F423248

General Info

Members Datasets Scaffolds Average Seq Length
364 189 728 98

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_101826070|Ga0070664_1018260701
Length 109
Sequence MNIYVSNLSFNVQDEDLKEFFTPYGEVTSAKIINDKETGRSRGFGFVEMPDDTASKKAIAELDGAEVEGRNIKVMEAKPKEDRPARSGXXXXFRYKYILNLQSPGHLGL

Samples

Sample ID Description Type Environment
1 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
129 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
138 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
139 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
140 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
141 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
142 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
143 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
144 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
167 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
168 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
173 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
174 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
175 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
176 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
184 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
185 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 2818991444 Filimonas endophytica 3197 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.78
Metatranscriptomes 4.95
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 0
Rhizoplane 1.37
Rhizosphere 96.98
Stem 0
Stem Tuber 0
Unclassified 5.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070664_101826070 3300005564 Bacteria 576
2 JGI24736J21556_1018982 3300001904 Bacteria 1087
3 JGI24739J22299_10216709 3300001989 Bacteria 561
4 Ga0058862_12628958 3300004803 Bacteria 1233
5 Ga0058862_12692869 3300004803 Bacteria 561
6 Ga0070658_10213981 3300005327 Bacteria 1629
7 Ga0070658_10712237 3300005327 Bacteria 871
8 Ga0070658_11126417 3300005327 Bacteria 682
9 Ga0070658_11465609 3300005327 Bacteria 592
10 Ga0070683_100764826 3300005329 Bacteria 925
11 Ga0070683_101733428 3300005329 Bacteria 601
12 Ga0070690_100259105 3300005330 Bacteria 1233
13 Ga0070670_100180264 3300005331 Bacteria 1834
14 Ga0070670_100479546 3300005331 Bacteria 1104
15 Ga0070670_101638355 3300005331 Bacteria 592
16 Ga0068869_100132033 3300005334 Bacteria 1920
17 Ga0070666_10032270 3300005335 Bacteria 3458
18 Ga0070680_100019449 3300005336 Bacteria 5381
19 Ga0070680_100582743 3300005336 Bacteria 960
20 Ga0070682_100265377 3300005337 Bacteria 1244
21 Ga0070682_101390471 3300005337 Bacteria 600
22 Ga0068868_100069286 3300005338 Bacteria 2811
23 Ga0068868_100177591 3300005338 Bacteria 1765
24 Ga0070660_100146107 3300005339 Bacteria 1899
25 Ga0070660_101002765 3300005339 Bacteria 706
26 Ga0070660_101534598 3300005339 Bacteria 566
27 Ga0070691_10156827 3300005341 Bacteria 1171
28 Ga0070661_100111841 3300005344 Bacteria 2040
29 Ga0070661_100689363 3300005344 Bacteria 832
30 Ga0070668_101160672 3300005347 Bacteria 699
31 Ga0070668_101610088 3300005347 Bacteria 595
32 Ga0070675_100133184 3300005354 Bacteria 2120
33 Ga0070673_100082238 3300005364 Bacteria 2613
34 Ga0070673_100478142 3300005364 Bacteria 1124
35 Ga0070659_100137742 3300005366 Bacteria 1986
36 Ga0070659_100361223 3300005366 Bacteria 1220
37 Ga0070659_101139322 3300005366 Unclassified 688
38 Ga0070667_100142070 3300005367 Unclassified 2103
39 Ga0070667_100518516 3300005367 Bacteria 1094
40 Ga0070694_100966168 3300005444 Bacteria 706
41 Ga0070663_100232690 3300005455 Bacteria 1452
42 Ga0070678_100267265 3300005456 Bacteria 1441
