F423192

General Info

Members Datasets Scaffolds Average Seq Length
364 229 334 125

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10082413|Ga0065714_100824134
Length 147
Sequence MTASAHALELLKVAAAAADSKAGEDLVAIDVSNPLPLADIFLIVTGRSERNVVAIAGEIEDKLIEAGYKPLRREGRAEGRWVLVDFGDLVVHVFHEEERVYYSLERLWKDCPVIPIDLASARSIDDSSDTAPSGADDESTVEIDAAE

Samples

Sample ID Description Type Environment
1 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
2 2643221546 Microbacterium sp. Root53 Isolate Unclassified
3 2643221549 Agromyces sp. Root1464 Isolate Unclassified
4 2643221616 Leifsonia sp. Root227 Isolate Unclassified
5 2643221619 Agromyces sp. Root81 Isolate Unclassified
6 2643221649 Leifsonia sp. Root4 Isolate Unclassified
7 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
8 2773857759 Microbacterium sp. 1294 Isolate Unclassified
9 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
10 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
11 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
12 2808606372 Agromyces sp. 23-23 Isolate Unclassified
13 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
14 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
15 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
16 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
17 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
18 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
19 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
20 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
21 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
22 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
23 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
24 2928153084 Leifsonia sp. 563 Isolate Unclassified
25 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
26 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
27 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
28 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
29 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
30 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
31 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
32 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
33 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
34 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
35 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
36 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
37 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
38 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
39 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
40 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
41 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
42 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
43 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
44 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
46 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
85 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
92 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
131 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
132 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
133 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
134 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
135 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
136 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
137 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
138 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
147 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
148 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
159 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
160 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
163 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
166 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
185 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
220 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
221 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
222 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
223 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
224 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
225 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
229 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.66
Metatranscriptomes 1.1
Isolates 8.24

