metagRoot

F423080

General Info

Members	Datasets	Scaffolds	Average Seq Length
363	236	363	281

Family's Representative Sequence

Representative Sequence	3300046660\|Ga0495625_0000453\|Ga0495625_0000453_16598_17473
Length	291
Sequence	MLREMLIGAHVSTAGGLANAIERGEERGCESIQIFHQSPRMWRPTNYGEADFDEFREKMAASKGVEAVIIHAVYLINCATKDKELRKKSLNSLVHALRIGDGIGAKGVVLHPGSQKTDPLKPSLKRASKVIATALKETDSCPLLIEQTAGHKGLLARDFDQTAELIELAGGGPRLGLCLDSCHLFVQGYDVTDEAHLGAVLDEADAKVGIDRLGAVHVNDAAAPLGSCRDRHANIGKGEMGKRGLSAFLSEPRFEGLPATLETPGPDKKGSDKKEVMLAKRLRREGLKRRG

Samples

	Sample ID	Description	Type	Environment
1	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
2	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
3	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
4	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
5	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
6	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
7	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
8	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
9	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
10	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
11	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
12	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
13	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
14	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
15	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
16	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
17	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
18	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
19	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
20	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
21	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
22	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
23	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
24	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
25	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
26	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
27	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
28	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
29	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
30	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
31	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
32	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
33	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
34	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
35	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
36	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
37	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
38	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
39	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
40	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
41	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
42	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
43	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
44	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
45	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
46	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
47	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
48	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
49	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
50	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
51	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
52	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
53	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
54	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
55	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
56	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
57	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
58	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
59	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
60	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
61	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
62	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
63	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
64	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
65	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
66	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
67	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
68	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
69	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
70	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
71	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
72	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
73	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