43 Ga0070678_101619851 3300005456 Bacteria 608
44 Ga0070662_100022618 3300005457 Bacteria 4306
45 Ga0070681_10010876 3300005458 Bacteria 8995
46 Ga0070681_10101041 3300005458 Bacteria 2829
47 Ga0070681_10195611 3300005458 Bacteria 1941
48 Ga0070681_10317832 3300005458 Bacteria 1466
49 Ga0068867_100930219 3300005459 Bacteria 784
50 Ga0070706_100320731 3300005467 Unclassified 1445
51 Ga0070679_100145982 3300005530 Bacteria 2343
52 Ga0070684_100003008 3300005535 Bacteria 12559
53 Ga0068853_100076053 3300005539 Bacteria 2931
54 Ga0068853_100081031 3300005539 Bacteria 2841
55 Ga0068853_100112482 3300005539 Bacteria 2420
56 Ga0068853_100280109 3300005539 Bacteria 1537
57 Ga0068853_100328057 3300005539 Bacteria 1420
58 Ga0068853_101490871 3300005539 Bacteria 655
59 Ga0068853_102216425 3300005539 Bacteria 533
60 Ga0070672_100512135 3300005543 Bacteria 1039
61 Ga0070672_100694175 3300005543 Bacteria 891
62 Ga0070696_101661469 3300005546 Bacteria 550
63 Ga0070693_100197457 3300005547 Bacteria 1305
64 Ga0068855_100083835 3300005563 Bacteria 3692
65 Ga0068855_100128890 3300005563 Bacteria 2890
66 Ga0068855_100432983 3300005563 Bacteria 1437
67 Ga0068855_101255851 3300005563 Bacteria 768
68 Ga0070664_100002343 3300005564 Bacteria 15223
69 Ga0068857_100000751 3300005577 Bacteria 24106
70 Ga0068857_100015273 3300005577 Bacteria 6702
71 Ga0068857_100060671 3300005577 Bacteria 3359
72 Ga0068857_100081224 3300005577 Bacteria 2895
73 Ga0068857_100240301 3300005577 Bacteria 1658
74 Ga0068854_100035018 3300005578 Bacteria 3512
75 Ga0068854_100319612 3300005578 Bacteria 1261
76 Ga0068854_101222159 3300005578 Bacteria 674
77 Ga0068856_100010686 3300005614 Bacteria 8918
78 Ga0068856_100136324 3300005614 Bacteria 2460
79 Ga0068852_100000123 3300005616 Bacteria 52266
80 Ga0068852_100007957 3300005616 Bacteria 7771
81 Ga0068852_100053779 3300005616 Bacteria 3467
82 Ga0068852_100429922 3300005616 Bacteria 1304
83 Ga0068852_101445934 3300005616 Bacteria 710
84 Ga0068852_101789935 3300005616 Bacteria 637
85 Ga0068859_101142187 3300005617 Unclassified 857
86 Ga0068864_102215775 3300005618 Bacteria 556
87 Ga0068861_101076170 3300005719 Bacteria 772
88 Ga0068851_10120574 3300005834 Bacteria 1409
89 Ga0068851_10164925 3300005834 Bacteria 1219
90 Ga0068870_10219348 3300005840 Bacteria 1163
91 Ga0068863_100444874 3300005841 Bacteria 1271
92 Ga0068858_100353066 3300005842 Bacteria 1409
93 Ga0068860_100092854 3300005843 Bacteria 2876
94 Ga0068860_100139669 3300005843 Bacteria 2328
95 Ga0075366_10528564 3300006195 Bacteria 730
96 Ga0097621_100038636 3300006237 Bacteria 3830
97 Ga0097621_100096945 3300006237 Bacteria 2475
98 Ga0068871_100002174 3300006358 Bacteria 13310
99 Ga0068871_100616293 3300006358 Bacteria 988
100 Ga0075428_100954658 3300006844 Unclassified 908
101 Ga0075431_100007656 3300006847 Bacteria 10754
102 Ga0075434_102445944 3300006871 Bacteria 524
103 Ga0075429_100094670 3300006880 Bacteria 2604
104 Ga0097620_101141974 3300006931 Unclassified 857
105 Ga0097620_101898624 3300006931 Bacteria 658
106 Ga0105240_10000424 3300009093 Bacteria 78228
107 Ga0105240_10007676 3300009093 Bacteria 15616
108 Ga0105240_10098876 3300009093 Unclassified 3552
109 Ga0111539_10651885 3300009094 Bacteria 1226
110 Ga0114129_10369225 3300009147 Bacteria 1897
111 Ga0105241_10100002 3300009174 Bacteria 2304
112 Ga0105241_10193642 3300009174 Bacteria 1693
113 Ga0105241_11178825 3300009174 Bacteria 725
114 Ga0105241_11541479 3300009174 Bacteria 641
115 Ga0105242_10771653 3300009176 Bacteria 949
116 Ga0105237_10000323 3300009545 Bacteria 67328
117 Ga0105237_10000697 3300009545 Bacteria 46499