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 13.74
Nodule 0
Rhizoplane 12.09
Rhizosphere 59.07
Stem 0
Stem Tuber 0.27
Unclassified 14.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10105153 3300001989 Bacteria 850
2 JGI24737J22298_10053831 3300001990 Bacteria 1218
3 JGI24735J21928_10002267 3300002067 Bacteria 6720
4 JGI25162J39368_1010402 3300002737 Bacteria 1178
5 JGI25164J39214_1000812 3300002772 Bacteria 11046
6 JGI25165J46597_1000002 3300003214 Bacteria 765387
7 Ga0006562J51391_1005963 3300003578 Bacteria 2540
8 Ga0006562J51391_1062315 3300003578 Bacteria 6402
9 Ga0006562J51391_1062316 3300003578 Bacteria 3290
10 Ga0055539_1000008 3300003752 Bacteria 537665
11 Ga0055533_1000001 3300003756 Bacteria 1863437
12 Ga0055525_1000481 3300003759 Bacteria 21391
13 Ga0055525_1005901 3300003759 Bacteria 1039
14 Ga0055527_1000001 3300003760 Bacteria 850044
15 Ga0055535_1024436 3300003761 Bacteria 693
16 Ga0055529_1000065 3300003763 Bacteria 173112
17 Ga0055541_1001674 3300003841 Bacteria 4679
18 Ga0065714_10082413 3300005288 Bacteria 2309
19 Ga0065714_10164025 3300005288 Bacteria 1037
20 Ga0070658_10001629 3300005327 Bacteria 18977
21 Ga0070658_10407852 3300005327 Bacteria 1168
22 Ga0070676_11237933 3300005328 Bacteria 568
23 Ga0070670_100359485 3300005331 Bacteria 1280
24 Ga0070660_100057333 3300005339 Bacteria 3017
25 Ga0070689_101717681 3300005340 Bacteria 571
26 Ga0070687_101131567 3300005343 Bacteria 574
27 Ga0070668_100466345 3300005347 Bacteria 1088
28 Ga0070675_100809652 3300005354 Bacteria 856
29 Ga0070674_100533463 3300005356 Bacteria 982
30 Ga0070673_101306116 3300005364 Bacteria 681
31 Ga0070659_100211879 3300005366 Bacteria 1597
32 Ga0070701_10846442 3300005438 Bacteria 627
33 Ga0070678_100496929 3300005456 Bacteria 1076
34 Ga0070672_100517145 3300005543 Bacteria 1034
35 Ga0070665_100069159 3300005548 Bacteria 3539
36 Ga0068855_100313714 3300005563 Bacteria 1734
37 Ga0068861_101017343 3300005719 Bacteria 792
38 Ga0068862_101106156 3300005844 Bacteria 788
39 Ga0075365_10008311 3300006038 Bacteria 5883
40 Ga0075368_10053820 3300006042 Bacteria 1603
41 Ga0075363_100060929 3300006048 Bacteria 2032
42 Ga0075364_10029049 3300006051 Bacteria 3544
43 Ga0075364_10875258 3300006051 Bacteria 612
44 Ga0075367_10010272 3300006178 Bacteria 4914
45 Ga0075370_10067621 3300006353 Bacteria 2040
46 Ga0075428_100675552 3300006844 Bacteria 1101
47 Ga0075429_101248486 3300006880 Bacteria 648
48 Ga0105244_10003467 3300009036 Bacteria 11230
49 Ga0105244_10144391 3300009036 Bacteria 1143
50 Ga0105244_10297702 3300009036 Bacteria 747
51 Ga0105243_11013321 3300009148 Bacteria 834
52 Ga0105237_11082517 3300009545 Bacteria 808
53 Ga0105249_10893431 3300009553 Bacteria 955
54 Ga0105246_10219336 3300011119 Bacteria 1490
55 Ga0105246_10736149 3300011119 Bacteria 868
56 Ga0157371_10034997 3300013102 Bacteria 3600
57 Ga0157371_10172872 3300013102 Bacteria 1544
58 Ga0157370_10001554 3300013104 Bacteria 28449
59 Ga0157369_10074717 3300013105 Bacteria 3635
60 Ga0157369_10080317 3300013105 Bacteria 3492
61 Ga0157369_10286134 3300013105 Bacteria 1716
62 Ga0157369_11543668 3300013105 Bacteria 675
63 Ga0157369_12101908 3300013105 Bacteria 573
64 Ga0163162_10019217 3300013306 Bacteria 6699
65 Ga0163162_10163770 3300013306 Bacteria 2347
66 Ga0163162_10407860 3300013306 Bacteria 1492
67 Ga0163162_11331328 3300013306 Bacteria 816
68 Ga0157372_10125417 3300013307 Bacteria 2952
69 Ga0157375_10632788 3300013308 Bacteria 1227
70 Ga0157375_10930776 3300013308 Bacteria 1012
71 Ga0157375_11928795 3300013308 Bacteria 701
72 Ga0157375_12392243 3300013308 Bacteria 630
73 Ga0157375_12566273 3300013308 Bacteria 609
74 Ga0157380_10064723 3300014326 Bacteria 2936
75 Ga0157380_10073364 3300014326 Bacteria 2774
76 Ga0157380_13484558 3300014326 Bacteria 504
77 Ga0163161_10287263 3300017792 Bacteria 1292
78 Ga0163161_10498122 3300017792 Bacteria 992
79 Ga0206355_1665089 3300020076 Bacteria 1161
80 Ga0209566_100026 3300025225 Bacteria 367457
81 Ga0209674_100001 3300025226 Bacteria 4013750
82 Ga0209672_100006 3300025228 Bacteria 1004497
83 Ga0209147_100647 3300025229 Bacteria 18166
84 Ga0209563_100001 3300025230 Bacteria 4013775
85 Ga0209563_100712 3300025230 Bacteria 10391
86 Ga0207427_100124 3300025231 Bacteria 98217
87 Ga0209437_100991 3300025233 Bacteria 9951
88 Ga0209258_103809 3300025242 Bacteria 3088
89 Ga0209677_100001 3300025253 Bacteria 4013787
90 Ga0209148_1000015 3300025254 Bacteria 850103
91 Ga0209129_1069879 3300025258 Bacteria 508
92 Ga0209233_1000001 3300025261 Bacteria 2992747
93 Ga0209455_1000013 3300025272 Bacteria 850103
94 Ga0207655_1000735 3300025728 Bacteria 36975
95 Ga0207688_10165687 3300025901 Bacteria 1312
96 Ga0207688_10235598 3300025901 Bacteria 1106
97 Ga0207647_10466579 3300025904 Bacteria 706
98 Ga0207645_10326195 3300025907 Bacteria 1025
99 Ga0207705_10000006 3300025909 Bacteria 657147
100 Ga0207705_10531446 3300025909 Unclassified 914
101 Ga0207657_10221038 3300025919 Bacteria 1517
102 Ga0207659_10684461 3300025926 Bacteria 878
103 Ga0207690_10028800 3300025932 Bacteria 3523
104 Ga0207709_10572881 3300025935 Bacteria 891
105 Ga0207667_10059237 3300025949 Bacteria 4011
106 Ga0207712_11169353 3300025961 Bacteria 686
107 Ga0207668_10425164 3300025972 Bacteria 1128
108 Ga0207678_11399853 3300026067 Bacteria 618
109 Ga0207676_11779751 3300026095 Bacteria 615
110 Ga0207675_101466723 3300026118 Bacteria 703
111 Ga0207683_11099419 3300026121 Bacteria 737
112 Ga0207683_11186053 3300026121 Bacteria 708
113 Ga0268266_10264640 3300028379 Bacteria 1594
114 Ga0268265_11078861 3300028380 Bacteria 796
115 Ga0307515_10293784 3300028794 Bacteria 1318
116 Ga0307408_102095264 3300031548 Bacteria 545
117 Ga0307405_10544418 3300031731 Bacteria 938
118 Ga0307405_10948254 3300031731 Bacteria 731
119 Ga0307405_11227956 3300031731 Bacteria 649
120 Ga0307405_11486289 3300031731 Bacteria 595
121 Ga0307413_10755560 3300031824 Bacteria 813
122 Ga0307410_10344443 3300031852 Bacteria 1189
123 Ga0307410_11236146 3300031852 Bacteria 652
124 Ga0307406_10000277 3300031901 Bacteria 30213
125 Ga0307406_10065359 3300031901 Bacteria 2364
126 Ga0307406_10180690 3300031901 Bacteria 1536
127 Ga0307406_10789693 3300031901 Bacteria 800
128 Ga0307412_10612566 3300031911 Bacteria 924
129 Ga0307412_10649117 3300031911 Bacteria 900
130 Ga0307409_100145556 3300031995 Bacteria 2049
131 Ga0307409_100498995 3300031995 Bacteria 1185
132 Ga0307409_101943151 3300031995 Bacteria 618
133 Ga0307416_100670378 3300032002 Bacteria 1124
134 Ga0307416_101046193 3300032002 Bacteria 920
135 Ga0307414_10474445 3300032004 Bacteria 1102
136 Ga0307414_10742870 3300032004 Bacteria 891
137 Ga0307415_101126101 3300032126 Bacteria 736
138 Ga0395899_0032646 3300037312 Bacteria 3912
139 Ga0395900_0639358 3300037418 Bacteria 1001
140 Ga0395898_0000622 3300037466 Bacteria 65033
141 Ga0439465_0082953 3300041413 Bacteria 1089
142 Ga0451787_444306 3300041441 Bacteria 558
143 Ga0451793_0628271 3300041452 Bacteria 758
144 Ga0451793_1827400 3300041452 Bacteria 751
145 Ga0451795_0171706 3300041456 Bacteria 773
146 Ga0451807_2405950 3300041486 Bacteria 1302
147 Ga0451835_0805613 3300041492 Bacteria 567
148 Ga0451837_0516628 3300041494 Bacteria 1081
149 Ga0451837_1149684 3300041494 Bacteria 592
150 Ga0451841_1375081 3300041498 Bacteria 628
151 Ga0451843_1223160 3300041509 Bacteria 706
152 Ga0451843_1336512 3300041509 Bacteria 692
153 Ga0451853_3824411 3300041512 Bacteria 688
154 Ga0450920_129882 3300042122 Bacteria 531
155 Ga0451577_1026101 3300042876 Bacteria 740
156 Ga0466972_0019211 3300044658 Bacteria 3418
157 Ga0466972_0119171 3300044658 Bacteria 1245
158 Ga0466965_0155891 3300044683 Bacteria 1195
159 Ga0466965_0161906 3300044683 Bacteria 1173
160 Ga0466966_0218304 3300044684 Bacteria 1151
161 Ga0466961_0214503 3300044693 Bacteria 1187
162 Ga0466971_0083169 3300044719 Bacteria 1461
163 Ga0466968_0054440 3300044735 Bacteria 1715
164 Ga0466968_0199676 3300044735 Bacteria 936
165 Ga0466968_0233218 3300044735 Bacteria 870
