300042131 Bacteria 3361
82 Ga0450896_000583 3300042133 Bacteria 3925
83 Ga0450899_000960 3300042135 Bacteria 3274
84 Ga0450903_022821 3300042138 Bacteria 964
85 Ga0450906_000159 3300042145 Bacteria 12639
86 Ga0439458_0015537 3300042157 Bacteria 1726
87 Ga0466969_0012659 3300044656 Bacteria 4444
88 Ga0466972_0000424 3300044658 Bacteria 21937
89 Ga0466972_0009269 3300044658 Bacteria 4945
90 Ga0466972_0057661 3300044658 Bacteria 1865
91 Ga0466972_0060595 3300044658 Bacteria 1815
92 Ga0466965_0002786 3300044683 Bacteria 7519
93 Ga0466965_0027815 3300044683 Bacteria 2745
94 Ga0466966_0000750 3300044684 Bacteria 20552
95 Ga0466966_0106950 3300044684 Bacteria 1726
96 Ga0466961_0020148 3300044693 Bacteria 4292
97 Ga0466963_0000109 3300044694 Bacteria 30106
98 Ga0466963_0039959 3300044694 Bacteria 3074
99 Ga0466964_0004389 3300044706 Bacteria 5201
100 Ga0466971_0001622 3300044719 Bacteria 9493
101 Ga0466971_0040918 3300044719 Bacteria 2082
102 Ga0466971_0049832 3300044719 Bacteria 1884
103 Ga0466968_0025468 3300044735 Bacteria 2422
104 Ga0466970_0000171 3300044765 Bacteria 30809
105 Ga0466970_0278584 3300044765 Bacteria 940
106 Ga0466957_0003967 3300044842 Bacteria 8175
107 Ga0466960_0010259 3300044901 Bacteria 3888
108 Ga0466959_0001807 3300045049 Bacteria 13392
109 Ga0466959_0054807 3300045049 Bacteria 2912
110 Ga0466958_0032325 3300045836 Bacteria 3112
111 Ga0466958_0238257 3300045836 Bacteria 1162
112 Ga0466967_0002858 3300045976 Bacteria 10968
113 Ga0466967_0013582 3300045976 Bacteria 6300
114 Ga0466967_0066844 3300045976 Bacteria 3204
115 Ga0466967_0708542 3300045976 Bacteria 997
116 Ga0495627_010893 3300046453 Bacteria 3284
117 Ga0495592_0014600 3300046454 Bacteria 5962
118 Ga0495592_0087591 3300046454 Bacteria 2239
119 Ga0495603_0005694 3300046455 Bacteria 7447
120 Ga0495603_0010034 3300046455 Bacteria 5729
121 Ga0495603_0012310 3300046455 Bacteria 5177
122 Ga0495603_0171279 3300046455 Bacteria 1257
123 Ga0495629_0004705 3300046459 Bacteria 10230
124 Ga0495629_0042351 3300046459 Bacteria 3200
125 Ga0495629_0049190 3300046459 Bacteria 2955
126 Ga0495629_0321597 3300046459 Bacteria 1057
127 Ga0495638_0031891 3300046460 Bacteria 3383
128 Ga0495638_0161015 3300046460 Bacteria 1295
129 Ga0495638_0167201 3300046460 Bacteria 1264
130 Ga0495651_0003297 3300046462 Bacteria 12391
131 Ga0495651_0212740 3300046462 Bacteria 1344
132 Ga0495582_0281707 3300046473 Bacteria 955
133 Ga0495605_0076748 3300046474 Bacteria 1569
134 Ga0495662_0001181 3300046476 Bacteria 12890
135 Ga0495662_0032817 3300046476 Bacteria 2508
136 Ga0495664_0002572 3300046477 Bacteria 9753
137 Ga0495585_0335792 3300046492 Bacteria 736
138 Ga0495594_0003595 3300046499 Bacteria 7967
139 Ga0495594_0019491 3300046499 Bacteria 3604
140 Ga0495594_0047555 3300046499 Bacteria 2356
141 Ga0495594_0078759 3300046499 Bacteria 1839
142 Ga0495594_0202889 3300046499 Bacteria 1130
143 Ga0495596_0096054 3300046500 Bacteria 1151
144 Ga0495607_0050051 3300046501 Bacteria 2434
145 Ga0495583_0041093 3300046506 Bacteria 2168
146 Ga0495583_0059637 3300046506 Bacteria 1709
147 Ga0495606_0032109 3300046507 Bacteria 3641
148 Ga0495606_0199494 3300046507 Bacteria 1141
149 Ga0495608_0029340 3300046511 Bacteria 3732
150 Ga0495610_0021419 3300046512 Bacteria 3556
151 Ga0495618_0111525 3300046514 Bacteria 1751
152 Ga0495620_0015165 3300046515 Bacteria 3896
153 Ga0495620_0023957 3300046515 Bacteria 2909
154 Ga0495630_0015485 3300046517 Bacteria 5569
155 Ga0495630_0200729 3300046517 Bacteria 1522
156 Ga0495631_0003753 3300046518 Bacteria 8272
157 Ga0495631_0098576 3300046518 Bacteria 1258
158 Ga0495632_0232539 3300046519 Bacteria 831
159 Ga0495643_0047556 3300046522 Bacteria 2322
160 Ga0495644_0038646 3300046523 Bacteria 1800
161 Ga0495648_0027479 3300046524 Bacteria 3807
162 Ga0495648_0163966 3300046524 Bacteria 1145
163 Ga0495666_0031945 3300046526 Bacteria 2579
164 Ga0495666_0050907 3300046526 Bacteria 1990
165 Ga0495652_0023264 3300046529 Bacteria 5493
166 Ga0495654_0199650 3300046530 Bacteria 856
167 Ga0495665_0054734 3300046531 Bacteria 2108
168 Ga0495640_0009882 3300046533 Bacteria 7400
169 Ga0495640_0261013 3300046533 Bacteria 1082
170 Ga0495586_0047101 3300046535 Bacteria 2326
171 Ga0495587_0004861 3300046536 Bacteria 8815
172 Ga0495597_0033864 3300046542 Bacteria 2310