74	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
75	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
76	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
77	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
78	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
79	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
80	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
120	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
121	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
122	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
123	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
124	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
125	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
126	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
127	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
128	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
129	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
130	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
131	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
132	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
133	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
134	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
135	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
136	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
137	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
138	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
139	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
140	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
141	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
142	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
143	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
144	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
145	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
146	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
147	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
148	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
149	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
150	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
151	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
152	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
153	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
154	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
155	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
156	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
157	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
158	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
159	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
160	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
161	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
162	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
163	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
164	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
165	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
166	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
167	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
168	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
169	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
170	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
171	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
172	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
173	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
174	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
175	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
176	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
177	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
178	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
179	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
180	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
181	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
182	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
183	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
184	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
185	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
186	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
187	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
188	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
189	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
190	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
191	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
192	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
193	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
194	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
195	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
196	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
197	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
198	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
199	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
200	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
201	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
202	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
203	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
204	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
205	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
206	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
207	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
208	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
209	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
210	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
211	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
212	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
213	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
214	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
215	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
216	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
217	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
218	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
219	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
220	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
221	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
222	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
223	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
224	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
225	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
226	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
227	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
228	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
229	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
230	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
231	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
232	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
233	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
234	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
235	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
236	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.72
Metatranscriptomes	0.28
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	4.41
Nodule	0
Rhizoplane	9.92
Rhizosphere	82.09
Stem	0
Stem Tuber	0
Unclassified	3.58

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10005107	3300001979	Bacteria	5572
2	Ga0070658_10045762	3300005327	Bacteria	3539
3	Ga0070676_10250194	3300005328	Bacteria	1182
4	Ga0070683_100005906	3300005329	Bacteria	10246
5	Ga0070683_100077357	3300005329	Bacteria	3111
6	Ga0070683_100097103	3300005329	Bacteria	2771
7	Ga0070682_100000030	3300005337	Bacteria	182768
8	Ga0070682_100000171	3300005337	Bacteria	48470
9	Ga0070682_100007384	3300005337	Bacteria	6201
10	Ga0070682_100109300	3300005337	Bacteria	1840
11	Ga0068868_100000520	3300005338	Bacteria	25795
12	Ga0070660_100005152	3300005339	Bacteria	9035
13	Ga0070689_100274529	3300005340	Bacteria	1397
14	Ga0070691_10000018	3300005341	Bacteria	47284
15	Ga0070691_10002451	3300005341	Bacteria	8236
16	Ga0070661_100000035	3300005344	Bacteria	111363
17	Ga0070661_100141410	3300005344	Bacteria	1814
18	Ga0070668_100007659	3300005347	Bacteria	8015
19	Ga0070674_100000004	3300005356	Bacteria	169446
20	Ga0070673_100005029	3300005364	Bacteria	8437
21	Ga0070688_100001268	3300005365	Bacteria	12586
22	Ga0070659_100005337	3300005366	Bacteria	9220
23	Ga0070659_100030610	3300005366	Bacteria	4165
24	Ga0070714_100146875	3300005435	Bacteria	2122
25	Ga0070713_100000010	3300005436	Bacteria	151790
26	Ga0070701_10037262	3300005438	Bacteria	2454
27	Ga0070711_100029845	3300005439	Bacteria	3603
28	Ga0070700_100028474	3300005441	Bacteria	3324
29	Ga0070694_100206795	3300005444	Bacteria	1466
30	Ga0070663_100038421	3300005455	Bacteria	3339
31	Ga0070678_100000345	3300005456	Bacteria	21680
32	Ga0070678_100050729	3300005456	Bacteria	3004
33	Ga0070662_100000006	3300005457	Bacteria	169366
34	Ga0070662_100079003	3300005457	Bacteria	2445
35	Ga0068867_100000295	3300005459	Bacteria	32708
36	Ga0070685_10001413	3300005466	Bacteria	12586
37	Ga0070685_10001687	3300005466	Bacteria	11606
38	Ga0070684_100023251	3300005535	Bacteria	5180
39	Ga0068853_100024630	3300005539	Bacteria	5048
40	Ga0068853_100140044	3300005539	Bacteria	2171
41	Ga0070672_100000006	3300005543	Bacteria	117060
42	Ga0070665_100008395	3300005548	Bacteria	10448