166 Ga0466970_0031775 3300044765 Bacteria 2788
167 Ga0466970_0115846 3300044765 Bacteria 1465
168 Ga0466970_0289867 3300044765 Bacteria 922
169 Ga0466970_0460105 3300044765 Bacteria 730
170 Ga0466957_0033885 3300044842 Bacteria 3064
171 Ga0466957_0094381 3300044842 Bacteria 1878
172 Ga0466957_0274300 3300044842 Bacteria 1127
173 Ga0466960_0028940 3300044901 Bacteria 2539
174 Ga0466960_0082017 3300044901 Bacteria 1627
175 Ga0466960_0184799 3300044901 Bacteria 1131
176 Ga0466960_0602609 3300044901 Bacteria 652
177 Ga0466959_0003420 3300045049 Bacteria 10378
178 Ga0466958_0598380 3300045836 Bacteria 717
179 Ga0466967_0428223 3300045976 Bacteria 1291
180 Ga0495638_0407691 3300046460 Bacteria 704
181 Ga0495620_0150098 3300046515 Bacteria 909
182 Ga0495631_0423127 3300046518 Bacteria 567
183 Ga0495643_0132480 3300046522 Bacteria 1250
184 Ga0495644_0305537 3300046523 Bacteria 623
185 Ga0495654_0139447 3300046530 Bacteria 1082
186 Ga0495621_0114074 3300046539 Bacteria 1039
187 Ga0495645_0697384 3300046543 Bacteria 617
188 Ga0495633_0559029 3300046558 Bacteria 515
189 Ga0495656_0373004 3300046615 Bacteria 743
190 Ga0495656_0691184 3300046615 Bacteria 549
191 Ga0495613_0205014 3300046689 Bacteria 1389
192 Ga0495681_0102815 3300047470 Bacteria 1247
193 Ga0495615_0044125 3300048090 Bacteria 1125
194 Ga0496100_0076347 3300048903 Bacteria 2249
195 Ga0496101_0047841 3300048904 Bacteria 3071
196 Ga0496102_0088567 3300048905 Bacteria 2862
197 Ga0496102_0233854 3300048905 Bacteria 1733
198 Ga0496102_0299289 3300048905 Bacteria 1516
199 Ga0496103_0048737 3300048906 Bacteria 2618
200 Ga0496103_0591926 3300048906 Bacteria 707
201 Ga0496104_0005777 3300048907 Bacteria 10829
202 Ga0496104_0031359 3300048907 Bacteria 4942
203 Ga0496104_0078647 3300048907 Bacteria 3143
204 Ga0496104_0104747 3300048907 Bacteria 2711
205 Ga0496105_0001198 3300048908 Bacteria 18055
206 Ga0496105_0036851 3300048908 Bacteria 4030
207 Ga0496105_0045213 3300048908 Bacteria 3633
208 Ga0496105_0055922 3300048908 Bacteria 3257
209 Ga0496107_0013306 3300048910 Bacteria 5749
210 Ga0496108_0020556 3300048911 Bacteria 5426
211 Ga0496108_0191389 3300048911 Bacteria 1773
212 Ga0496109_0012986 3300048912 Bacteria 7200
213 Ga0496109_0031440 3300048912 Bacteria 4763
214 Ga0496109_0715044 3300048912 Bacteria 939
215 Ga0496110_0033530 3300048913 Bacteria 4442
216 Ga0496110_0059713 3300048913 Bacteria 3362
217 Ga0496111_0001311 3300048914 Bacteria 13958
218 Ga0496111_0081521 3300048914 Bacteria 2362
219 Ga0496112_0628007 3300048915 Bacteria 1005
220 Ga0496113_0157720 3300048916 Bacteria 1793
221 Ga0496113_0158654 3300048916 Bacteria 1787
222 Ga0496113_0210047 3300048916 Bacteria 1549
223 Ga0496114_0017719 3300048917 Bacteria 5754
224 Ga0496114_0029002 3300048917 Bacteria 4545
225 Ga0496114_0099835 3300048917 Bacteria 2476
226 Ga0496114_0713112 3300048917 Bacteria 879
227 Ga0496115_0008787 3300048918 Bacteria 7488
228 Ga0496115_0066070 3300048918 Bacteria 2922
229 Ga0496115_0151140 3300048918 Bacteria 1917
230 Ga0496115_0538696 3300048918 Bacteria 934
231 Ga0496115_0769438 3300048918 Bacteria 751
232 Ga0496115_1081284 3300048918 Bacteria 609
233 Ga0496117_0000053 3300048920 Bacteria 279396
234 Ga0496117_0015966 3300048920 Bacteria 6362
235 Ga0496117_0057387 3300048920 Bacteria 2704
236 Ga0496117_0217758 3300048920 Bacteria 1065
237 Ga0496118_0026175 3300048921 Bacteria 4977
238 Ga0496119_0007344 3300048922 Bacteria 9964
239 Ga0496119_0013811 3300048922 Bacteria 6386
240 Ga0496119_0035160 3300048922 Bacteria 3287
241 Ga0496120_0001606 3300048923 Bacteria 26223
242 Ga0496120_0005690 3300048923 Bacteria 9839
243 Ga0496120_0121395 3300048923 Bacteria 1351
244 Ga0496121_0000528 3300048924 Bacteria 72606
245 Ga0496122_0030456 3300048925 Bacteria 4520
246 Ga0496122_0279206 3300048925 Bacteria 914
247 Ga0496122_0325446 3300048925 Bacteria 815
248 Ga0496123_0003526 3300048926 Bacteria 17426
249 Ga0496124_0022443 3300048927 Bacteria 5785
250 Ga0496124_0240999 3300048927 Bacteria 1345
251 Ga0496125_0000061 3300048928 Bacteria 262739
252 Ga0496126_0004970 3300048929 Bacteria 15509
253 Ga0496126_0089444 3300048929 Bacteria 2710
254 Ga0496126_0097039 3300048929 Bacteria 2583
255 Ga0496126_0163194 3300048929 Bacteria 1903
256 Ga0496126_0357854 3300048929 Bacteria 1193
257 Ga0496126_0904216 3300048929 Bacteria 669
258 Ga0501031_0022745 3300049568 Bacteria 4086
259 Ga0501031_0153795 3300049568 Bacteria 1503
260 Ga0501032_0042901 3300049569 Bacteria 3066
261 Ga0501033_0003601 3300049570 Bacteria 12650
262 Ga0501033_0039034 3300049570 Bacteria 3547
263 Ga0501033_0053334 3300049570 Bacteria 2995
264 Ga0501033_0323603 3300049570 Bacteria 1083
265 Ga0501033_0743602 3300049570 Bacteria 665
266 Ga0501034_0003851 3300049571 Bacteria 16904
267 Ga0501034_0039965 3300049571 Bacteria 4750
268 Ga0501034_0149659 3300049571 Bacteria 2310
269 Ga0501034_0187774 3300049571 Bacteria 2029
270 Ga0501034_0302346 3300049571 Bacteria 1536
271 Ga0501034_0485816 3300049571 Bacteria 1150
272 Ga0501036_0039434 3300049572 Bacteria 3996
273 Ga0501037_0006700 3300049573 Bacteria 8422
274 Ga0501037_0321735 3300049573 Bacteria 1071
275 Ga0501038_0662822 3300049574 Bacteria 784
276 Ga0501039_0008421 3300049575 Bacteria 7859
277 Ga0501042_0005404 3300049578 Bacteria 8223
278 Ga0501042_0006058 3300049578 Bacteria 7835
279 Ga0501042_0467382 3300049578 Bacteria 915
280 Ga0501043_0046530 3300049579 Bacteria 3411
281 Ga0501043_0090885 3300049579 Bacteria 2400
282 Ga0501046_0007649 3300049580 Bacteria 9478
283 Ga0501046_0008618 3300049580 Bacteria 8868
284 Ga0501046_0062032 3300049580 Bacteria 2921
285 Ga0501047_0024267 3300049581 Bacteria 5821
286 Ga0501047_0069733 3300049581 Bacteria 3385
287 Ga0501047_0461892 3300049581 Bacteria 1098
288 Ga0501047_1272385 3300049581 Bacteria 549
289 Ga0501048_0101889 3300049582 Bacteria 2025
290 Ga0501067_0182146 3300049583 Bacteria 1170
291 Ga0501068_0147256 3300049584 Bacteria 1478
292 Ga0501068_0941031 3300049584 Bacteria 569
293 Ga0501070_0004597 3300049586 Bacteria 11833
294 Ga0501070_0053777 3300049586 Bacteria 3339
295 Ga0501070_0067956 3300049586 Bacteria 2951
296 Ga0501070_0367748 3300049586 Bacteria 1166
297 Ga0501073_0006981 3300049589 Bacteria 8412
298 Ga0501073_0818158 3300049589 Bacteria 642
299 Ga0501083_0004406 3300049744 Bacteria 9926
300 Ga0501083_0034147 3300049744 Bacteria 3479
301 Ga0501035_0023818 3300049822 Bacteria 5617
302 Ga0501035_0055940 3300049822 Bacteria 3522
303 Ga0501035_0196152 3300049822 Bacteria 1734
304 Ga0501035_0764405 3300049822 Bacteria 774
305 Ga0501044_0011752 3300049823 Bacteria 9485
306 Ga0501044_0013505 3300049823 Bacteria 8831
307 Ga0501044_0016131 3300049823 Bacteria 8030
308 Ga0501044_0093680 3300049823 Bacteria 3028
309 Ga0501044_0227790 3300049823 Bacteria 1812
310 Ga0501044_0493562 3300049823 Bacteria 1126
311 Ga0501044_1111631 3300049823 Bacteria 659
312 Ga0501044_1218291 3300049823 Bacteria 620
313 Ga0501045_0135839 3300049824 Bacteria 1828
314 nmdc:mga03n38_5285_c1 3300050490 Bacteria 4380
315 nmdc:mga00v17_11343_c1 3300050491 Bacteria 4898
316 nmdc:mga00v17_514836_c1 3300050491 Bacteria 775
317 nmdc:mga00v17_765304_c1 3300050491 Bacteria 617
318 nmdc:mga0yw44_4751_c1 3300050492 Bacteria 6294
319 nmdc:mga06z11_88383_c1 3300050494 Bacteria 1678
320 nmdc:mga04h51_5523_c1 3300050495 Bacteria 3227
321 nmdc:mga07m45_213058_c1 3300050496 Bacteria 1124
322 nmdc:mga0sz30_423320_c1 3300050516 Bacteria 597
323 Ga0500635_0000013 3300053080 Bacteria 133088
324 Ga0500628_070520 3300053129 Bacteria 875
325 Ga0500559_0000585 3300053136 Bacteria 24994
326 Ga0500559_0003466 3300053136 Bacteria 7744
327 Ga0500559_0064546 3300053136 Bacteria 1638
328 Ga0500559_0205707 3300053136 Bacteria 928
329 Ga0500568_0000049 3300053139 Bacteria 116515
330 Ga0500573_0119101 3300053140 Bacteria 1471
331 Ga0500616_0000221 3300053153 Bacteria 88983
332 Ga0501084_0305264 3300054114 Bacteria 1344
333 Ga0501082_0777020 3300060353 Bacteria 838
334 Ga0466962_0131092 3300061719 Bacteria 1211