173 Ga0495597_0130537 3300046542 Bacteria 1042
174 Ga0495622_0008428 3300046557 Bacteria 4772
175 Ga0495622_0011926 3300046557 Bacteria 4020
176 Ga0495633_0016192 3300046558 Bacteria 3852
177 Ga0495668_0023666 3300046616 Bacteria 3499
178 Ga0495634_0001501 3300046642 Bacteria 20644
179 Ga0495634_0247121 3300046642 Bacteria 1092
180 Ga0495611_0163093 3300046648 Bacteria 1041
181 Ga0495625_0064659 3300046660 Bacteria 2580
182 Ga0495625_0079413 3300046660 Bacteria 2287
183 Ga0495635_0000408 3300046663 Bacteria 27373
184 Ga0495635_0075719 3300046663 Bacteria 2305
185 Ga0495661_0026117 3300046665 Bacteria 3763
186 Ga0495657_0010509 3300046675 Bacteria 6964
187 Ga0495599_0134953 3300046678 Bacteria 1532
188 Ga0495623_0031384 3300046679 Bacteria 3416
189 Ga0495646_0011593 3300046680 Bacteria 5600
190 Ga0495646_0065081 3300046680 Bacteria 2159
191 Ga0495613_0005554 3300046689 Bacteria 9468
192 Ga0495613_0020739 3300046689 Bacteria 4899
193 Ga0495613_0036411 3300046689 Bacteria 3649
194 Ga0495613_0191367 3300046689 Bacteria 1445
195 Ga0495624_0031847 3300046690 Bacteria 3424
196 Ga0495624_0094996 3300046690 Bacteria 1837
197 Ga0495624_0326689 3300046690 Bacteria 923
198 Ga0495670_0017131 3300046691 Bacteria 3564
199 Ga0495671_0029187 3300046692 Bacteria 2835
200 Ga0495671_0115242 3300046692 Bacteria 1312
201 Ga0495649_0016994 3300046694 Bacteria 4117
202 Ga0495649_0098942 3300046694 Bacteria 1551
203 Ga0495589_0012130 3300046794 Bacteria 4468
204 Ga0495589_0033526 3300046794 Bacteria 2578
205 Ga0495589_0042999 3300046794 Bacteria 2250
206 Ga0495589_0044916 3300046794 Bacteria 2195
207 Ga0495600_0091155 3300046809 Bacteria 1988
208 Ga0495600_0126038 3300046809 Bacteria 1665
209 Ga0495660_0112400 3300046810 Bacteria 1388
210 Ga0495660_0331119 3300046810 Bacteria 681
211 Ga0495581_0002268 3300047315 Bacteria 10824
212 Ga0495581_0020191 3300047315 Bacteria 3868
213 Ga0495604_0000920 3300047317 Bacteria 24512
214 Ga0495604_0037593 3300047317 Bacteria 3811
215 Ga0495636_0008378 3300047318 Bacteria 4081
216 Ga0495636_0112998 3300047318 Bacteria 1196
217 Ga0495674_0089073 3300047319 Bacteria 2638
218 Ga0495672_0024650 3300047320 Bacteria 3871
219 Ga0495676_0005032 3300047321 Bacteria 12125
220 Ga0495676_0007106 3300047321 Bacteria 10273
221 Ga0495676_0011719 3300047321 Bacteria 7906
222 Ga0495676_0012000 3300047321 Bacteria 7815
223 Ga0495676_0077773 3300047321 Bacteria 2528
224 Ga0495676_0124346 3300047321 Bacteria 1871
225 Ga0495676_0177137 3300047321 Bacteria 1496
226 Ga0495687_002642 3300047443 Bacteria 14003
227 Ga0495687_002800 3300047443 Bacteria 13453
228 Ga0495687_045741 3300047443 Bacteria 1893
229 Ga0495687_064595 3300047443 Bacteria 1493
230 Ga0495675_0012165 3300047444 Bacteria 5414
231 Ga0495675_0039668 3300047444 Bacteria 2999
232 Ga0495675_0352979 3300047444 Bacteria 864
233 Ga0495677_0102338 3300047445 Bacteria 1085
234 Ga0495685_002305 3300047447 Bacteria 5956
235 Ga0495685_008215 3300047447 Bacteria 3459
236 Ga0495685_014676 3300047447 Bacteria 2664
237 Ga0495685_052241 3300047447 Bacteria 1384
238 Ga0495673_0082816 3300047469 Bacteria 1326
239 Ga0495681_0010706 3300047470 Bacteria 5530
240 Ga0495681_0016281 3300047470 Bacteria 4175
241 Ga0495684_0033325 3300047471 Bacteria 3952
242 Ga0495684_0045396 3300047471 Bacteria 3363
243 Ga0495686_0020204 3300047472 Bacteria 4443
244 Ga0495686_0163507 3300047472 Bacteria 1299
245 Ga0495593_0014884 3300047673 Bacteria 4419
246 Ga0495602_0328100 3300048088 Bacteria 1111
247 Ga0495614_0000594 3300048089 Bacteria 15141
248 Ga0495614_0082384 3300048089 Bacteria 1394
249 Ga0495614_0238179 3300048089 Bacteria 830
250 Ga0495626_0004500 3300048091 Bacteria 8532
251 Ga0496106_0182115 3300048909 Bacteria 1668
252 Ga0496109_0040793 3300048912 Bacteria 4205
253 Ga0495678_032395 3300049459 Bacteria 2168
254 Ga0495682_0111827 3300049460 Bacteria 979
255 Ga0501031_0201530 3300049568 Bacteria 1298
256 Ga0501032_0014662 3300049569 Bacteria 5550
257 Ga0501032_0246954 3300049569 Bacteria 1159
258 Ga0501033_0003398 3300049570 Bacteria 13119
259 Ga0501033_0111607 3300049570 Bacteria 1989
260 Ga0501033_0120176 3300049570 Bacteria 1907
261 Ga0501034_0013042 3300049571 Bacteria 8566
262 Ga0501034_0017128 3300049571 Bacteria 7434
263 Ga0501034_0139788 3300049571 Bacteria 2402
264 Ga0501034_0480445 3300049571 Bacteria 1158