43	Ga0070665_100036631	3300005548	Bacteria	4934
44	Ga0070704_100501459	3300005549	Bacteria	1053
45	Ga0068855_100218253	3300005563	Bacteria	2140
46	Ga0070664_100008925	3300005564	Bacteria	8127
47	Ga0070664_100012611	3300005564	Bacteria	6879
48	Ga0068854_100000237	3300005578	Bacteria	37524
49	Ga0068854_100040108	3300005578	Bacteria	3302
50	Ga0070702_100052986	3300005615	Bacteria	2329
51	Ga0070702_100245083	3300005615	Bacteria	1211
52	Ga0068852_100000170	3300005616	Bacteria	43748
53	Ga0068852_100011596	3300005616	Bacteria	6647
54	Ga0068864_100000015	3300005618	Bacteria	303368
55	Ga0068866_10000004	3300005718	Bacteria	202810
56	Ga0068851_10007207	3300005834	Bacteria	5096
57	Ga0068851_10118103	3300005834	Bacteria	1423
58	Ga0068860_100014544	3300005843	Bacteria	7701
59	Ga0068860_100142452	3300005843	Bacteria	2305
60	Ga0081455_10007388	3300005937	Bacteria	11579
61	Ga0081538_10000002	3300005981	Bacteria	242010
62	Ga0081538_10030066	3300005981	Bacteria	3696
63	Ga0081540_1000063	3300005983	Bacteria	119510
64	Ga0081539_10002638	3300005985	Bacteria	24507
65	Ga0075365_10003372	3300006038	Bacteria	8216
66	Ga0075365_10013956	3300006038	Bacteria	4822
67	Ga0075365_10154785	3300006038	Bacteria	1595
68	Ga0075363_100001763	3300006048	Bacteria	8450
69	Ga0075363_100019260	3300006048	Bacteria	3410
70	Ga0075364_10039007	3300006051	Bacteria	3078
71	Ga0075364_10053875	3300006051	Bacteria	2630
72	Ga0070715_10000014	3300006163	Bacteria	154272
73	Ga0070712_100000353	3300006175	Bacteria	26043
74	Ga0075428_100377988	3300006844	Bacteria	1519
75	Ga0075433_10001022	3300006852	Bacteria	19936
76	Ga0068865_100014282	3300006881	Bacteria	5044
77	Ga0105240_10670202	3300009093	Bacteria	1135
78	Ga0111539_10144708	3300009094	Bacteria	2783
79	Ga0105245_10000116	3300009098	Bacteria	77303
80	Ga0105245_10000212	3300009098	Bacteria	55133
81	Ga0105245_10001002	3300009098	Bacteria	25634
82	Ga0105245_10007310	3300009098	Bacteria	9669
83	Ga0105245_10012005	3300009098	Bacteria	7532
84	Ga0105247_10000955	3300009101	Bacteria	21799
85	Ga0114129_10683346	3300009147	Bacteria	1321
86	Ga0105243_10426943	3300009148	Bacteria	1238
87	Ga0105242_10000375	3300009176	Bacteria	35458
88	Ga0105242_10002124	3300009176	Bacteria	15632
89	Ga0105242_10032598	3300009176	Bacteria	4167
90	Ga0105248_10000008	3300009177	Bacteria	403910
91	Ga0105238_10000048	3300009551	Bacteria	146322
92	Ga0105249_10004349	3300009553	Bacteria	12251
93	Ga0105249_10011552	3300009553	Bacteria	7759
94	Ga0105249_10128973	3300009553	Bacteria	2412
95	Ga0105239_10965686	3300010375	Bacteria	979
96	Ga0157371_10117998	3300013102	Bacteria	1886
97	Ga0157370_10012132	3300013104	Bacteria	8962
98	Ga0157370_10101367	3300013104	Bacteria	2697
99	Ga0157369_10000078	3300013105	Bacteria	135173
100	Ga0157374_10000686	3300013296	Bacteria	29832
101	Ga0157374_10369137	3300013296	Bacteria	1428
102	Ga0157378_10195622	3300013297	Bacteria	1909
103	Ga0157378_10199776	3300013297	Bacteria	1890
104	Ga0157375_10000130	3300013308	Bacteria	74968
105	Ga0157375_10003947	3300013308	Bacteria	12860
106	Ga0157375_10015272	3300013308	Bacteria	6872
107	Ga0157375_10016307	3300013308	Bacteria	6669
108	Ga0157380_10000149	3300014326	Bacteria	39858
109	Ga0157380_10000261	3300014326	Bacteria	31504
110	Ga0157380_10118539	3300014326	Bacteria	2238
111	Ga0157377_10020868	3300014745	Bacteria	3437
112	Ga0157379_10104657	3300014968	Bacteria	2540
113	Ga0157379_10292202	3300014968	Bacteria	1484
114	Ga0157376_10128805	3300014969	Bacteria	2255
115	Ga0157376_10813389	3300014969	Bacteria	948
116	Ga0163161_10001978	3300017792	Bacteria	14877
117	Ga0206353_11255567	3300020082	Bacteria	1142
118	Ga0207656_10000284	3300025321	Bacteria	17451
119	Ga0207656_10039927	3300025321	Bacteria	1988
120	Ga0207642_10000005	3300025899	Bacteria	401934
121	Ga0207710_10000543	3300025900	Bacteria	22684
122	Ga0207688_10020359	3300025901	Bacteria	3622
123	Ga0207680_10003525	3300025903	Bacteria	7367
124	Ga0207685_10000025	3300025905	Bacteria	110358
125	Ga0207645_10093357	3300025907	Bacteria	1936
126	Ga0207695_10507139	3300025913	Bacteria	1088
127	Ga0207693_10006121	3300025915	Bacteria	9974
128	Ga0207657_10004632	3300025919	Bacteria	14527
129	Ga0207649_10000028	3300025920	Bacteria	161482
130	Ga0207694_10000056	3300025924	Bacteria	146908
131	Ga0207687_10000020	3300025927	Bacteria	228407
132	Ga0207687_10000031	3300025927	Bacteria	150246
133	Ga0207687_10000079	3300025927	Bacteria	70683
134	Ga0207687_10004101	3300025927	Bacteria	9763
135	Ga0207700_10000007	3300025928	Bacteria	345720
136	Ga0207690_10003023	3300025932	Bacteria	10121
137	Ga0207706_10000017	3300025933	Bacteria	169589
138	Ga0207706_10002715	3300025933	Bacteria	17238
139	Ga0207686_10000061	3300025934	Bacteria	97978
140	Ga0207686_10000356	3300025934	Bacteria	32614