118 Ga0105237_10003018 3300009545 Bacteria 20308
119 Ga0105237_10450808 3300009545 Bacteria 1292
120 Ga0105237_11064809 3300009545 Bacteria 815
121 Ga0105238_10148009 3300009551 Bacteria 2324
122 Ga0105238_10868322 3300009551 Bacteria 920
123 Ga0105249_10965805 3300009553 Bacteria 920
124 Ga0105239_10000458 3300010375 Bacteria 59589
125 Ga0105239_10011036 3300010375 Bacteria 10085
126 Ga0105239_10405708 3300010375 Bacteria 1543
127 Ga0105246_11438838 3300011119 Bacteria 645
128 Ga0157314_1033407 3300012500 Bacteria 589
129 Ga0157373_10008646 3300013100 Bacteria 7555
130 Ga0157373_10055805 3300013100 Bacteria 2806
131 Ga0157373_10183857 3300013100 Bacteria 1472
132 Ga0157373_10516480 3300013100 Bacteria 864
133 Ga0157373_10816223 3300013100 Bacteria 688
134 Ga0157371_10039065 3300013102 Bacteria 3395
135 Ga0157371_10052832 3300013102 Bacteria 2886
136 Ga0157371_10088999 3300013102 Bacteria 2186
137 Ga0157371_10523003 3300013102 Bacteria 877
138 Ga0157371_10545985 3300013102 Bacteria 859
139 Ga0157371_10726451 3300013102 Bacteria 745
140 Ga0157371_11434924 3300013102 Bacteria 537
141 Ga0157370_10002491 3300013104 Bacteria 22188
142 Ga0157370_10055637 3300013104 Bacteria 3768
143 Ga0157370_10184598 3300013104 Bacteria 1937
144 Ga0157370_10279610 3300013104 Bacteria 1542
145 Ga0157370_10447007 3300013104 Bacteria 1188
146 Ga0157370_10632442 3300013104 Bacteria 979
147 Ga0157370_11774416 3300013104 Bacteria 554
148 Ga0157369_10002442 3300013105 Bacteria 22322
149 Ga0157369_10006025 3300013105 Bacteria 14078
150 Ga0157369_10400675 3300013105 Bacteria 1423
151 Ga0157369_11104859 3300013105 Bacteria 810
152 Ga0157369_11148620 3300013105 Bacteria 793
153 Ga0157374_10000029 3300013296 Bacteria 211547
154 Ga0157374_10006563 3300013296 Bacteria 9879
155 Ga0157374_10007436 3300013296 Bacteria 9343
156 Ga0157374_10062142 3300013296 Bacteria 3499
157 Ga0157374_10120081 3300013296 Bacteria 2536
158 Ga0157374_10966848 3300013296 Bacteria 870
159 Ga0157378_10068227 3300013297 Bacteria 3188
160 Ga0157378_10114257 3300013297 Bacteria 2480
161 Ga0157378_10742617 3300013297 Bacteria 1004
162 Ga0163162_10007652 3300013306 Bacteria 10523
163 Ga0163162_10315750 3300013306 Bacteria 1695
164 Ga0163162_10642596 3300013306 Bacteria 1185
165 Ga0163162_10844391 3300013306 Bacteria 1031
166 Ga0163162_11179735 3300013306 Bacteria 869
167 Ga0157372_10006278 3300013307 Bacteria 12640
168 Ga0157372_10039847 3300013307 Bacteria 5187
169 Ga0157372_10045640 3300013307 Bacteria 4862
170 Ga0157372_10062681 3300013307 Bacteria 4167
171 Ga0157372_10067159 3300013307 Bacteria 4029
172 Ga0157372_10087013 3300013307 Bacteria 3545
173 Ga0157372_10109040 3300013307 Bacteria 3170
174 Ga0157372_10115955 3300013307 Bacteria 3071
175 Ga0157372_10144310 3300013307 Bacteria 2745
176 Ga0157372_10185670 3300013307 Bacteria 2408
177 Ga0157372_10201673 3300013307 Bacteria 2305
178 Ga0157372_10255898 3300013307 Bacteria 2033
179 Ga0157372_10284147 3300013307 Bacteria 1924
180 Ga0157372_10320265 3300013307 Bacteria 1805
181 Ga0157372_10344285 3300013307 Bacteria 1737
182 Ga0157372_10416328 3300013307 Bacteria 1566
183 Ga0157372_10474438 3300013307 Bacteria 1458
184 Ga0157372_11438903 3300013307 Bacteria 794
185 Ga0157372_11517452 3300013307 Bacteria 772
186 Ga0157372_11940077 3300013307 Bacteria 677
187 Ga0157372_12078977 3300013307 Unclassified 653
188 Ga0157372_12896417 3300013307 Bacteria 549
189 Ga0157375_10020664 3300013308 Bacteria 6019
190 Ga0157375_10038897 3300013308 Bacteria 4572
191 Ga0157375_12003574 3300013308 Bacteria 688
192 Ga0163163_10043011 3300014325 Bacteria 4427