265 Ga0501036_0046479 3300049572 Bacteria 3676
266 Ga0501036_0251553 3300049572 Bacteria 1481
267 Ga0501037_0195359 3300049573 Bacteria 1431
268 Ga0501038_0002494 3300049574 Bacteria 17131
269 Ga0501038_0055989 3300049574 Bacteria 3387
270 Ga0501038_0120440 3300049574 Bacteria 2165
271 Ga0501039_0084237 3300049575 Bacteria 2476
272 Ga0501042_0034680 3300049578 Bacteria 3579
273 Ga0501043_0005465 3300049579 Bacteria 10274
274 Ga0501043_0135594 3300049579 Bacteria 1928
275 Ga0501043_0146385 3300049579 Bacteria 1849
276 Ga0501046_0027825 3300049580 Bacteria 4608
277 Ga0501047_0027224 3300049581 Bacteria 5506
278 Ga0501047_0309144 3300049581 Bacteria 1421
279 Ga0501047_0411023 3300049581 Bacteria 1185
280 Ga0501048_0005189 3300049582 Bacteria 9921
281 Ga0501048_0056879 3300049582 Bacteria 2775
282 Ga0501070_0014818 3300049586 Bacteria 6560
283 Ga0501080_0382793 3300049742 Bacteria 1267
284 Ga0501035_0004966 3300049822 Bacteria 12612
285 Ga0501035_0030216 3300049822 Bacteria 4939
286 Ga0501035_0079611 3300049822 Bacteria 2894
287 Ga0501044_0063374 3300049823 Bacteria 3777
288 Ga0501044_0065914 3300049823 Bacteria 3693
289 Ga0501044_0133279 3300049823 Bacteria 2477
290 Ga0501044_0183610 3300049823 Bacteria 2057
291 Ga0501044_0518015 3300049823 Bacteria 1092
292 nmdc:mga03n38_125513_c1 3300050490 Bacteria 1266
293 nmdc:mga03n38_9377_c1 3300050490 Bacteria 3559
294 nmdc:mga06z11_1659_c1 3300050494 Bacteria 8343
295 nmdc:mga04h51_3863_c1 3300050495 Bacteria 3682
296 nmdc:mga07m45_99333_c1 3300050496 Bacteria 1671
297 Ga0495619_0129077 3300053085 Bacteria 1736
298 Ga0500644_0010885 3300053088 Bacteria 2471
299 Ga0500640_011625 3300053095 Bacteria 3592
300 Ga0500650_0098376 3300053098 Bacteria 1370
301 Ga0500572_034770 3300053111 Bacteria 1429
302 Ga0500573_0242635 3300053140 Bacteria 933
303 Ga0500624_016027 3300053157 Bacteria 1152
304 Ga0466962_0000168 3300061719 Bacteria 27818
305 Ga0466962_0043767 3300061719 Bacteria 2142
306 Ga0466962_0056452 3300061719 Bacteria 1875

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046492 Ga0495585_0335792 Ga0495585_0335792_142_708 188
2 3300046507 Ga0495606_0199494 Ga0495606_0199494_331_897 188
3 3300046517 Ga0495630_0200729 Ga0495630_0200729_12_578 188
4 3300046523 Ga0495644_0038646 Ga0495644_0038646_482_1048 188
5 3300046526 Ga0495666_0050907 Ga0495666_0050907_305_871 188
6 3300046663 Ga0495635_0075719 Ga0495635_0075719_1660_2226 188
7 3300046690 Ga0495624_0326689 Ga0495624_0326689_11_577 188
8 3300046794 Ga0495589_0042999 Ga0495589_0042999_1400_1966 188
9 3300046810 Ga0495660_0331119 Ga0495660_0331119_87_653 188
10 3300047443 Ga0495687_064595 Ga0495687_064595_18_584 188
11 3300047445 Ga0495677_0102338 Ga0495677_0102338_338_904 188
12 3300047447 Ga0495685_008215 Ga0495685_008215_928_1494 188
13 3300047447 Ga0495685_052241 Ga0495685_052241_797_1363 188
14 3300049460 Ga0495682_0111827 Ga0495682_0111827_325_891 188
15 3300041452 Ga0451793_1229270 Ga0451793_1229270_70_645 191
16 3300006038 Ga0075365_10050168 Ga0075365_100501682 215
17 3300049568 Ga0501031_0201530 Ga0501031_0201530_57_704 215
18 3300049569 Ga0501032_0014662 Ga0501032_0014662_2540_3187 215
19 3300049570 Ga0501033_0120176 Ga0501033_0120176_1023_1670 215
20 3300049572 Ga0501036_0251553 Ga0501036_0251553_366_1013 215
21 3300049573 Ga0501037_0195359 Ga0501037_0195359_554_1201 215
22 3300049574 Ga0501038_0055989 Ga0501038_0055989_431_1078 215
23 3300049578 Ga0501042_0034680 Ga0501042_0034680_2798_3445 215
24 3300049579 Ga0501043_0146385 Ga0501043_0146385_764_1411 215
25 3300049580 Ga0501046_0027825 Ga0501046_0027825_2778_3425 215
26 3300049581 Ga0501047_0027224 Ga0501047_0027224_4624_5271 215
27 3300049582 Ga0501048_0005189 Ga0501048_0005189_8650_9297 215
28 3300049822 Ga0501035_0030216 Ga0501035_0030216_3172_3819 215
29 3300049823 Ga0501044_0133279 Ga0501044_0133279_795_1442 215
30 iso_pu_bacteria 2582581312 2585296270 215
31 iso_pu_bacteria 2808606982 2811844746 215
32 3300046460 Ga0495638_0161015 Ga0495638_0161015_66_782 217
33 iso_pu_bacteria 2643221587 2643941646 217
34 iso_pu_bacteria 2643221677 2644428730 217
35 iso_pu_bacteria 2912757875 2912762459 217
36 iso_pu_bacteria 2918501144 2918506181 217
37 iso_pu_bacteria 8025530807 8025537628 217
38 iso_pu_bacteria 8033684223 8033691482 217