141	Ga0207709_10009853	3300025935	Bacteria	5260
142	Ga0207709_10029834	3300025935	Bacteria	3168
143	Ga0207670_10242996	3300025936	Bacteria	1388
144	Ga0207669_10000195	3300025937	Bacteria	27661
145	Ga0207691_10000025	3300025940	Bacteria	129424
146	Ga0207691_10011277	3300025940	Bacteria	8575
147	Ga0207711_10000006	3300025941	Bacteria	792692
148	Ga0207689_10200922	3300025942	Bacteria	1645
149	Ga0207661_10002602	3300025944	Bacteria	12416
150	Ga0207661_10051056	3300025944	Bacteria	3298
151	Ga0207661_10293656	3300025944	Bacteria	1455
152	Ga0207679_10007180	3300025945	Bacteria	7057
153	Ga0207667_10091842	3300025949	Bacteria	3136
154	Ga0207651_10002519	3300025960	Bacteria	8744
155	Ga0207668_10006016	3300025972	Bacteria	7154
156	Ga0207668_10014638	3300025972	Bacteria	4857
157	Ga0207640_10000248	3300025981	Bacteria	36585
158	Ga0207640_10014698	3300025981	Bacteria	4511
159	Ga0207658_10003673	3300025986	Bacteria	10820
160	Ga0207677_10000588	3300026023	Bacteria	22552
161	Ga0207639_10001181	3300026041	Bacteria	17748
162	Ga0207639_10122284	3300026041	Bacteria	2140
163	Ga0207678_10005025	3300026067	Bacteria	11867
164	Ga0207708_10001247	3300026075	Bacteria	19180
165	Ga0207708_10146611	3300026075	Bacteria	1855
166	Ga0207641_10000077	3300026088	Bacteria	144978
167	Ga0207641_10013513	3300026088	Bacteria	6697
168	Ga0207648_10002595	3300026089	Bacteria	19350
169	Ga0207648_10011262	3300026089	Bacteria	8434
170	Ga0207676_10000018	3300026095	Bacteria	306375
171	Ga0207676_10554996	3300026095	Bacteria	1098
172	Ga0207675_100122775	3300026118	Bacteria	2459
173	Ga0207675_100235077	3300026118	Bacteria	1769
174	Ga0207683_10001994	3300026121	Bacteria	18063
175	Ga0207683_10051273	3300026121	Bacteria	3615
176	Ga0207698_10000042	3300026142	Bacteria	97349
177	Ga0268266_10001339	3300028379	Bacteria	29819
178	Ga0268266_10016916	3300028379	Bacteria	6231
179	Ga0268265_10009107	3300028380	Bacteria	6711
180	Ga0268264_10008972	3300028381	Bacteria	8298
181	Ga0268264_10227538	3300028381	Bacteria	1720
182	Ga0265337_1003867	3300028556	Bacteria	6357
183	Ga0265326_10000229	3300028558	Bacteria	26997
184	Ga0265322_10000020	3300028654	Bacteria	108805
185	Ga0265336_10003653	3300028666	Bacteria	5987
186	Ga0265338_10000578	3300028800	Bacteria	64450
187	Ga0265324_10000360	3300029957	Bacteria	33003
188	Ga0265328_10002108	3300031239	Bacteria	8984
189	Ga0265320_10000035	3300031240	Bacteria	137855
190	Ga0265325_10053312	3300031241	Bacteria	2074
191	Ga0265329_10006231	3300031242	Bacteria	4749
192	Ga0265331_10003031	3300031250	Bacteria	11023
193	Ga0265327_10000015	3300031251	Bacteria	496677
194	Ga0307408_100138948	3300031548	Bacteria	1905
195	Ga0265314_10000865	3300031711	Bacteria	36011
196	Ga0307413_10153469	3300031824	Bacteria	1608
197	Ga0307410_10027891	3300031852	Bacteria	3574
198	Ga0307406_10216530	3300031901	Unclassified	1420
199	Ga0307407_10361116	3300031903	Bacteria	1031
200	Ga0307409_100019512	3300031995	Bacteria	4593
201	Ga0307416_100008970	3300032002	Bacteria	6503
202	Ga0307416_100137250	3300032002	Bacteria	2215
203	Ga0307415_100000494	3300032126	Bacteria	17107
204	Ga0307415_100069360	3300032126	Bacteria	2472
205	Ga0451800_1415042	3300041459	Bacteria	1808
206	Ga0451807_0885554	3300041486	Bacteria	975
207	Ga0451853_1853007	3300041512	Bacteria	3168
208	Ga0466963_0046497	3300044694	Bacteria	2862
209	Ga0466957_0105564	3300044842	Bacteria	1780
210	Ga0466960_0054029	3300044901	Bacteria	1949
211	Ga0466967_0000017	3300045976	Bacteria	89904
212	Ga0466967_0252462	3300045976	Bacteria	1685
213	Ga0495592_0000318	3300046454	Bacteria	40338
214	Ga0495592_0342294	3300046454	Unclassified	961
215	Ga0495603_0000020	3300046455	Bacteria	64469
216	Ga0495603_0000711	3300046455	Bacteria	18835
217	Ga0495629_0003726	3300046459	Bacteria	11487
218	Ga0495629_0015448	3300046459	Bacteria	5482
219	Ga0495638_0060881	3300046460	Bacteria	2333
220	Ga0495641_0017264	3300046461	Bacteria	3765
221	Ga0495641_0110592	3300046461	Unclassified	1226
222	Ga0495651_0244108	3300046462	Bacteria	1230
223	Ga0495653_0009400	3300046463	Bacteria	8000
224	Ga0495653_0017744	3300046463	Bacteria	5786
225	Ga0495653_0029308	3300046463	Bacteria	4396
226	Ga0495653_0076934	3300046463	Bacteria	2479
227	Ga0495662_0001700	3300046476	Bacteria	10995
228	Ga0495606_0000108	3300046507	Bacteria	140473
229	Ga0495608_0000036	3300046511	Bacteria	129609
230	Ga0495608_0000183	3300046511	Bacteria	44585
231	Ga0495618_0000144	3300046514	Bacteria	50904
232	Ga0495620_0000797	3300046515	Bacteria	19341
233	Ga0495628_0001544	3300046516	Bacteria	21069
234	Ga0495628_0118702	3300046516	Bacteria	2030
235	Ga0495628_0158981	3300046516	Bacteria	1718
236	Ga0495630_0000012	3300046517	Bacteria	223330
237	Ga0495630_0000175	3300046517	Bacteria	49924