193 Ga0163163_10100594 3300014325 Bacteria 2913
194 Ga0163163_13060410 3300014325 Bacteria 521
195 Ga0157377_10025128 3300014745 Bacteria 3174
196 Ga0157377_10032889 3300014745 Bacteria 2827
197 Ga0157379_11940756 3300014968 Bacteria 581
198 Ga0157379_12388007 3300014968 Bacteria 527
199 Ga0157376_10001013 3300014969 Bacteria 18323
200 Ga0157376_10051911 3300014969 Bacteria 3407
201 Ga0157376_10071363 3300014969 Bacteria 2951
202 Ga0206356_10606496 3300020070 Bacteria 1666
203 Ga0206352_10139634 3300020078 Bacteria 1393
204 Ga0206354_10142046 3300020081 Bacteria 1279
205 Ga0207656_10150772 3300025321 Bacteria 1101
206 Ga0207647_10000057 3300025904 Bacteria 85211
207 Ga0207647_10024712 3300025904 Unclassified 3959
208 Ga0207647_10230882 3300025904 Bacteria 1065
209 Ga0207643_10484211 3300025908 Bacteria 790
210 Ga0207705_10470502 3300025909 Bacteria 975
211 Ga0207705_11261956 3300025909 Bacteria 565
212 Ga0207654_10112823 3300025911 Bacteria 1694
213 Ga0207707_10093582 3300025912 Bacteria 2625
214 Ga0207707_10164504 3300025912 Bacteria 1939
215 Ga0207707_10419811 3300025912 Bacteria 1147
216 Ga0207695_10000546 3300025913 Bacteria 78237
217 Ga0207695_10040658 3300025913 Unclassified 4982
218 Ga0207695_10060968 3300025913 Bacteria 3901
219 Ga0207695_10173479 3300025913 Bacteria 2080
220 Ga0207671_10002299 3300025914 Bacteria 20645
221 Ga0207671_10006849 3300025914 Bacteria 10057
222 Ga0207671_10007678 3300025914 Bacteria 9313
223 Ga0207671_10685522 3300025914 Bacteria 815
224 Ga0207671_11165392 3300025914 Bacteria 604
225 Ga0207660_10307510 3300025917 Bacteria 1263
226 Ga0207657_10055695 3300025919 Bacteria 3415
227 Ga0207657_10151725 3300025919 Bacteria 1887
228 Ga0207657_10259865 3300025919 Bacteria 1382
229 Ga0207649_10093383 3300025920 Bacteria 1974
230 Ga0207649_11147074 3300025920 Bacteria 614
231 Ga0207652_11089451 3300025921 Bacteria 699
232 Ga0207694_10561615 3300025924 Bacteria 958
233 Ga0207650_10019897 3300025925 Bacteria 4725
234 Ga0207650_11628904 3300025925 Bacteria 548
235 Ga0207659_10324747 3300025926 Bacteria 1270
236 Ga0207690_10033936 3300025932 Bacteria 3284
237 Ga0207690_10246789 3300025932 Bacteria 1377
238 Ga0207706_10034711 3300025933 Bacteria 4488
239 Ga0207691_11129858 3300025940 Bacteria 651
240 Ga0207661_10897102 3300025944 Bacteria 816
241 Ga0207661_11094815 3300025944 Bacteria 734
242 Ga0207679_10087927 3300025945 Bacteria 2394
243 Ga0207667_10000337 3300025949 Bacteria 64244
244 Ga0207667_10043604 3300025949 Bacteria 4760
245 Ga0207667_10784808 3300025949 Bacteria 950
246 Ga0207651_11075338 3300025960 Bacteria 720
247 Ga0207651_11445117 3300025960 Bacteria 619
248 Ga0207640_10036814 3300025981 Bacteria 3075
249 Ga0207640_10354410 3300025981 Bacteria 1180
250 Ga0207658_10477157 3300025986 Bacteria 1108
251 Ga0207677_10258095 3300026023 Bacteria 1419
252 Ga0207677_11104779 3300026023 Bacteria 723
253 Ga0207677_11293716 3300026023 Bacteria 669
254 Ga0207639_10123715 3300026041 Bacteria 2130
255 Ga0207639_10170183 3300026041 Bacteria 1844
256 Ga0207639_10352046 3300026041 Bacteria 1315
257 Ga0207639_10606485 3300026041 Bacteria 1010
258 Ga0207639_11454117 3300026041 Bacteria 643
259 Ga0207639_11888324 3300026041 Bacteria 558
260 Ga0207678_10371339 3300026067 Bacteria 1236
261 Ga0207702_10038052 3300026078 Bacteria 4029
262 Ga0207702_10804175 3300026078 Bacteria 929
263 Ga0207702_10824717 3300026078 Bacteria 917
264 Ga0207641_10136258 3300026088 Bacteria 2210
265 Ga0207641_12002478 3300026088 Bacteria 580
266 Ga0207648_10077259 3300026089 Bacteria 2902
267 Ga0207674_10000582 3300026116 Bacteria 48019