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046543 Ga0495645_0697384 Ga0495645_0697384_16_378 116
2 iso_pu_bacteria 8046352972 8046356402 118
3 3300048929 Ga0496126_0097039 Ga0496126_0097039_1809_2189 119
4 iso_pu_bacteria 2862993130 2862995760 119
5 iso_pu_bacteria 2906799679 2906800643 119
6 iso_pu_bacteria 2964326757 2964329382 119
7 3300053153 Ga0500616_0000221 Ga0500616_0000221_60447_60809 120
8 iso_pu_bacteria 2643221546 2643753468 120
9 iso_pu_bacteria 2643221549 2643767734 120
10 iso_pu_bacteria 2643221619 2644111109 120
11 iso_pu_bacteria 2808606372 2808902047 120
12 iso_pu_bacteria 2857720070 2857720243 120
13 iso_pu_bacteria 2928090899 2928091919 120
14 iso_pu_bacteria 2984580707 2984581314 120
15 3300041492 Ga0451835_0805613 Ga0451835_0805613_133_501 121
16 iso_pu_bacteria 2585428094 2587862798 121
17 iso_pu_bacteria 2643221616 2644095889 121
18 iso_pu_bacteria 2643221649 2644279692 121
19 iso_pu_bacteria 2757320536 2758226065 121
20 iso_pu_bacteria 2773857759 2774384579 121
21 iso_pu_bacteria 2773857763 2774399424 121
22 iso_pu_bacteria 2808606306 2808631131 121
23 iso_pu_bacteria 2808606368 2808885697 121
24 iso_pu_bacteria 2821268502 2821270068 121
25 iso_pu_bacteria 2844841374 2844842257 121
26 iso_pu_bacteria 2852632344 2852634255 121
27 iso_pu_bacteria 2870628048 2870630420 121
28 iso_pu_bacteria 2884763398 2884765251 121
29 iso_pu_bacteria 2919055335 2919057904 121
30 iso_pu_bacteria 2919523602 2919524301 121
31 iso_pu_bacteria 2928153084 2928156087 121
32 iso_pu_bacteria 2939660829 2939663954 121
33 iso_pu_bacteria 2966921586 2966922129 121
34 iso_pu_bacteria 2977251589 2977253829 121
35 3300042876 Ga0451577_1026101 Ga0451577_1026101_206_580 122
36 3300041509 Ga0451843_1223160 Ga0451843_1223160_57_428 123
37 3300044901 Ga0466960_0082017 Ga0466960_0082017_989_1405 123
38 3300045976 Ga0466967_0428223 Ga0466967_0428223_242_658 123
39 3300048922 Ga0496119_0035160 Ga0496119_0035160_2105_2476 123
40 3300050491 nmdc:mga00v17_514836_c1 nmdc:mga00v17_514836_c1_17_388 123
41 3300053129 Ga0500628_070520 Ga0500628_070520_147_518 123
42 3300053136 Ga0500559_0000585 Ga0500559_0000585_24094_24465 123
43 3300053140 Ga0500573_0119101 Ga0500573_0119101_802_1176 123
44 3300003760 Ga0055527_1000001 Ga0055527_100000157 124
45 3300003761 Ga0055535_1024436 Ga0055535_10244361 124
46 3300003763 Ga0055529_1000065 Ga0055529_100006557 124
47 3300005340 Ga0070689_101717681 Ga0070689_1017176812 124
48 3300005456 Ga0070678_100496929 Ga0070678_1004969291 124
49 3300005719 Ga0068861_101017343 Ga0068861_1010173432 124
50 3300005844 Ga0068862_101106156 Ga0068862_1011061563 124
51 3300006844 Ga0075428_100675552 Ga0075428_1006755522 124
52 3300006880 Ga0075429_101248486 Ga0075429_1012484862 124
53 3300009036 Ga0105244_10297702 Ga0105244_102977022 124
54 3300009148 Ga0105243_11013321 Ga0105243_110133212 124
55 3300009553 Ga0105249_10893431 Ga0105249_108934312 124
56 3300011119 Ga0105246_10219336 Ga0105246_102193362 124
57 3300013105 Ga0157369_10286134 Ga0157369_102861343 124
58 3300013306 Ga0163162_11331328 Ga0163162_113313282 124
59 3300013308 Ga0157375_12392243 Ga0157375_123922431 124
60 3300014326 Ga0157380_10064723 Ga0157380_100647232 124
61 3300025228 Ga0209672_100006 Ga0209672_100006918 124
62 3300025229 Ga0209147_100647 Ga0209147_10064721 124
63 3300025242 Ga0209258_103809 Ga0209258_1038095 124
64 3300025254 Ga0209148_1000015 Ga0209148_1000015762 124
65 3300025272 Ga0209455_1000013 Ga0209455_1000013762 124
66 3300025901 Ga0207688_10165687 Ga0207688_101656872 124
67 3300025907 Ga0207645_10326195 Ga0207645_103261952 124
68 3300025961 Ga0207712_11169353 Ga0207712_111693532 124
69 3300026118 Ga0207675_101466723 Ga0207675_1014667231 124
70 3300026121 Ga0207683_11099419 Ga0207683_110994192 124
71 3300028380 Ga0268265_11078861 Ga0268265_110788613 124
72 3300031548 Ga0307408_102095264 Ga0307408_1020952642 124
73 3300031731 Ga0307405_10544418 Ga0307405_105444181 124
74 3300031731 Ga0307405_10948254 Ga0307405_109482542 124
75 3300031731 Ga0307405_11227956 Ga0307405_112279562 124
76 3300031824 Ga0307413_10755560 Ga0307413_107555602 124
77 3300031852 Ga0307410_11236146 Ga0307410_112361462 124
78 3300031901 Ga0307406_10180690 Ga0307406_101806902 124
79 3300031911 Ga0307412_10649117 Ga0307412_106491172 124
80 3300031995 Ga0307409_100145556 Ga0307409_1001455561 124
81 3300031995 Ga0307409_101943151 Ga0307409_1019431512 124
82 3300032002 Ga0307416_100670378 Ga0307416_1006703781 124
83 3300032002 Ga0307416_101046193 Ga0307416_1010461932 124
84 3300032004 Ga0307414_10474445 Ga0307414_104744452 124
85 3300032126 Ga0307415_101126101 Ga0307415_1011261012 124
86 3300037312 Ga0395899_0032646 Ga0395899_0032646_2905_3279 124
87 3300037418 Ga0395900_0639358 Ga0395900_0639358_468_842 124
88 3300037466 Ga0395898_0000622 Ga0395898_0000622_1055_1429 124
89 3300046460 Ga0495638_0407691 Ga0495638_0407691_151_525 124
90 3300046558 Ga0495633_0559029 Ga0495633_0559029_36_410 124
91 3300046615 Ga0495656_0691184 Ga0495656_0691184_56_430 124
92 3300046689 Ga0495613_0205014 Ga0495613_0205014_984_1358 124
93 3300048905 Ga0496102_0299289 Ga0496102_0299289_1079_1468 124
94 3300048912 Ga0496109_0715044 Ga0496109_0715044_130_519 124
95 3300048916 Ga0496113_0157720 Ga0496113_0157720_45_434 124
96 3300048924 Ga0496121_0000528 Ga0496121_0000528_71494_71868 124
97 3300048927 Ga0496124_0240999 Ga0496124_0240999_446_820 124
98 3300049568 Ga0501031_0153795 Ga0501031_0153795_985_1359 124
99 3300049570 Ga0501033_0039034 Ga0501033_0039034_877_1251 124