238	Ga0495630_0000555	3300046517	Bacteria	27256
239	Ga0495652_0000023	3300046529	Bacteria	168049
240	Ga0495652_0074569	3300046529	Bacteria	2821
241	Ga0495640_0155263	3300046533	Bacteria	1469
242	Ga0495587_0034326	3300046536	Bacteria	3060
243	Ga0495598_0015258	3300046537	Bacteria	1936
244	Ga0495645_0045180	3300046543	Bacteria	3214
245	Ga0495622_0000021	3300046557	Bacteria	162267
246	Ga0495667_0000034	3300046559	Bacteria	141464
247	Ga0495667_0022185	3300046559	Bacteria	4278
248	Ga0495634_0002025	3300046642	Bacteria	17228
249	Ga0495625_0000453	3300046660	Bacteria	61379
250	Ga0495635_0062787	3300046663	Bacteria	2551
251	Ga0495635_0225255	3300046663	Bacteria	1267
252	Ga0495588_0000149	3300046674	Bacteria	100598
253	Ga0495657_0000001	3300046675	Bacteria	445641
254	Ga0495599_0023666	3300046678	Bacteria	3840
255	Ga0495647_0000009	3300046681	Bacteria	94874
256	Ga0495647_0000047	3300046681	Bacteria	35186
257	Ga0495647_0009294	3300046681	Bacteria	3326
258	Ga0495647_0011573	3300046681	Bacteria	3025
259	Ga0495658_0001601	3300046683	Bacteria	11790
260	Ga0495669_0020973	3300046684	Bacteria	2832
261	Ga0495613_0000481	3300046689	Bacteria	34000
262	Ga0495624_0000414	3300046690	Bacteria	33832
263	Ga0495624_0005038	3300046690	Bacteria	9563
264	Ga0495600_0000645	3300046809	Bacteria	18030
265	Ga0495600_0009781	3300046809	Bacteria	5928
266	Ga0495600_0050092	3300046809	Bacteria	2725
267	Ga0495604_0000122	3300047317	Bacteria	65938
268	Ga0495604_0000317	3300047317	Bacteria	43411
269	Ga0495674_0000019	3300047319	Bacteria	185107
270	Ga0495676_0002025	3300047321	Bacteria	17856
271	Ga0495680_0000193	3300047322	Bacteria	65567
272	Ga0495680_0003849	3300047322	Bacteria	14549
273	Ga0495680_0321170	3300047322	Bacteria	1083
274	Ga0495675_0000037	3300047444	Bacteria	91283
275	Ga0495685_019445	3300047447	Bacteria	2333
276	Ga0495684_0098641	3300047471	Bacteria	2209
277	Ga0495686_0078013	3300047472	Bacteria	2028
278	Ga0495593_0012869	3300047673	Bacteria	4780
279	Ga0495602_0000166	3300048088	Bacteria	61220
280	Ga0495602_0308198	3300048088	Bacteria	1156
281	Ga0496100_0000005	3300048903	Bacteria	312112
282	Ga0496101_0000022	3300048904	Bacteria	216728
283	Ga0496101_0370079	3300048904	Bacteria	1127
284	Ga0496102_0000081	3300048905	Bacteria	139266
285	Ga0496103_0000031	3300048906	Bacteria	204016
286	Ga0496103_0351924	3300048906	Bacteria	947
287	Ga0496104_0000024	3300048907	Bacteria	229913
288	Ga0496104_0000077	3300048907	Bacteria	100848
289	Ga0496104_0005387	3300048907	Bacteria	11200
290	Ga0496105_0000004	3300048908	Bacteria	475798
291	Ga0496105_0000013	3300048908	Bacteria	229894
292	Ga0496105_0000098	3300048908	Bacteria	59301
293	Ga0496106_0000087	3300048909	Bacteria	73787
294	Ga0496106_0119550	3300048909	Bacteria	2058
295	Ga0496107_0000046	3300048910	Bacteria	67209
296	Ga0496108_0000005	3300048911	Bacteria	535059
297	Ga0496108_0000365	3300048911	Bacteria	38077
298	Ga0496108_0529184	3300048911	Bacteria	1029
299	Ga0496109_0000095	3300048912	Bacteria	91702
300	Ga0496109_0000174	3300048912	Bacteria	63794
301	Ga0496109_0000628	3300048912	Bacteria	29413
302	Ga0496110_0000011	3300048913	Bacteria	97293
303	Ga0496110_0129696	3300048913	Bacteria	2276
304	Ga0496111_0000170	3300048914	Bacteria	29627
305	Ga0496111_0012939	3300048914	Bacteria	5662
306	Ga0496111_0115276	3300048914	Bacteria	1981
307	Ga0496112_0000085	3300048915	Bacteria	61255
308	Ga0496112_0020305	3300048915	Bacteria	6294
309	Ga0496113_0000202	3300048916	Bacteria	27530
310	Ga0496113_0015272	3300048916	Bacteria	5272
311	Ga0496113_0347999	3300048916	Bacteria	1189
312	Ga0496114_0044413	3300048917	Bacteria	3687
313	Ga0496115_0000010	3300048918	Bacteria	227112
314	Ga0496115_0410449	3300048918	Bacteria	1098
315	Ga0496116_0000519	3300048919	Bacteria	51925
316	Ga0496117_0070769	3300048920	Bacteria	2341
317	Ga0496118_0001908	3300048921	Bacteria	29656
318	Ga0496119_0002641	3300048922	Bacteria	19419
319	Ga0496119_0015243	3300048922	Bacteria	5939
320	Ga0496119_0021220	3300048922	Bacteria	4703
321	Ga0496120_0003219	3300048923	Bacteria	15156
322	Ga0496121_0028280	3300048924	Bacteria	5223
323	Ga0496121_0036430	3300048924	Bacteria	4384
324	Ga0496125_0046197	3300048928	Bacteria	3656
325	Ga0496125_0097520	3300048928	Bacteria	2178
326	Ga0496126_0014886	3300048929	Bacteria	7845
327	Ga0501032_0191604	3300049569	Bacteria	1336
328	Ga0501042_0010425	3300049578	Bacteria	6233
329	Ga0501070_0035531	3300049586	Bacteria	4165
330	Ga0501070_0044216	3300049586	Bacteria	3706
331	Ga0501071_0012632	3300049587	Bacteria	5736
332	Ga0501072_0103060	3300049588	Bacteria	2268
333	Ga0501073_0084766	3300049589	Bacteria	2205
334	Ga0501083_0106049	3300049744	Bacteria	1850
335	nmdc:mga03n38_24029_c1	3300050490	Bacteria	2488
336	nmdc:mga03n38_47259_c1	3300050490	Bacteria	1904