268 Ga0207674_10073150 3300026116 Bacteria 3441
269 Ga0207674_10306942 3300026116 Bacteria 1536
270 Ga0207674_10520253 3300026116 Bacteria 1149
271 Ga0207674_10779351 3300026116 Bacteria 923
272 Ga0207674_11846871 3300026116 Bacteria 571
273 Ga0207675_100962854 3300026118 Bacteria 871
274 Ga0207683_10250707 3300026121 Bacteria 1616
275 Ga0207698_10028535 3300026142 Bacteria 3981
276 Ga0207698_10044829 3300026142 Bacteria 3327
277 Ga0207698_10176689 3300026142 Bacteria 1886
278 Ga0207698_10408702 3300026142 Bacteria 1299
279 Ga0207698_10627717 3300026142 Unclassified 1062
280 Ga0207698_10949743 3300026142 Bacteria 869
281 Ga0209995_1007517 3300027471 Bacteria 1756
282 Ga0209995_1062642 3300027471 Unclassified 634
283 Ga0209968_1054222 3300027526 Bacteria 700
284 Ga0209971_1082040 3300027682 Bacteria 785
285 Ga0268264_10074392 3300028381 Bacteria 2886
286 Ga0268264_10080437 3300028381 Bacteria 2783
287 Ga0307517_10473609 3300028786 Bacteria 643
288 Ga0307509_10111760 3300031507 Bacteria 2733
289 Ga0307406_11420053 3300031901 Bacteria 609
290 Ga0307412_11979724 3300031911 Bacteria 539
291 Ga0307414_11082936 3300032004 Bacteria 740
292 Ga0307411_11573720 3300032005 Bacteria 606
293 Ga0307415_102571113 3300032126 Bacteria 502
294 Ga0373953_0150688 3300035117 Unclassified 997
295 Ga0373962_0406875 3300035242 Bacteria 502
296 Ga0373931_1263627 3300035691 Bacteria 507
297 Ga0373935_1060351 3300035692 Unclassified 603
298 Ga0373937_0012572 3300036401 Bacteria 7447
299 Ga0395899_0637073 3300037312 Bacteria 675
300 Ga0395900_0196997 3300037418 Bacteria 2040
301 Ga0395900_1446545 3300037418 Bacteria 600
302 Ga0395905_0047917 3300037471 Bacteria 4004
303 Ga0395905_0088292 3300037471 Bacteria 2906
304 Ga0395905_0562321 3300037471 Bacteria 1042
305 Ga0395901_0144727 3300038443 Bacteria 2499
306 Ga0439436_0004260 3300041404 Bacteria 4383
307 Ga0439439_0087016 3300041406 Bacteria 850
308 Ga0451804_0372014 3300041463 Bacteria 504
309 Ga0451807_1606026 3300041486 Bacteria 978
310 Ga0451807_2698467 3300041486 Bacteria 606
311 Ga0439457_001390 3300042014 Bacteria 7289
312 Ga0439462_0001767 3300042015 Bacteria 4892
313 Ga0466969_0127163 3300044656 Bacteria 1183
314 Ga0466972_0591896 3300044658 Bacteria 524
315 Ga0466970_0297314 3300044765 Bacteria 910
316 Ga0466970_0794585 3300044765 Bacteria 554
317 Ga0466957_0026930 3300044842 Bacteria 3413
318 Ga0466967_0094951 3300045976 Bacteria 2717
319 Ga0495592_0089665 3300046454 Bacteria 2208
320 Ga0495580_0995432 3300046472 Unclassified 535
321 Ga0495608_0133016 3300046511 Bacteria 1591
322 Ga0495618_0192074 3300046514 Bacteria 1294
323 Ga0495628_0056425 3300046516 Bacteria 3091
324 Ga0495586_0126711 3300046535 Bacteria 1428
325 Ga0495667_0205363 3300046559 Bacteria 1260
326 Ga0495611_0000136 3300046648 Bacteria 51423
327 Ga0495611_0002180 3300046648 Bacteria 9132
328 Ga0495635_0207375 3300046663 Unclassified 1328
329 Ga0495657_0161796 3300046675 Bacteria 1385
330 Ga0495600_0912272 3300046809 Unclassified 518
331 Ga0495674_0197936 3300047319 Bacteria 1668
332 Ga0495676_0485777 3300047321 Bacteria 812
333 Ga0495675_0160262 3300047444 Bacteria 1386
334 Ga0496107_0555604 3300048910 Bacteria 850
335 Ga0496110_1671165 3300048913 Bacteria 547
336 Ga0501341_18452 3300049131 Bacteria 505
337 Ga0501305_063072 3300049161 Unclassified 641
338 Ga0501291_077420 3300049514 Bacteria 656
339 Ga0501293_031725 3300049516 Bacteria 568
340 Ga0501315_089186 3300049531 Bacteria 532
341 Ga0501317_110918 3300049533 Bacteria 504
342 Ga0501335_022373 3300049551 Unclassified 681
343 Ga0501335_024374 3300049551 Bacteria 660
344 Ga0501335_047753 3300049551 Unclassified 516