39 3300031838 Ga0307518_10407373 Ga0307518_104073731 218
40 3300032002 Ga0307416_100588834 Ga0307416_1005888341 218
41 3300046455 Ga0495603_0005694 Ga0495603_0005694_2952_3668 218
42 3300046459 Ga0495629_0004705 Ga0495629_0004705_6553_7269 218
43 3300046459 Ga0495629_0042351 Ga0495629_0042351_1185_1901 218
44 3300046499 Ga0495594_0003595 Ga0495594_0003595_7222_7938 218
45 3300046557 Ga0495622_0011926 Ga0495622_0011926_458_1174 218
46 3300046689 Ga0495613_0005554 Ga0495613_0005554_7935_8651 218
47 3300047321 Ga0495676_0005032 Ga0495676_0005032_7512_8228 218
48 3300047321 Ga0495676_0007106 Ga0495676_0007106_6885_7601 218
49 3300048089 Ga0495614_0000594 Ga0495614_0000594_14077_14793 218
50 3300048909 Ga0496106_0182115 Ga0496106_0182115_678_1394 218
51 iso_pu_bacteria 2862178590 2862185007 218
52 iso_pu_bacteria 2862705112 2862708298 219
53 iso_pu_bacteria 2873151551 2873154395 219
54 iso_pu_bacteria 2990044586 2990048404 219
55 iso_pu_bacteria 8008485437 8008491278 219
56 iso_pu_bacteria 8025524527 8025530607 219
57 iso_pu_bacteria 2582581313 2585307104 220
58 iso_pu_bacteria 2582581314 2585316257 220
59 iso_pu_bacteria 2616644814 2616696990 220
60 iso_pu_bacteria 2784746763 2785341495 220
61 iso_pu_bacteria 2784746768 2785371170 220
62 iso_pu_bacteria 2811994879 2812356326 220
63 iso_pu_bacteria 2852635781 2852640340 220
64 iso_pu_bacteria 2946064051 2946069532 220
65 iso_pu_bacteria 2947224130 2947227297 220
66 iso_pu_bacteria 8048406513 8048406785 220
67 3300005937 Ga0081455_10182755 Ga0081455_101827552 221
68 3300028786 Ga0307517_10124205 Ga0307517_101242052 221
69 3300028794 Ga0307515_10055445 Ga0307515_100554454 221
70 3300030521 Ga0307511_10040960 Ga0307511_100409603 221
71 3300030522 Ga0307512_10003826 Ga0307512_1000382612 221
72 3300031456 Ga0307513_10013013 Ga0307513_100130132 221
73 3300031616 Ga0307508_10240787 Ga0307508_102407872 221
74 3300031649 Ga0307514_10002934 Ga0307514_1000293410 221
75 3300031649 Ga0307514_10073390 Ga0307514_100733902 221
76 3300031730 Ga0307516_10019613 Ga0307516_100196132 221
77 3300031730 Ga0307516_10067321 Ga0307516_100673212 221
78 3300033179 Ga0307507_10049362 Ga0307507_100493621 221
79 3300033180 Ga0307510_10048170 Ga0307510_100481702 221
80 3300033180 Ga0307510_10210981 Ga0307510_102109811 221
81 3300037418 Ga0395900_0130924 Ga0395900_0130924_125_832 221
82 3300037466 Ga0395898_0003080 Ga0395898_0003080_8983_9690 221
83 3300038443 Ga0395901_0246501 Ga0395901_0246501_459_1166 221
84 3300041406 Ga0439439_0006242 Ga0439439_0006242_383_1048 221
85 3300041456 Ga0451795_0635336 Ga0451795_0635336_369_1034 221
86 3300041492 Ga0451835_0654287 Ga0451835_0654287_133_798 221
87 3300041509 Ga0451843_1323335 Ga0451843_1323335_538_1203 221
88 3300041512 Ga0451853_0275255 Ga0451853_0275255_1844_2509 221
89 3300041512 Ga0451853_1951995 Ga0451853_1951995_1932_2597 221
90 3300042007 Ga0439449_0066988 Ga0439449_0066988_641_1306 221
91 3300042007 Ga0439449_0123570 Ga0439449_0123570_172_837 221
92 3300042014 Ga0439457_000434 Ga0439457_000434_7520_8185 221
93 3300044656 Ga0466969_0012659 Ga0466969_0012659_2496_3179 221
94 3300044658 Ga0466972_0000424 Ga0466972_0000424_11259_11942 221
95 3300044658 Ga0466972_0060595 Ga0466972_0060595_725_1408 221
96 3300044683 Ga0466965_0027815 Ga0466965_0027815_2029_2712 221
97 3300044684 Ga0466966_0106950 Ga0466966_0106950_301_984 221
98 3300044719 Ga0466971_0040918 Ga0466971_0040918_641_1324 221
99 3300044735 Ga0466968_0025468 Ga0466968_0025468_420_1103 221
100 3300045049 Ga0466959_0054807 Ga0466959_0054807_838_1521 221
101 3300046453 Ga0495627_010893 Ga0495627_010893_900_1565 221
102 3300046454 Ga0495592_0014600 Ga0495592_0014600_3031_3696 221
103 3300046454 Ga0495592_0087591 Ga0495592_0087591_321_986 221
104 3300046455 Ga0495603_0010034 Ga0495603_0010034_2720_3385 221
105 3300046455 Ga0495603_0012310 Ga0495603_0012310_845_1537 221
106 3300046455 Ga0495603_0171279 Ga0495603_0171279_405_1097 221
107 3300046459 Ga0495629_0049190 Ga0495629_0049190_927_1592 221
108 3300046459 Ga0495629_0321597 Ga0495629_0321597_238_903 221
109 3300046460 Ga0495638_0167201 Ga0495638_0167201_226_918 221
110 3300046462 Ga0495651_0003297 Ga0495651_0003297_10658_11323 221
111 3300046462 Ga0495651_0212740 Ga0495651_0212740_582_1247 221
112 3300046473 Ga0495582_0281707 Ga0495582_0281707_40_705 221