100 3300049570 Ga0501033_0323603 Ga0501033_0323603_11_385 124
101 3300049571 Ga0501034_0149659 Ga0501034_0149659_101_475 124
102 3300049571 Ga0501034_0187774 Ga0501034_0187774_153_527 124
103 3300049571 Ga0501034_0302346 Ga0501034_0302346_1071_1445 124
104 3300049573 Ga0501037_0321735 Ga0501037_0321735_104_478 124
105 3300049574 Ga0501038_0662822 Ga0501038_0662822_258_632 124
106 3300049578 Ga0501042_0005404 Ga0501042_0005404_5415_5789 124
107 3300049579 Ga0501043_0090885 Ga0501043_0090885_1135_1509 124
108 3300049580 Ga0501046_0007649 Ga0501046_0007649_4207_4581 124
109 3300049580 Ga0501046_0062032 Ga0501046_0062032_905_1279 124
110 3300049581 Ga0501047_0461892 Ga0501047_0461892_491_865 124
111 3300049583 Ga0501067_0182146 Ga0501067_0182146_571_945 124
112 3300049584 Ga0501068_0941031 Ga0501068_0941031_55_429 124
113 3300049586 Ga0501070_0004597 Ga0501070_0004597_262_636 124
114 3300049586 Ga0501070_0067956 Ga0501070_0067956_1883_2257 124
115 3300049586 Ga0501070_0367748 Ga0501070_0367748_157_531 124
116 3300049589 Ga0501073_0006981 Ga0501073_0006981_5908_6282 124
117 3300049589 Ga0501073_0818158 Ga0501073_0818158_256_630 124
118 3300049822 Ga0501035_0055940 Ga0501035_0055940_2725_3099 124
119 3300049822 Ga0501035_0196152 Ga0501035_0196152_1109_1483 124
120 3300049822 Ga0501035_0764405 Ga0501035_0764405_218_592 124
121 3300049823 Ga0501044_0013505 Ga0501044_0013505_6930_7304 124
122 3300049823 Ga0501044_0016131 Ga0501044_0016131_578_952 124
123 3300049823 Ga0501044_0093680 Ga0501044_0093680_1012_1386 124
124 3300049823 Ga0501044_0227790 Ga0501044_0227790_1221_1595 124
125 3300054114 Ga0501084_0305264 Ga0501084_0305264_474_848 124
126 3300001989 JGI24739J22299_10105153 JGI24739J22299_101051532 125
127 3300001990 JGI24737J22298_10053831 JGI24737J22298_100538312 125
128 3300002067 JGI24735J21928_10002267 JGI24735J21928_1000226710 125
129 3300002737 JGI25162J39368_1010402 JGI25162J39368_10104022 125
130 3300002772 JGI25164J39214_1000812 JGI25164J39214_10008124 125
131 3300003214 JGI25165J46597_1000002 JGI25165J46597_1000002536 125
132 3300003578 Ga0006562J51391_1005963 Ga0006562J51391_10059632 125
133 3300003578 Ga0006562J51391_1062315 Ga0006562J51391_10623157 125
134 3300003578 Ga0006562J51391_1062316 Ga0006562J51391_10623162 125
135 3300003752 Ga0055539_1000008 Ga0055539_1000008480 125
136 3300003756 Ga0055533_1000001 Ga0055533_1000001590 125
137 3300003759 Ga0055525_1000481 Ga0055525_100048116 125
138 3300003759 Ga0055525_1005901 Ga0055525_10059012 125
139 3300003841 Ga0055541_1001674 Ga0055541_10016744 125
140 3300005288 Ga0065714_10082413 Ga0065714_100824134 125
141 3300005288 Ga0065714_10164025 Ga0065714_101640252 125
142 3300005327 Ga0070658_10001629 Ga0070658_100016295 125
143 3300005327 Ga0070658_10407852 Ga0070658_104078522 125
144 3300005328 Ga0070676_11237933 Ga0070676_112379332 125
145 3300005331 Ga0070670_100359485 Ga0070670_1003594852 125
146 3300005339 Ga0070660_100057333 Ga0070660_1000573332 125
147 3300005343 Ga0070687_101131567 Ga0070687_1011315672 125
148 3300005347 Ga0070668_100466345 Ga0070668_1004663452 125
149 3300005354 Ga0070675_100809652 Ga0070675_1008096522 125
150 3300005356 Ga0070674_100533463 Ga0070674_1005334631 125
151 3300005364 Ga0070673_101306116 Ga0070673_1013061161 125
152 3300005366 Ga0070659_100211879 Ga0070659_1002118792 125
153 3300005438 Ga0070701_10846442 Ga0070701_108464422 125
154 3300005543 Ga0070672_100517145 Ga0070672_1005171452 125
155 3300005548 Ga0070665_100069159 Ga0070665_1000691594 125
156 3300005563 Ga0068855_100313714 Ga0068855_1003137142 125
157 3300006038 Ga0075365_10008311 Ga0075365_100083117 125
158 3300006042 Ga0075368_10053820 Ga0075368_100538202 125
159 3300006048 Ga0075363_100060929 Ga0075363_1000609294 125
160 3300006051 Ga0075364_10029049 Ga0075364_100290492 125
161 3300006051 Ga0075364_10875258 Ga0075364_108752582 125
162 3300006178 Ga0075367_10010272 Ga0075367_100102722 125
163 3300006353 Ga0075370_10067621 Ga0075370_100676212 125
164 3300009036 Ga0105244_10003467 Ga0105244_100034671 125
165 3300009036 Ga0105244_10144391 Ga0105244_101443911 125
166 3300009545 Ga0105237_11082517 Ga0105237_110825171 125
167 3300011119 Ga0105246_10736149 Ga0105246_107361492 125
168 3300013102 Ga0157371_10034997 Ga0157371_100349975 125
169 3300013102 Ga0157371_10172872 Ga0157371_101728722 125
170 3300013104 Ga0157370_10001554 Ga0157370_100015547 125
171 3300013105 Ga0157369_10074717 Ga0157369_100747175 125
172 3300013105 Ga0157369_10080317 Ga0157369_100803172 125
173 3300013105 Ga0157369_11543668 Ga0157369_115436681 125
174 3300013105 Ga0157369_12101908 Ga0157369_121019081 125
175 3300013306 Ga0163162_10019217 Ga0163162_100192176 125
176 3300013306 Ga0163162_10163770 Ga0163162_101637704 125
177 3300013306 Ga0163162_10407860 Ga0163162_104078603 125
178 3300013307 Ga0157372_10125417 Ga0157372_101254172 125
179 3300013308 Ga0157375_10632788 Ga0157375_106327882 125
180 3300013308 Ga0157375_10930776 Ga0157375_109307762 125
181 3300013308 Ga0157375_11928795 Ga0157375_119287951 125
182 3300013308 Ga0157375_12566273 Ga0157375_125662731 125
183 3300014326 Ga0157380_10073364 Ga0157380_100733645 125
184 3300014326 Ga0157380_13484558 Ga0157380_134845581 125
185 3300017792 Ga0163161_10287263 Ga0163161_102872632 125
186 3300017792 Ga0163161_10498122 Ga0163161_104981222 125
187 3300020076 Ga0206355_1665089 Ga0206355_16650892 125
188 3300025225 Ga0209566_100026 Ga0209566_100026134 125
189 3300025226 Ga0209674_100001 Ga0209674_100001590 125
190 3300025230 Ga0209563_100001 Ga0209563_100001590 125