345 Ga0501336_021268 3300049552 Bacteria 592
346 Ga0501336_029805 3300049552 Bacteria 532
347 Ga0501207_117216 3300049654 Bacteria 549
348 Ga0501250_096495 3300049680 Bacteria 521
349 Ga0501257_001784 3300049686 Bacteria 4487
350 Ga0501264_048942 3300049761 Bacteria 540
351 Ga0501270_036467 3300049767 Bacteria 838
352 nmdc:mga05p37_156909_c1 3300050507 Bacteria 2780
353 nmdc:mga09592_89060_c1 3300050508 Bacteria 2636
354 nmdc:mga06r32_12133_c1 3300050510 Bacteria 7772
355 nmdc:mga0n895_2035623_c1 3300050512 Bacteria 531
356 nmdc:mga0a205_798154_c1 3300050515 Bacteria 792
357 Ga0495619_0091461 3300053085 Bacteria 2060
358 Ga0500646_0197028 3300053090 Unclassified 689
359 Ga0500645_042964 3300053730 Bacteria 1332
360 Ga0587088_177206 3300059508 Bacteria 532
361 Ga0587067_224499 3300059640 Bacteria 510
362 Ga0587069_058642 3300059642 Bacteria 704
363 Ga0587114_110761 3300059655 Bacteria 545
364 2819585844 2818991444 Bacteria 6968812
365 Ga0070664_101826070
366 JGI24736J21556_1018982
367 JGI24739J22299_10216709
368 Ga0058862_12628958
369 Ga0058862_12692869
370 Ga0070658_10213981
371 Ga0070658_10712237
372 Ga0070658_11126417
373 Ga0070658_11465609
374 Ga0070683_100764826
375 Ga0070683_101733428
376 Ga0070690_100259105
377 Ga0070670_100180264
378 Ga0070670_100479546
379 Ga0070670_101638355
380 Ga0068869_100132033
381 Ga0070666_10032270
382 Ga0070680_100019449
383 Ga0070680_100582743
384 Ga0070682_100265377
385 Ga0070682_101390471
386 Ga0068868_100069286
387 Ga0068868_100177591
388 Ga0070660_100146107
389 Ga0070660_101002765
390 Ga0070660_101534598
391 Ga0070691_10156827
392 Ga0070661_100111841
393 Ga0070661_100689363
394 Ga0070668_101160672
395 Ga0070668_101610088
396 Ga0070675_100133184
397 Ga0070673_100082238
398 Ga0070673_100478142
399 Ga0070659_100137742
400 Ga0070659_100361223
401 Ga0070659_101139322
402 Ga0070667_100142070
403 Ga0070667_100518516
404 Ga0070694_100966168
405 Ga0070663_100232690
406 Ga0070678_100267265
407 Ga0070678_101619851
408 Ga0070662_100022618
409 Ga0070681_10010876
410 Ga0070681_10101041
411 Ga0070681_10195611
412 Ga0070681_10317832
413 Ga0068867_100930219
414 Ga0070706_100320731
415 Ga0070679_100145982
416 Ga0070684_100003008
417 Ga0068853_100076053
418 Ga0068853_100081031
419 Ga0068853_100112482
420 Ga0068853_100280109
421 Ga0068853_100328057
422 Ga0068853_101490871
423 Ga0068853_102216425
424 Ga0070672_100512135
425 Ga0070672_100694175
426 Ga0070696_101661469
427 Ga0070693_100197457
428 Ga0068855_100083835
429 Ga0068855_100128890
430 Ga0068855_100432983
431 Ga0068855_101255851
432 Ga0070664_100002343
433 Ga0068857_100000751
434 Ga0068857_100015273
435 Ga0068857_100060671
436 Ga0068857_100081224
437 Ga0068857_100240301
438 Ga0068854_100035018
439 Ga0068854_100319612
440 Ga0068854_101222159
441 Ga0068856_100010686
442 Ga0068856_100136324
443 Ga0068852_100000123
444 Ga0068852_100007957
445 Ga0068852_100053779
446 Ga0068852_100429922
447 Ga0068852_101445934
448 Ga0068852_101789935
449 Ga0068859_101142187
450 Ga0068864_102215775
451 Ga0068861_101076170
452 Ga0068851_10120574
453 Ga0068851_10164925
454 Ga0068870_10219348
455 Ga0068863_100444874
456 Ga0068858_100353066
457 Ga0068860_100092854
458 Ga0068860_100139669
459 Ga0075366_10528564
460 Ga0097621_100038636
461 Ga0097621_100096945
462 Ga0068871_100002174
463 Ga0068871_100616293
464 Ga0075428_100954658
465 Ga0075431_100007656
466 Ga0075434_102445944
467 Ga0075429_100094670
468 Ga0097620_101141974
469 Ga0097620_101898624
470 Ga0105240_10000424
471 Ga0105240_10007676
472 Ga0105240_10098876
473 Ga0111539_10651885
474 Ga0114129_10369225
475 Ga0105241_10100002