113 3300046474 Ga0495605_0076748 Ga0495605_0076748_785_1477 221
114 3300046476 Ga0495662_0001181 Ga0495662_0001181_10657_11322 221
115 3300046476 Ga0495662_0032817 Ga0495662_0032817_1484_2149 221
116 3300046477 Ga0495664_0002572 Ga0495664_0002572_6478_7143 221
117 3300046499 Ga0495594_0019491 Ga0495594_0019491_2174_2839 221
118 3300046499 Ga0495594_0047555 Ga0495594_0047555_1491_2156 221
119 3300046499 Ga0495594_0078759 Ga0495594_0078759_464_1156 221
120 3300046500 Ga0495596_0096054 Ga0495596_0096054_343_1035 221
121 3300046501 Ga0495607_0050051 Ga0495607_0050051_1712_2377 221
122 3300046506 Ga0495583_0041093 Ga0495583_0041093_570_1235 221
123 3300046506 Ga0495583_0059637 Ga0495583_0059637_848_1513 221
124 3300046507 Ga0495606_0032109 Ga0495606_0032109_1713_2378 221
125 3300046511 Ga0495608_0029340 Ga0495608_0029340_715_1380 221
126 3300046512 Ga0495610_0021419 Ga0495610_0021419_936_1601 221
127 3300046514 Ga0495618_0111525 Ga0495618_0111525_866_1531 221
128 3300046515 Ga0495620_0015165 Ga0495620_0015165_2174_2839 221
129 3300046515 Ga0495620_0023957 Ga0495620_0023957_440_1105 221
130 3300046517 Ga0495630_0015485 Ga0495630_0015485_2682_3347 221
131 3300046518 Ga0495631_0003753 Ga0495631_0003753_3899_4564 221
132 3300046518 Ga0495631_0098576 Ga0495631_0098576_527_1219 221
133 3300046519 Ga0495632_0232539 Ga0495632_0232539_117_782 221
134 3300046522 Ga0495643_0047556 Ga0495643_0047556_1381_2046 221
135 3300046524 Ga0495648_0027479 Ga0495648_0027479_2027_2692 221
136 3300046524 Ga0495648_0163966 Ga0495648_0163966_140_805 221
137 3300046526 Ga0495666_0031945 Ga0495666_0031945_179_844 221
138 3300046529 Ga0495652_0023264 Ga0495652_0023264_1642_2307 221
139 3300046530 Ga0495654_0199650 Ga0495654_0199650_57_722 221
140 3300046531 Ga0495665_0054734 Ga0495665_0054734_1119_1784 221
141 3300046533 Ga0495640_0009882 Ga0495640_0009882_4094_4759 221
142 3300046533 Ga0495640_0261013 Ga0495640_0261013_76_741 221
143 3300046535 Ga0495586_0047101 Ga0495586_0047101_1308_1973 221
144 3300046536 Ga0495587_0004861 Ga0495587_0004861_8036_8701 221
145 3300046542 Ga0495597_0033864 Ga0495597_0033864_494_1159 221
146 3300046542 Ga0495597_0130537 Ga0495597_0130537_226_891 221
147 3300046557 Ga0495622_0008428 Ga0495622_0008428_2802_3467 221
148 3300046558 Ga0495633_0016192 Ga0495633_0016192_537_1202 221
149 3300046616 Ga0495668_0023666 Ga0495668_0023666_1904_2569 221
150 3300046642 Ga0495634_0001501 Ga0495634_0001501_40_705 221
151 3300046642 Ga0495634_0247121 Ga0495634_0247121_54_719 221
152 3300046648 Ga0495611_0163093 Ga0495611_0163093_264_929 221
153 3300046660 Ga0495625_0064659 Ga0495625_0064659_380_1045 221
154 3300046660 Ga0495625_0079413 Ga0495625_0079413_931_1596 221
155 3300046663 Ga0495635_0000408 Ga0495635_0000408_25012_25677 221
156 3300046665 Ga0495661_0026117 Ga0495661_0026117_375_1040 221
157 3300046675 Ga0495657_0010509 Ga0495657_0010509_2711_3376 221
158 3300046678 Ga0495599_0134953 Ga0495599_0134953_321_986 221
159 3300046679 Ga0495623_0031384 Ga0495623_0031384_2345_3010 221
160 3300046680 Ga0495646_0011593 Ga0495646_0011593_2606_3271 221
161 3300046680 Ga0495646_0065081 Ga0495646_0065081_47_712 221
162 3300046689 Ga0495613_0020739 Ga0495613_0020739_424_1089 221
163 3300046689 Ga0495613_0191367 Ga0495613_0191367_663_1328 221
164 3300046690 Ga0495624_0031847 Ga0495624_0031847_773_1438 221
165 3300046690 Ga0495624_0094996 Ga0495624_0094996_123_788 221
166 3300046691 Ga0495670_0017131 Ga0495670_0017131_937_1629 221
167 3300046692 Ga0495671_0115242 Ga0495671_0115242_161_826 221
168 3300046694 Ga0495649_0098942 Ga0495649_0098942_495_1160 221
169 3300046794 Ga0495589_0012130 Ga0495589_0012130_785_1477 221
170 3300046794 Ga0495589_0033526 Ga0495589_0033526_1218_1910 221
171 3300046794 Ga0495589_0044916 Ga0495589_0044916_494_1159 221
172 3300046809 Ga0495600_0091155 Ga0495600_0091155_393_1058 221
173 3300046809 Ga0495600_0126038 Ga0495600_0126038_886_1551 221
174 3300046810 Ga0495660_0112400 Ga0495660_0112400_310_975 221
175 3300047315 Ga0495581_0002268 Ga0495581_0002268_6472_7137 221
176 3300047315 Ga0495581_0020191 Ga0495581_0020191_2103_2768 221
177 3300047317 Ga0495604_0000920 Ga0495604_0000920_2596_3261 221
178 3300047317 Ga0495604_0037593 Ga0495604_0037593_2176_2841 221
179 3300047318 Ga0495636_0008378 Ga0495636_0008378_940_1605 221