191 3300025230 Ga0209563_100712 Ga0209563_1007125 125
192 3300025231 Ga0207427_100124 Ga0207427_10012426 125
193 3300025233 Ga0209437_100991 Ga0209437_1009917 125
194 3300025253 Ga0209677_100001 Ga0209677_100001590 125
195 3300025258 Ga0209129_1069879 Ga0209129_10698791 125
196 3300025261 Ga0209233_1000001 Ga0209233_10000012270 125
197 3300025728 Ga0207655_1000735 Ga0207655_100073544 125
198 3300025901 Ga0207688_10235598 Ga0207688_102355982 125
199 3300025904 Ga0207647_10466579 Ga0207647_104665792 125
200 3300025909 Ga0207705_10000006 Ga0207705_10000006118 125
201 3300025909 Ga0207705_10531446 Ga0207705_105314461 125
202 3300025919 Ga0207657_10221038 Ga0207657_102210382 125
203 3300025926 Ga0207659_10684461 Ga0207659_106844612 125
204 3300025932 Ga0207690_10028800 Ga0207690_100288005 125
205 3300025935 Ga0207709_10572881 Ga0207709_105728811 125
206 3300025949 Ga0207667_10059237 Ga0207667_100592374 125
207 3300025972 Ga0207668_10425164 Ga0207668_104251642 125
208 3300026067 Ga0207678_11399853 Ga0207678_113998531 125
209 3300026095 Ga0207676_11779751 Ga0207676_117797511 125
210 3300026121 Ga0207683_11186053 Ga0207683_111860532 125
211 3300028379 Ga0268266_10264640 Ga0268266_102646403 125
212 3300028794 Ga0307515_10293784 Ga0307515_102937842 125
213 3300031731 Ga0307405_11486289 Ga0307405_114862892 125
214 3300031852 Ga0307410_10344443 Ga0307410_103444433 125
215 3300031901 Ga0307406_10000277 Ga0307406_1000027724 125
216 3300031901 Ga0307406_10065359 Ga0307406_100653591 125
217 3300031901 Ga0307406_10789693 Ga0307406_107896932 125
218 3300031911 Ga0307412_10612566 Ga0307412_106125661 125
219 3300031995 Ga0307409_100498995 Ga0307409_1004989952 125
220 3300032004 Ga0307414_10742870 Ga0307414_107428702 125
221 3300041413 Ga0439465_0082953 Ga0439465_0082953_132_509 125
222 3300041441 Ga0451787_444306 Ga0451787_444306_37_414 125
223 3300041452 Ga0451793_0628271 Ga0451793_0628271_63_440 125
224 3300041452 Ga0451793_1827400 Ga0451793_1827400_223_606 125
225 3300041456 Ga0451795_0171706 Ga0451795_0171706_224_601 125
226 3300041486 Ga0451807_2405950 Ga0451807_2405950_782_1159 125
227 3300041494 Ga0451837_0516628 Ga0451837_0516628_503_883 125
228 3300041494 Ga0451837_1149684 Ga0451837_1149684_70_447 125
229 3300041498 Ga0451841_1375081 Ga0451841_1375081_175_552 125
230 3300041509 Ga0451843_1336512 Ga0451843_1336512_191_571 125
231 3300041512 Ga0451853_3824411 Ga0451853_3824411_214_591 125
232 3300042122 Ga0450920_129882 Ga0450920_129882_94_471 125
233 3300044658 Ga0466972_0019211 Ga0466972_0019211_1065_1442 125
234 3300044658 Ga0466972_0119171 Ga0466972_0119171_644_1021 125
235 3300044683 Ga0466965_0155891 Ga0466965_0155891_637_1014 125
236 3300044683 Ga0466965_0161906 Ga0466965_0161906_628_1005 125
237 3300044684 Ga0466966_0218304 Ga0466966_0218304_581_958 125
238 3300044693 Ga0466961_0214503 Ga0466961_0214503_606_983 125
239 3300044719 Ga0466971_0083169 Ga0466971_0083169_554_931 125
240 3300044735 Ga0466968_0054440 Ga0466968_0054440_47_424 125
241 3300044735 Ga0466968_0199676 Ga0466968_0199676_86_466 125
242 3300044735 Ga0466968_0233218 Ga0466968_0233218_172_549 125
243 3300044765 Ga0466970_0031775 Ga0466970_0031775_1910_2287 125
244 3300044765 Ga0466970_0115846 Ga0466970_0115846_907_1284 125
245 3300044765 Ga0466970_0289867 Ga0466970_0289867_44_424 125
246 3300044765 Ga0466970_0460105 Ga0466970_0460105_168_548 125
247 3300044842 Ga0466957_0033885 Ga0466957_0033885_220_597 125
248 3300044842 Ga0466957_0094381 Ga0466957_0094381_173_550 125
249 3300044842 Ga0466957_0274300 Ga0466957_0274300_25_402 125
250 3300044901 Ga0466960_0028940 Ga0466960_0028940_1963_2340 125
251 3300044901 Ga0466960_0184799 Ga0466960_0184799_149_526 125
252 3300044901 Ga0466960_0602609 Ga0466960_0602609_231_611 125
253 3300045049 Ga0466959_0003420 Ga0466959_0003420_9821_10198 125
254 3300045836 Ga0466958_0598380 Ga0466958_0598380_212_589 125
255 3300046515 Ga0495620_0150098 Ga0495620_0150098_95_472 125
256 3300046518 Ga0495631_0423127 Ga0495631_0423127_124_534 125
257 3300046522 Ga0495643_0132480 Ga0495643_0132480_439_816 125
258 3300046523 Ga0495644_0305537 Ga0495644_0305537_45_422 125
259 3300046530 Ga0495654_0139447 Ga0495654_0139447_336_713 125
260 3300046539 Ga0495621_0114074 Ga0495621_0114074_570_947 125
261 3300046615 Ga0495656_0373004 Ga0495656_0373004_112_489 125
262 3300047470 Ga0495681_0102815 Ga0495681_0102815_269_646 125
263 3300048090 Ga0495615_0044125 Ga0495615_0044125_79_456 125
264 3300048903 Ga0496100_0076347 Ga0496100_0076347_1130_1519 125
265 3300048904 Ga0496101_0047841 Ga0496101_0047841_1796_2185 125
266 3300048905 Ga0496102_0088567 Ga0496102_0088567_1657_2046 125
267 3300048905 Ga0496102_0233854 Ga0496102_0233854_519_896 125
268 3300048906 Ga0496103_0048737 Ga0496103_0048737_28_417 125
269 3300048906 Ga0496103_0591926 Ga0496103_0591926_302_679 125
270 3300048907 Ga0496104_0005777 Ga0496104_0005777_8228_8605 125
271 3300048907 Ga0496104_0031359 Ga0496104_0031359_455_844 125
272 3300048907 Ga0496104_0078647 Ga0496104_0078647_2596_2973 125
273 3300048907 Ga0496104_0104747 Ga0496104_0104747_1507_1884 125
274 3300048908 Ga0496105_0001198 Ga0496105_0001198_16631_17008 125
275 3300048908 Ga0496105_0036851 Ga0496105_0036851_642_1019 125
276 3300048908 Ga0496105_0045213 Ga0496105_0045213_3067_3444 125
277 3300048908 Ga0496105_0055922 Ga0496105_0055922_973_1362 125
278 3300048910 Ga0496107_0013306 Ga0496107_0013306_1726_2115 125
279 3300048911 Ga0496108_0020556 Ga0496108_0020556_2797_3174 125
280 3300048911 Ga0496108_0191389 Ga0496108_0191389_661_1050 125