476 Ga0105241_10193642
477 Ga0105241_11178825
478 Ga0105241_11541479
479 Ga0105242_10771653
480 Ga0105237_10000323
481 Ga0105237_10000697
482 Ga0105237_10003018
483 Ga0105237_10450808
484 Ga0105237_11064809
485 Ga0105238_10148009
486 Ga0105238_10868322
487 Ga0105249_10965805
488 Ga0105239_10000458
489 Ga0105239_10011036
490 Ga0105239_10405708
491 Ga0105246_11438838
492 Ga0157314_1033407
493 Ga0157373_10008646
494 Ga0157373_10055805
495 Ga0157373_10183857
496 Ga0157373_10516480
497 Ga0157373_10816223
498 Ga0157371_10039065
499 Ga0157371_10052832
500 Ga0157371_10088999
501 Ga0157371_10523003
502 Ga0157371_10545985
503 Ga0157371_10726451
504 Ga0157371_11434924
505 Ga0157370_10002491
506 Ga0157370_10055637
507 Ga0157370_10184598
508 Ga0157370_10279610
509 Ga0157370_10447007
510 Ga0157370_10632442
511 Ga0157370_11774416
512 Ga0157369_10002442
513 Ga0157369_10006025
514 Ga0157369_10400675
515 Ga0157369_11104859
516 Ga0157369_11148620
517 Ga0157374_10000029
518 Ga0157374_10006563
519 Ga0157374_10007436
520 Ga0157374_10062142
521 Ga0157374_10120081
522 Ga0157374_10966848
523 Ga0157378_10068227
524 Ga0157378_10114257
525 Ga0157378_10742617
526 Ga0163162_10007652
527 Ga0163162_10315750
528 Ga0163162_10642596
529 Ga0163162_10844391
530 Ga0163162_11179735
531 Ga0157372_10006278
532 Ga0157372_10039847
533 Ga0157372_10045640
534 Ga0157372_10062681
535 Ga0157372_10067159
536 Ga0157372_10087013
537 Ga0157372_10109040
538 Ga0157372_10115955
539 Ga0157372_10144310
540 Ga0157372_10185670
541 Ga0157372_10201673
542 Ga0157372_10255898
543 Ga0157372_10284147
544 Ga0157372_10320265
545 Ga0157372_10344285
546 Ga0157372_10416328
547 Ga0157372_10474438
548 Ga0157372_11438903
549 Ga0157372_11517452
550 Ga0157372_11940077
551 Ga0157372_12078977
552 Ga0157372_12896417
553 Ga0157375_10020664
554 Ga0157375_10038897
555 Ga0157375_12003574
556 Ga0163163_10043011
557 Ga0163163_10100594
558 Ga0163163_13060410
559 Ga0157377_10025128
560 Ga0157377_10032889
561 Ga0157379_11940756
562 Ga0157379_12388007
563 Ga0157376_10001013
564 Ga0157376_10051911
565 Ga0157376_10071363
566 Ga0206356_10606496
567 Ga0206352_10139634
568 Ga0206354_10142046
569 Ga0207656_10150772
570 Ga0207647_10000057
571 Ga0207647_10024712
572 Ga0207647_10230882
573 Ga0207643_10484211
574 Ga0207705_10470502
575 Ga0207705_11261956
576 Ga0207654_10112823
577 Ga0207707_10093582
578 Ga0207707_10164504
579 Ga0207707_10419811
580 Ga0207695_10000546
581 Ga0207695_10040658
582 Ga0207695_10060968
583 Ga0207695_10173479
584 Ga0207671_10002299
585 Ga0207671_10006849
586 Ga0207671_10007678
587 Ga0207671_10685522
588 Ga0207671_11165392
589 Ga0207660_10307510
590 Ga0207657_10055695
591 Ga0207657_10151725
592 Ga0207657_10259865
593 Ga0207649_10093383
594 Ga0207649_11147074
595 Ga0207652_11089451
596 Ga0207694_10561615
597 Ga0207650_10019897
598 Ga0207650_11628904
599 Ga0207659_10324747
600 Ga0207690_10033936
601 Ga0207690_10246789
602 Ga0207706_10034711
603 Ga0207691_11129858
604 Ga0207661_10897102
605 Ga0207661_11094815
606 Ga0207679_10087927
607 Ga0207667_10000337
608 Ga0207667_10043604
609 Ga0207667_10784808
610 Ga0207651_11075338
611 Ga0207651_11445117
612 Ga0207640_10036814
613 Ga0207640_10354410
614 Ga0207658_10477157
615 Ga0207677_10258095
616 Ga0207677_11104779
617 Ga0207677_11293716
618 Ga0207639_10123715
619 Ga0207639_10170183
620 Ga0207639_10352046
621 Ga0207639_10606485
622 Ga0207639_11454117
623 Ga0207639_11888324
624 Ga0207678_10371339
625 Ga0207702_10038052
626 Ga0207702_10804175
627 Ga0207702_10824717
628 Ga0207641_10136258
629 Ga0207641_12002478
630 Ga0207648_10077259
631 Ga0207674_10000582
632 Ga0207674_10073150