180 3300047318 Ga0495636_0112998 Ga0495636_0112998_281_973 221
181 3300047319 Ga0495674_0089073 Ga0495674_0089073_1048_1713 221
182 3300047320 Ga0495672_0024650 Ga0495672_0024650_1867_2532 221
183 3300047321 Ga0495676_0011719 Ga0495676_0011719_934_1599 221
184 3300047321 Ga0495676_0012000 Ga0495676_0012000_3113_3778 221
185 3300047321 Ga0495676_0077773 Ga0495676_0077773_1537_2202 221
186 3300047321 Ga0495676_0124346 Ga0495676_0124346_1155_1847 221
187 3300047321 Ga0495676_0177137 Ga0495676_0177137_752_1444 221
188 3300047443 Ga0495687_002642 Ga0495687_002642_3120_3785 221
189 3300047443 Ga0495687_002800 Ga0495687_002800_9428_10093 221
190 3300047443 Ga0495687_045741 Ga0495687_045741_40_705 221
191 3300047444 Ga0495675_0039668 Ga0495675_0039668_2213_2878 221
192 3300047444 Ga0495675_0352979 Ga0495675_0352979_140_805 221
193 3300047447 Ga0495685_002305 Ga0495685_002305_1563_2255 221
194 3300047447 Ga0495685_014676 Ga0495685_014676_1878_2570 221
195 3300047469 Ga0495673_0082816 Ga0495673_0082816_199_864 221
196 3300047470 Ga0495681_0016281 Ga0495681_0016281_1011_1676 221
197 3300047471 Ga0495684_0033325 Ga0495684_0033325_1330_1995 221
198 3300047471 Ga0495684_0045396 Ga0495684_0045396_146_811 221
199 3300047673 Ga0495593_0014884 Ga0495593_0014884_1088_1753 221
200 3300048088 Ga0495602_0328100 Ga0495602_0328100_40_705 221
201 3300048089 Ga0495614_0082384 Ga0495614_0082384_690_1355 221
202 3300048091 Ga0495626_0004500 Ga0495626_0004500_4172_4837 221
203 3300049459 Ga0495678_032395 Ga0495678_032395_660_1325 221
204 3300050490 nmdc:mga03n38_125513_c1 nmdc:mga03n38_125513_c1_343_1008 221
205 3300053085 Ga0495619_0129077 Ga0495619_0129077_673_1338 221
206 3300053095 Ga0500640_011625 Ga0500640_011625_2487_3152 221
207 3300053098 Ga0500650_0098376 Ga0500650_0098376_507_1172 221
208 3300053111 Ga0500572_034770 Ga0500572_034770_114_779 221
209 3300053140 Ga0500573_0242635 Ga0500573_0242635_177_842 221
210 3300053157 Ga0500624_016027 Ga0500624_016027_451_1116 221
211 3300061719 Ga0466962_0056452 Ga0466962_0056452_156_839 221
212 iso_pu_bacteria 2547132111 2547410919 221
213 iso_pu_bacteria 2808606375 2808913258 221
214 iso_pu_bacteria 2862574272 2862577832 221
215 iso_pu_bacteria 2862290372 2862291708 222
216 3300003578 Ga0006562J51391_1038744 Ga0006562J51391_10387442 223
217 3300037466 Ga0395898_0172696 Ga0395898_0172696_474_1163 223
218 3300045976 Ga0466967_0066844 Ga0466967_0066844_1610_2299 223
219 3300046694 Ga0495649_0016994 Ga0495649_0016994_2030_2713 223
220 3300049823 Ga0501044_0065914 Ga0501044_0065914_2099_2788 223
221 iso_pu_bacteria 3006393351 3006394987 223
222 iso_pu_bacteria 8008574985 8008577470 223
223 3300003322 rootL2_10010335 rootL2_100103352 224
224 3300003322 rootL2_10010336 rootL2_100103361 224
225 3300003322 rootL2_10129193 rootL2_101291931 224
226 3300003323 rootH1_10024409 rootH1_100244092 224
227 3300003323 rootH1_10053824 rootH1_100538241 224
228 3300003578 Ga0006562J51391_1042226 Ga0006562J51391_10422262 224
229 3300005331 Ga0070670_100759354 Ga0070670_1007593541 224
230 3300005356 Ga0070674_100306963 Ga0070674_1003069632 224
231 3300006048 Ga0075363_100024055 Ga0075363_1000240552 224
232 3300006353 Ga0075370_10094038 Ga0075370_100940381 224
233 3300009148 Ga0105243_10104939 Ga0105243_101049392 224
234 3300015688 Ga0183367_1002 Ga0183367_1002371 224
235 3300025935 Ga0207709_10365455 Ga0207709_103654552 224
236 3300027312 Ga0209371_1008853 Ga0209371_10088532 224
237 3300028794 Ga0307515_10000573 Ga0307515_1000057314 224
238 3300028794 Ga0307515_10209657 Ga0307515_102096572 224
239 3300030500 Ga0268256_1007986 Ga0268256_10079862 224
240 3300030522 Ga0307512_10044717 Ga0307512_100447172 224
241 3300031507 Ga0307509_10525986 Ga0307509_105259861 224
242 3300031616 Ga0307508_10068782 Ga0307508_100687822 224
243 3300031838 Ga0307518_10269122 Ga0307518_102691221 224
244 3300033180 Ga0307510_10048062 Ga0307510_100480623 224
245 3300037466 Ga0395898_0063838 Ga0395898_0063838_1670_2362 224
246 3300041404 Ga0439436_0000677 Ga0439436_0000677_7192_7866 224
247 3300041406 Ga0439439_0002611 Ga0439439_0002611_1564_2238 224
248 3300041406 Ga0439439_0037939 Ga0439439_0037939_427_1119 224
249 3300041999 Ga0439433_0009580 Ga0439433_0009580_315_989 224
250 3300042002 Ga0439442_012928 Ga0439442_012928_668_1342 224