337	nmdc:mga00v17_124097_c1	3300050491	Bacteria	1646
338	nmdc:mga0yw44_1730_c1	3300050492	Bacteria	8868
339	nmdc:mga06z11_235835_c1	3300050494	Bacteria	1073
340	nmdc:mga05p37_668135_c1	3300050507	Bacteria	1160
341	nmdc:mga0a205_45_c1	3300050515	Bacteria	68070
342	nmdc:mga0a205_934_c1	3300050515	Bacteria	16438
343	Ga0495601_0000034	3300053077	Bacteria	93719
344	Ga0495601_0000104	3300053077	Bacteria	46045
345	Ga0495601_0004052	3300053077	Bacteria	8446
346	Ga0495601_0069438	3300053077	Unclassified	2247
347	Ga0495601_0081702	3300053077	Bacteria	2074
348	Ga0495601_0139051	3300053077	Bacteria	1583
349	Ga0495612_0007489	3300053078	Bacteria	4462
350	Ga0495612_0035894	3300053078	Bacteria	2010
351	Ga0495655_0000006	3300053083	Bacteria	201200
352	Ga0495595_0000002	3300053084	Bacteria	445641
353	Ga0495595_0000121	3300053084	Bacteria	33439
354	Ga0495619_0000008	3300053085	Bacteria	305999
355	Ga0495619_0000037	3300053085	Bacteria	124007
356	Ga0495619_0000541	3300053085	Bacteria	24974
357	Ga0495619_0000769	3300053085	Bacteria	20942
358	Ga0495619_0002670	3300053085	Bacteria	11667
359	Ga0500566_0000850	3300053094	Bacteria	17428
360	Ga0500641_0066969	3300053096	Bacteria	1504
361	Ga0500595_024547	3300053119	Bacteria	2103
362	Ga0500628_000001	3300053129	Bacteria	564074
363	Ga0530510_0289629	3300061734	Bacteria	1224

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300031548	Ga0307408_100138948	Ga0307408_1001389482	227
2	3300031901	Ga0307406_10216530	Ga0307406_102165303	227
3	3300053078	Ga0495612_0035894	Ga0495612_0035894_485_1357	228
4	3300046511	Ga0495608_0000036	Ga0495608_0000036_68189_69064	231
5	3300046675	Ga0495657_0000001	Ga0495657_0000001_68189_69064	231
6	3300047444	Ga0495675_0000037	Ga0495675_0000037_55003_55878	231
7	3300053084	Ga0495595_0000002	Ga0495595_0000002_376578_377453	231
8	3300053085	Ga0495619_0000541	Ga0495619_0000541_152_1027	231
9	3300049588	Ga0501072_0103060	Ga0501072_0103060_193_1062	232
10	3300061734	Ga0530510_0289629	Ga0530510_0289629_56_925	232
11	3300025935	Ga0207709_10029834	Ga0207709_100298342	248
12	3300006048	Ga0075363_100019260	Ga0075363_1000192604	249
13	3300006051	Ga0075364_10039007	Ga0075364_100390073	249
14	3300046684	Ga0495669_0020973	Ga0495669_0020973_692_1552	249
15	3300048916	Ga0496113_0015272	Ga0496113_0015272_3351_4211	249
16	3300049586	Ga0501070_0044216	Ga0501070_0044216_732_1589	249
17	3300049589	Ga0501073_0084766	Ga0501073_0084766_1136_1993	249
18	3300049744	Ga0501083_0106049	Ga0501083_0106049_802_1659	249
19	3300050490	nmdc:mga03n38_47259_c1	nmdc:mga03n38_47259_c1_284_1144	249
20	3300005327	Ga0070658_10045762	Ga0070658_100457621	250
21	3300005328	Ga0070676_10250194	Ga0070676_102501942	250
22	3300005329	Ga0070683_100097103	Ga0070683_1000971031	250
23	3300005337	Ga0070682_100007384	Ga0070682_1000073842	250
24	3300005337	Ga0070682_100109300	Ga0070682_1001093002	250
25	3300005339	Ga0070660_100005152	Ga0070660_1000051527	250
26	3300005344	Ga0070661_100141410	Ga0070661_1001414102	250
27	3300005347	Ga0070668_100007659	Ga0070668_1000076593	250
28	3300005366	Ga0070659_100030610	Ga0070659_1000306102	250
29	3300005438	Ga0070701_10037262	Ga0070701_100372622	250
30	3300005441	Ga0070700_100028474	Ga0070700_1000284743	250
31	3300005455	Ga0070663_100038421	Ga0070663_1000384213	250
32	3300005457	Ga0070662_100079003	Ga0070662_1000790031	250
33	3300005543	Ga0070672_100000006	Ga0070672_10000000669	250
34	3300005548	Ga0070665_100036631	Ga0070665_1000366312	250
35	3300005549	Ga0070704_100501459	Ga0070704_1005014591	250
36	3300005563	Ga0068855_100218253	Ga0068855_1002182532	250
37	3300005564	Ga0070664_100008925	Ga0070664_1000089252	250
38	3300005578	Ga0068854_100040108	Ga0068854_1000401081	250
39	3300005615	Ga0070702_100052986	Ga0070702_1000529862	250
40	3300005615	Ga0070702_100245083	Ga0070702_1002450832	250
41	3300005616	Ga0068852_100011596	Ga0068852_1000115965	250
42	3300005985	Ga0081539_10002638	Ga0081539_1000263810	250
43	3300006038	Ga0075365_10003372	Ga0075365_100033726	250
44	3300006048	Ga0075363_100001763	Ga0075363_1000017634	250
45	3300006051	Ga0075364_10053875	Ga0075364_100538752	250
46	3300006852	Ga0075433_10001022	Ga0075433_100010227	250
47	3300006881	Ga0068865_100014282	Ga0068865_1000142823	250
48	3300009094	Ga0111539_10144708	Ga0111539_101447083	250
49	3300009098	Ga0105245_10012005	Ga0105245_1001200510	250
50	3300009147	Ga0114129_10683346	Ga0114129_106833462	250
51	3300009551	Ga0105238_10000048	Ga0105238_1000004886	250
52	3300009553	Ga0105249_10011552	Ga0105249_100115524	250
53	3300013102	Ga0157371_10117998	Ga0157371_101179981	250
54	3300013308	Ga0157375_10016307	Ga0157375_100163077	250
55	3300014745	Ga0157377_10020868	Ga0157377_100208682	250
56	3300014968	Ga0157379_10104657	Ga0157379_101046572	250