633 Ga0207674_10306942
634 Ga0207674_10520253
635 Ga0207674_10779351
636 Ga0207674_11846871
637 Ga0207675_100962854
638 Ga0207683_10250707
639 Ga0207698_10028535
640 Ga0207698_10044829
641 Ga0207698_10176689
642 Ga0207698_10408702
643 Ga0207698_10627717
644 Ga0207698_10949743
645 Ga0209995_1007517
646 Ga0209995_1062642
647 Ga0209968_1054222
648 Ga0209971_1082040
649 Ga0268264_10074392
650 Ga0268264_10080437
651 Ga0307517_10473609
652 Ga0307509_10111760
653 Ga0307406_11420053
654 Ga0307412_11979724
655 Ga0307414_11082936
656 Ga0307411_11573720
657 Ga0307415_102571113
658 Ga0373953_0150688
659 Ga0373962_0406875
660 Ga0373931_1263627
661 Ga0373935_1060351
662 Ga0373937_0012572
663 Ga0395899_0637073
664 Ga0395900_0196997
665 Ga0395900_1446545
666 Ga0395905_0047917
667 Ga0395905_0088292
668 Ga0395905_0562321
669 Ga0395901_0144727
670 Ga0439436_0004260
671 Ga0439439_0087016
672 Ga0451804_0372014
673 Ga0451807_1606026
674 Ga0451807_2698467
675 Ga0439457_001390
676 Ga0439462_0001767
677 Ga0466969_0127163
678 Ga0466972_0591896
679 Ga0466970_0297314
680 Ga0466970_0794585
681 Ga0466957_0026930
682 Ga0466967_0094951
683 Ga0495592_0089665
684 Ga0495580_0995432
685 Ga0495608_0133016
686 Ga0495618_0192074
687 Ga0495628_0056425
688 Ga0495586_0126711
689 Ga0495667_0205363
690 Ga0495611_0000136
691 Ga0495611_0002180
692 Ga0495635_0207375
693 Ga0495657_0161796
694 Ga0495600_0912272
695 Ga0495674_0197936
696 Ga0495676_0485777
697 Ga0495675_0160262
698 Ga0496107_0555604
699 Ga0496110_1671165
700 Ga0501341_18452
701 Ga0501305_063072
702 Ga0501291_077420
703 Ga0501293_031725
704 Ga0501315_089186
705 Ga0501317_110918
706 Ga0501335_022373
707 Ga0501335_024374
708 Ga0501335_047753
709 Ga0501336_021268
710 Ga0501336_029805
711 Ga0501207_117216
712 Ga0501250_096495
713 Ga0501257_001784
714 Ga0501264_048942
715 Ga0501270_036467
716 nmdc:mga05p37_156909_c1
717 nmdc:mga09592_89060_c1
718 nmdc:mga06r32_12133_c1
719 nmdc:mga0n895_2035623_c1
720 nmdc:mga0a205_798154_c1
721 Ga0495619_0091461
722 Ga0500646_0197028
723 Ga0500645_042964
724 Ga0587088_177206
725 Ga0587067_224499
726 Ga0587069_058642
727 Ga0587114_110761
728 2819585844

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00076

RRM_1

RNA recognition motif

3

73

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cw1-assembly2.cif.gz_6 crystal structure of human spliceosomal u1 snrnp 0.9725 3 78
3bs9-assembly3.cif.gz_B x-ray structure of human tia-1 rrm2 0.9714 2 78
4c7q-assembly1.cif.gz_A solution structure of the nt. gr-rbp1 rrm domain 0.9659 2 78
5o3j-assembly1.cif.gz_A crystal structure of tia-1 rrm2 in complex with rna 0.9647 1 75
6kor-assembly1.cif.gz_A crystal structure of the rrm domain of syncrip 0.9646 2 81
ID Description Score Start End Superfamily
af_Q8LHN4_54_155_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9893 2 76 3.30.70.330
af_A0A1D6K495_179_285_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.989 2 80 3.30.70.330
af_A0A0R4J5H0_158_246_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9853 2 77 3.30.70.330
af_Q6K6C4_230_316_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9851 2 81 3.30.70.330
af_I1JXD6_208_306_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9833 1 75 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A5C1Q851-F1-model_v4 RNA-binding protein 0.9974 1 81 GO:0003723
AF-A0A2A2GDY4-F1-model_v4 RNA-binding protein 0.9967 1 81 GO:0003723
AF-A0A0P7C023-F1-model_v4 RNA-binding protein 0.9956 1 80 GO:0003723
AF-S6BBZ5-F1-model_v4 RNP-1 like RNA-binding protein 0.9944 2 80 GO:0003723
AF-A0A7C7CCP8-F1-model_v4 RNA-binding protein 0.9944 1 80 GO:0003723

Map