281 3300048912 Ga0496109_0012986 Ga0496109_0012986_2360_2737 125
282 3300048912 Ga0496109_0031440 Ga0496109_0031440_1243_1632 125
283 3300048913 Ga0496110_0033530 Ga0496110_0033530_1950_2339 125
284 3300048913 Ga0496110_0059713 Ga0496110_0059713_986_1363 125
285 3300048914 Ga0496111_0001311 Ga0496111_0001311_11106_11495 125
286 3300048914 Ga0496111_0081521 Ga0496111_0081521_1957_2334 125
287 3300048915 Ga0496112_0628007 Ga0496112_0628007_430_807 125
288 3300048916 Ga0496113_0158654 Ga0496113_0158654_683_1072 125
289 3300048916 Ga0496113_0210047 Ga0496113_0210047_314_691 125
290 3300048917 Ga0496114_0017719 Ga0496114_0017719_349_726 125
291 3300048917 Ga0496114_0029002 Ga0496114_0029002_3702_4091 125
292 3300048917 Ga0496114_0099835 Ga0496114_0099835_1117_1494 125
293 3300048917 Ga0496114_0713112 Ga0496114_0713112_331_711 125
294 3300048918 Ga0496115_0008787 Ga0496115_0008787_3902_4291 125
295 3300048918 Ga0496115_0066070 Ga0496115_0066070_1017_1394 125
296 3300048918 Ga0496115_0151140 Ga0496115_0151140_1105_1482 125
297 3300048918 Ga0496115_0538696 Ga0496115_0538696_464_841 125
298 3300048918 Ga0496115_0769438 Ga0496115_0769438_185_562 125
299 3300048918 Ga0496115_1081284 Ga0496115_1081284_77_454 125
300 3300048920 Ga0496117_0000053 Ga0496117_0000053_210081_210458 125
301 3300048920 Ga0496117_0015966 Ga0496117_0015966_3836_4213 125
302 3300048920 Ga0496117_0057387 Ga0496117_0057387_1468_1845 125
303 3300048920 Ga0496117_0217758 Ga0496117_0217758_303_680 125
304 3300048921 Ga0496118_0026175 Ga0496118_0026175_4089_4466 125
305 3300048922 Ga0496119_0007344 Ga0496119_0007344_9575_9952 125
306 3300048922 Ga0496119_0013811 Ga0496119_0013811_5964_6341 125
307 3300048923 Ga0496120_0001606 Ga0496120_0001606_16234_16611 125
308 3300048923 Ga0496120_0005690 Ga0496120_0005690_3298_3675 125
309 3300048923 Ga0496120_0121395 Ga0496120_0121395_48_437 125
310 3300048925 Ga0496122_0030456 Ga0496122_0030456_734_1111 125
311 3300048925 Ga0496122_0279206 Ga0496122_0279206_347_724 125
312 3300048925 Ga0496122_0325446 Ga0496122_0325446_61_438 125
313 3300048926 Ga0496123_0003526 Ga0496123_0003526_13864_14241 125
314 3300048927 Ga0496124_0022443 Ga0496124_0022443_4351_4728 125
315 3300048928 Ga0496125_0000061 Ga0496125_0000061_235269_235646 125
316 3300048929 Ga0496126_0004970 Ga0496126_0004970_11243_11620 125
317 3300048929 Ga0496126_0089444 Ga0496126_0089444_218_595 125
318 3300048929 Ga0496126_0163194 Ga0496126_0163194_1437_1814 125
319 3300048929 Ga0496126_0357854 Ga0496126_0357854_64_441 125
320 3300048929 Ga0496126_0904216 Ga0496126_0904216_113_490 125
321 3300049568 Ga0501031_0022745 Ga0501031_0022745_1674_2057 125
322 3300049569 Ga0501032_0042901 Ga0501032_0042901_1416_1799 125
323 3300049570 Ga0501033_0003601 Ga0501033_0003601_10086_10469 125
324 3300049570 Ga0501033_0053334 Ga0501033_0053334_1839_2222 125
325 3300049570 Ga0501033_0743602 Ga0501033_0743602_213_596 125
326 3300049571 Ga0501034_0003851 Ga0501034_0003851_1842_2225 125
327 3300049571 Ga0501034_0039965 Ga0501034_0039965_426_809 125
328 3300049571 Ga0501034_0485816 Ga0501034_0485816_258_635 125
329 3300049572 Ga0501036_0039434 Ga0501036_0039434_1487_1870 125
330 3300049573 Ga0501037_0006700 Ga0501037_0006700_1082_1465 125
331 3300049575 Ga0501039_0008421 Ga0501039_0008421_2811_3194 125
332 3300049578 Ga0501042_0006058 Ga0501042_0006058_507_890 125
333 3300049578 Ga0501042_0467382 Ga0501042_0467382_266_649 125
334 3300049579 Ga0501043_0046530 Ga0501043_0046530_1615_1998 125
335 3300049580 Ga0501046_0008618 Ga0501046_0008618_2753_3136 125
336 3300049581 Ga0501047_0024267 Ga0501047_0024267_3952_4335 125
337 3300049581 Ga0501047_0069733 Ga0501047_0069733_1814_2194 125
338 3300049581 Ga0501047_1272385 Ga0501047_1272385_29_412 125
339 3300049582 Ga0501048_0101889 Ga0501048_0101889_1446_1829 125
340 3300049584 Ga0501068_0147256 Ga0501068_0147256_60_443 125
341 3300049586 Ga0501070_0053777 Ga0501070_0053777_776_1159 125
342 3300049744 Ga0501083_0004406 Ga0501083_0004406_2399_2782 125
343 3300049744 Ga0501083_0034147 Ga0501083_0034147_2816_3199 125
344 3300049822 Ga0501035_0023818 Ga0501035_0023818_3748_4131 125
345 3300049823 Ga0501044_0011752 Ga0501044_0011752_7616_7999 125
346 3300049823 Ga0501044_0493562 Ga0501044_0493562_22_405 125
347 3300049823 Ga0501044_1111631 Ga0501044_1111631_151_528 125
348 3300049823 Ga0501044_1218291 Ga0501044_1218291_25_405 125
349 3300049824 Ga0501045_0135839 Ga0501045_0135839_1170_1553 125
350 3300050490 nmdc:mga03n38_5285_c1 nmdc:mga03n38_5285_c1_2641_3018 125
351 3300050491 nmdc:mga00v17_11343_c1 nmdc:mga00v17_11343_c1_3683_4060 125
352 3300050491 nmdc:mga00v17_765304_c1 nmdc:mga00v17_765304_c1_103_480 125
353 3300050492 nmdc:mga0yw44_4751_c1 nmdc:mga0yw44_4751_c1_5114_5491 125
354 3300050494 nmdc:mga06z11_88383_c1 nmdc:mga06z11_88383_c1_833_1210 125
355 3300050495 nmdc:mga04h51_5523_c1 nmdc:mga04h51_5523_c1_110_487 125
356 3300050496 nmdc:mga07m45_213058_c1 nmdc:mga07m45_213058_c1_409_786 125
357 3300050516 nmdc:mga0sz30_423320_c1 nmdc:mga0sz30_423320_c1_10_390 125
358 3300053080 Ga0500635_0000013 Ga0500635_0000013_14542_14919 125
359 3300053136 Ga0500559_0003466 Ga0500559_0003466_3755_4132 125
360 3300053136 Ga0500559_0064546 Ga0500559_0064546_130_507 125
361 3300053136 Ga0500559_0205707 Ga0500559_0205707_76_456 125
362 3300053139 Ga0500568_0000049 Ga0500568_0000049_69227_69610 125
363 3300060353 Ga0501082_0777020 Ga0501082_0777020_165_548 125
364 3300061719 Ga0466962_0131092 Ga0466962_0131092_510_887 125