251 3300042007 Ga0439449_0001239 Ga0439449_0001239_6976_7650 224
252 3300042007 Ga0439449_0056851 Ga0439449_0056851_463_1137 224
253 3300042014 Ga0439457_003468 Ga0439457_003468_1884_2558 224
254 3300042015 Ga0439462_0006513 Ga0439462_0006513_1106_1780 224
255 3300042131 Ga0450894_001478 Ga0450894_001478_2282_2974 224
256 3300042133 Ga0450896_000583 Ga0450896_000583_2293_2985 224
257 3300042135 Ga0450899_000960 Ga0450899_000960_1609_2301 224
258 3300042145 Ga0450906_000159 Ga0450906_000159_7419_8111 224
259 3300044683 Ga0466965_0002786 Ga0466965_0002786_5058_5750 224
260 3300044684 Ga0466966_0000750 Ga0466966_0000750_17492_18184 224
261 3300044693 Ga0466961_0020148 Ga0466961_0020148_1360_2052 224
262 3300044694 Ga0466963_0000109 Ga0466963_0000109_18036_18728 224
263 3300044694 Ga0466963_0039959 Ga0466963_0039959_2269_2961 224
264 3300044706 Ga0466964_0004389 Ga0466964_0004389_2823_3515 224
265 3300044719 Ga0466971_0001622 Ga0466971_0001622_2241_2933 224
266 3300044765 Ga0466970_0000171 Ga0466970_0000171_29203_29895 224
267 3300044842 Ga0466957_0003967 Ga0466957_0003967_1095_1787 224
268 3300045049 Ga0466959_0001807 Ga0466959_0001807_10337_11029 224
269 3300045836 Ga0466958_0032325 Ga0466958_0032325_1587_2279 224
270 3300045976 Ga0466967_0002858 Ga0466967_0002858_8112_8804 224
271 3300045976 Ga0466967_0013582 Ga0466967_0013582_2575_3267 224
272 3300045976 Ga0466967_0708542 Ga0466967_0708542_38_712 224
273 3300046460 Ga0495638_0031891 Ga0495638_0031891_1625_2317 224
274 3300046499 Ga0495594_0202889 Ga0495594_0202889_94_786 224
275 3300046689 Ga0495613_0036411 Ga0495613_0036411_2725_3417 224
276 3300046692 Ga0495671_0029187 Ga0495671_0029187_1593_2267 224
277 3300047444 Ga0495675_0012165 Ga0495675_0012165_2241_2933 224
278 3300047470 Ga0495681_0010706 Ga0495681_0010706_293_985 224
279 3300047472 Ga0495686_0163507 Ga0495686_0163507_560_1252 224
280 3300048089 Ga0495614_0238179 Ga0495614_0238179_81_773 224
281 3300048912 Ga0496109_0040793 Ga0496109_0040793_2909_3601 224
282 3300049569 Ga0501032_0246954 Ga0501032_0246954_429_1121 224
283 3300049570 Ga0501033_0111607 Ga0501033_0111607_502_1194 224
284 3300049571 Ga0501034_0013042 Ga0501034_0013042_5118_5810 224
285 3300049571 Ga0501034_0139788 Ga0501034_0139788_404_1096 224
286 3300049571 Ga0501034_0480445 Ga0501034_0480445_100_792 224
287 3300049572 Ga0501036_0046479 Ga0501036_0046479_2391_3083 224
288 3300049574 Ga0501038_0120440 Ga0501038_0120440_1124_1816 224
289 3300049575 Ga0501039_0084237 Ga0501039_0084237_1181_1873 224
290 3300049579 Ga0501043_0005465 Ga0501043_0005465_4872_5564 224
291 3300049586 Ga0501070_0014818 Ga0501070_0014818_276_968 224
292 3300049822 Ga0501035_0004966 Ga0501035_0004966_9388_10080 224
293 3300049823 Ga0501044_0063374 Ga0501044_0063374_424_1116 224
294 3300050490 nmdc:mga03n38_9377_c1 nmdc:mga03n38_9377_c1_2844_3536 224
295 3300050496 nmdc:mga07m45_99333_c1 nmdc:mga07m45_99333_c1_549_1241 224
296 3300053088 Ga0500644_0010885 Ga0500644_0010885_716_1408 224
297 3300061719 Ga0466962_0000168 Ga0466962_0000168_11789_12481 224
298 iso_pu_bacteria 2643221678 2644439685 224
299 iso_pu_bacteria 2643221714 2644632962 224
300 iso_pu_bacteria 2784132148 2784590070 224
301 iso_pu_bacteria 2808606359 2808843706 224
302 iso_pu_bacteria 2808606448 2809233767 224
303 iso_pu_bacteria 2862281513 2862287398 224
304 iso_pu_bacteria 2862507626 2862513161 224
305 iso_pu_bacteria 2863404153 2863408274 224
306 iso_pu_bacteria 2867428634 2867432656 224
307 iso_pu_bacteria 2877676314 2877679423 224
308 iso_pu_bacteria 2912715099 2912718035 224
309 iso_pu_bacteria 2912723979 2912730482 224
310 iso_pu_bacteria 2919468124 2919474211 224
311 iso_pu_bacteria 2946072368 2946077434 224
312 iso_pu_bacteria 2954002825 2954005121 224
313 iso_pu_bacteria 2954711539 2954714628 224
314 iso_pu_bacteria 2954721474 2954724574 224
315 iso_pu_bacteria 2954731030 2954737244 224
316 iso_pu_bacteria 2954740390 2954743497 224
317 iso_pu_bacteria 2954749733 2954756096 224
318 iso_pu_bacteria 2954759201 2954762451 224
319 iso_pu_bacteria 2990059506 2990063541 224
320 iso_pu_bacteria 3006493962 3006498719 224
321 iso_pu_bacteria 8008558824 8008562470 224
322 iso_pu_bacteria 8056447290 8056448179 224
323 3300006042 Ga0075368_10007990 Ga0075368_100079902 225
324 3300006178 Ga0075367_10001478 Ga0075367_100014784 225
325 3300014497 Ga0182008_10008765 Ga0182008_100087652 225
326 3300015261 Ga0182006_1017237 Ga0182006_10172372 225
327 3300015262 Ga0182007_10000817 Ga0182007_100008176 225
328 3300027866 Ga0209813_10003255 Ga0209813_100032553 225
329 3300031456 Ga0307513_10179790 Ga0307513_101797902 225
330 3300032002 Ga0307416_100354343 Ga0307416_1003543432 225
331 3300042138 Ga0450903_022821 Ga0450903_022821_45_740 225
332 3300044658 Ga0466972_0009269 Ga0466972_0009269_1801_2499 225
333 3300044658 Ga0466972_0057661 Ga0466972_0057661_671_1378 225
334 3300044719 Ga0466971_0049832 Ga0466971_0049832_788_1495 225
335 3300044765 Ga0466970_0278584 Ga0466970_0278584_59_757 225
336 3300044901 Ga0466960_0010259 Ga0466960_0010259_1751_2449 225
337 3300045836 Ga0466958_0238257 Ga0466958_0238257_219_926 225
338 3300047472 Ga0495686_0020204 Ga0495686_0020204_433_1128 225
339 3300049570 Ga0501033_0003398 Ga0501033_0003398_4161_4868 225
340 3300049571 Ga0501034_0017128 Ga0501034_0017128_1709_2404 225
341 3300049574 Ga0501038_0002494 Ga0501038_0002494_3813_4508 225
342 3300049579 Ga0501043_0135594 Ga0501043_0135594_1158_1853 225
343 3300049581 Ga0501047_0309144 Ga0501047_0309144_275_970 225
344 3300049581 Ga0501047_0411023 Ga0501047_0411023_377_1072 225
345 3300049582 Ga0501048_0056879 Ga0501048_0056879_814_1509 225
346 3300049742 Ga0501080_0382793 Ga0501080_0382793_286_981 225
347 3300049822 Ga0501035_0079611 Ga0501035_0079611_2174_2869 225
348 3300049823 Ga0501044_0183610 Ga0501044_0183610_609_1304 225
349 3300049823 Ga0501044_0518015 Ga0501044_0518015_267_962 225
350 3300050494 nmdc:mga06z11_1659_c1 nmdc:mga06z11_1659_c1_5163_5858 225
351 3300050495 nmdc:mga04h51_3863_c1 nmdc:mga04h51_3863_c1_626_1321 225
352 3300061719 Ga0466962_0043767 Ga0466962_0043767_272_979 225
353 iso_pu_bacteria 2554235005 2554256498 226
354 iso_pu_bacteria 8023623736 8023625085 226
355 iso_pu_bacteria 8056829672 8056834887 226
356 3300001989 JGI24739J22299_10024070 JGI24739J22299_100240702 227
357 3300002075 JGI24738J21930_10008393 JGI24738J21930_100083932 227
358 3300005563 Ga0068855_100437501 Ga0068855_1004375012 227
359 3300005578 Ga0068854_100415605 Ga0068854_1004156051 227
360 3300011119 Ga0105246_10011942 Ga0105246_100119422 227
361 3300013307 Ga0157372_10135234 Ga0157372_101352342 227
362 3300025904 Ga0207647_10052224 Ga0207647_100522242 227
363 3300025949 Ga0207667_10441717 Ga0207667_104417172 227
364 3300042157 Ga0439458_0015537 Ga0439458_0015537_600_1307 227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04167

DUF402

Protein of unknown function (DUF402)

91

153

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3exm-assembly1.cif.gz_A crystal structure of the phosphatase sc4828 with the non-hydrolyzable nucleotide gpcp 0.994 14 221
3exm-assembly1.cif.gz_A crystal structure of the phosphatase sc4828 with the non-hydrolyzable nucleotide gpcp 0.9799 14 221
5zdn-assembly1.cif.gz_A the complex structure of fomd with cdp 0.855 16 207
5zdn-assembly1.cif.gz_A the complex structure of fomd with cdp 0.8167 16 207
7d8q-assembly1.cif.gz_A the structure of nucleotide phosphatase sa1684 complex with gdp analogue from staphylococcus aureus 0.8064 14 201
ID Description Score Start End Superfamily
3cbtA01 Mainly Beta;Beta Barrel;FomD barrel-like fold;FomD-like 0.9907 14 206 2.40.380.10
3cbtA01 Mainly Beta;Beta Barrel;FomD barrel-like fold;FomD-like 0.9806 14 206 2.40.380.10
af_Q2G0C7_40_167_2.40.380.10 Mainly Beta;Beta Barrel;FomD barrel-like fold;FomD-like 0.8616 102 196 2.40.380.10
af_Q2G2M8_8_173_2.40.380.10 Mainly Beta;Beta Barrel;FomD barrel-like fold;FomD-like 0.7798 17 201 2.40.380.10
af_Q2G2M8_8_173_2.40.380.10 Mainly Beta;Beta Barrel;FomD barrel-like fold;FomD-like 0.7756 17 201 2.40.380.10
ID Description Score Start End GO Terms
AF-A0A6B3ESB1-F1-model_v4 DUF402 domain-containing protein 0.9909 100 206 GO:0016787
AF-A0A3D2Z0W9-F1-model_v4 Uncharacterized protein 0.9882 133 216
AF-A0A2T7LW21-F1-model_v4 DUF402 domain-containing protein 0.9848 14 225 GO:0016787
AF-A0A6B3H839-F1-model_v4 DUF402 domain-containing protein 0.9832 75 178 GO:0016787
AF-A0A3R9XKF6-F1-model_v4 DUF402 domain-containing protein 0.983 23 225 GO:0016787

Feature Viewer

pLDDT pTM Quality
90.07 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map