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02410

RsfS

Ribosomal silencing factor during starvation

12

108

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wcw-assembly1.cif.gz_B ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis 0.9437 2 112
2o5a-assembly1.cif.gz_B crystal structure of q9kd89 from bacillus halodurans. northeast structural genomics target bhr21 0.9378 8 116
4wcw-assembly2.cif.gz_C ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis 0.9356 2 118
4wcw-assembly2.cif.gz_C ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis 0.928 2 118
4wcw-assembly1.cif.gz_B ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis 0.9276 2 112
ID Description Score Start End Superfamily
af_P0AAT6_2_105_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9741 8 108 3.30.460.10
2id1B01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9723 8 108 3.30.460.10
4wcwD01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9398 2 112 3.30.460.10
af_P0AAT6_2_105_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9378 8 108 3.30.460.10
2id1B01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9354 8 108 3.30.460.10
ID Description Score Start End GO Terms
AF-A0A4Q4D5A0-F1-model_v4 Ribosome silencing factor 0.997 7 117 GO:0017148
GO:0043023
GO:0090071
AF-A0A7Y6B8N4-F1-model_v4 deleted 0.9963 1 122
AF-A0A444QB58-F1-model_v4 Ribosomal silencing factor RsfS 0.996 1 116 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071
AF-A0A4R9BZA3-F1-model_v4 Ribosomal silencing factor RsfS 0.9959 1 117 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071
AF-A0A4Q2JA97-F1-model_v4 Ribosomal silencing factor RsfS 0.9958 1 115 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071

Feature Viewer

pLDDT pTM Quality
87.6 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map