57	3300014969	Ga0157376_10813389	Ga0157376_108133891	250
58	3300025901	Ga0207688_10020359	Ga0207688_100203593	250
59	3300025919	Ga0207657_10004632	Ga0207657_1000463212	250
60	3300025924	Ga0207694_10000056	Ga0207694_1000005686	250
61	3300025933	Ga0207706_10002715	Ga0207706_100027155	250
62	3300025936	Ga0207670_10242996	Ga0207670_102429961	250
63	3300025940	Ga0207691_10000025	Ga0207691_1000002555	250
64	3300025940	Ga0207691_10011277	Ga0207691_100112774	250
65	3300025942	Ga0207689_10200922	Ga0207689_102009222	250
66	3300025944	Ga0207661_10293656	Ga0207661_102936561	250
67	3300025949	Ga0207667_10091842	Ga0207667_100918422	250
68	3300025972	Ga0207668_10014638	Ga0207668_100146383	250
69	3300025981	Ga0207640_10014698	Ga0207640_100146983	250
70	3300026067	Ga0207678_10005025	Ga0207678_1000502511	250
71	3300026075	Ga0207708_10001247	Ga0207708_1000124714	250
72	3300026089	Ga0207648_10011262	Ga0207648_100112622	250
73	3300026095	Ga0207676_10554996	Ga0207676_105549962	250
74	3300026118	Ga0207675_100122775	Ga0207675_1001227752	250
75	3300028379	Ga0268266_10016916	Ga0268266_100169162	250
76	3300044901	Ga0466960_0054029	Ga0466960_0054029_667_1545	250
77	3300046454	Ga0495592_0000318	Ga0495592_0000318_17532_18392	250
78	3300046455	Ga0495603_0000020	Ga0495603_0000020_2683_3543	250
79	3300046460	Ga0495638_0060881	Ga0495638_0060881_10_870	250
80	3300046463	Ga0495653_0029308	Ga0495653_0029308_1250_2110	250
81	3300046511	Ga0495608_0000183	Ga0495608_0000183_23388_24248	250
82	3300046557	Ga0495622_0000021	Ga0495622_0000021_65138_65998	250
83	3300046660	Ga0495625_0000453	Ga0495625_0000453_16598_17473	250
84	3300046678	Ga0495599_0023666	Ga0495599_0023666_785_1645	250
85	3300046681	Ga0495647_0009294	Ga0495647_0009294_246_1106	250
86	3300047447	Ga0495685_019445	Ga0495685_019445_367_1227	250
87	3300048906	Ga0496103_0351924	Ga0496103_0351924_167_931	250
88	3300048907	Ga0496104_0000024	Ga0496104_0000024_69335_70195	250
89	3300048908	Ga0496105_0000013	Ga0496105_0000013_159719_160579	250
90	3300048909	Ga0496106_0119550	Ga0496106_0119550_1149_2018	250
91	3300048911	Ga0496108_0529184	Ga0496108_0529184_70_939	250
92	3300048914	Ga0496111_0115276	Ga0496111_0115276_46_915	250
93	3300048916	Ga0496113_0347999	Ga0496113_0347999_209_1078	250
94	3300048918	Ga0496115_0410449	Ga0496115_0410449_11_871	250
95	3300049578	Ga0501042_0010425	Ga0501042_0010425_5189_6049	250
96	3300050490	nmdc:mga03n38_24029_c1	nmdc:mga03n38_24029_c1_88_957	250
97	3300050491	nmdc:mga00v17_124097_c1	nmdc:mga00v17_124097_c1_796_1614	250
98	3300050494	nmdc:mga06z11_235835_c1	nmdc:mga06z11_235835_c1_69_938	250
99	3300050507	nmdc:mga05p37_668135_c1	nmdc:mga05p37_668135_c1_206_1066	250
100	3300050515	nmdc:mga0a205_45_c1	nmdc:mga0a205_45_c1_59656_60516	250
101	3300053077	Ga0495601_0000104	Ga0495601_0000104_11790_12650	250
102	3300053084	Ga0495595_0000121	Ga0495595_0000121_4555_5415	250
103	3300001979	JGI24740J21852_10005107	JGI24740J21852_100051071	251
104	3300005329	Ga0070683_100005906	Ga0070683_1000059061	251
105	3300005329	Ga0070683_100077357	Ga0070683_1000773573	251
106	3300005337	Ga0070682_100000030	Ga0070682_100000030113	251
107	3300005337	Ga0070682_100000171	Ga0070682_10000017146	251
108	3300005338	Ga0068868_100000520	Ga0068868_10000052015	251
109	3300005340	Ga0070689_100274529	Ga0070689_1002745291	251
110	3300005341	Ga0070691_10000018	Ga0070691_1000001814	251
111	3300005341	Ga0070691_10002451	Ga0070691_100024512	251
112	3300005344	Ga0070661_100000035	Ga0070661_10000003560	251
113	3300005356	Ga0070674_100000004	Ga0070674_100000004113	251
114	3300005364	Ga0070673_100005029	Ga0070673_1000050297	251
115	3300005365	Ga0070688_100001268	Ga0070688_1000012684	251
116	3300005366	Ga0070659_100005337	Ga0070659_1000053377	251
117	3300005435	Ga0070714_100146875	Ga0070714_1001468752	251
118	3300005436	Ga0070713_100000010	Ga0070713_1000000104	251
119	3300005439	Ga0070711_100029845	Ga0070711_1000298451	251
120	3300005444	Ga0070694_100206795	Ga0070694_1002067952	251
121	3300005456	Ga0070678_100000345	Ga0070678_10000034510	251
122	3300005456	Ga0070678_100050729	Ga0070678_1000507293	251
123	3300005457	Ga0070662_100000006	Ga0070662_100000006116	251
124	3300005459	Ga0068867_100000295	Ga0068867_1000002957	251
125	3300005466	Ga0070685_10001413	Ga0070685_1000141310	251
126	3300005466	Ga0070685_10001687	Ga0070685_100016879	251
127	3300005535	Ga0070684_100023251	Ga0070684_1000232511	251
128	3300005539	Ga0068853_100024630	Ga0068853_1000246302	251
129	3300005539	Ga0068853_100140044	Ga0068853_1001400441	251
130	3300005548	Ga0070665_100008395	Ga0070665_1000083952	251
131	3300005564	Ga0070664_100012611	Ga0070664_1000126113	251
132	3300005578	Ga0068854_100000237	Ga0068854_10000023726	251
133	3300005616	Ga0068852_100000170	Ga0068852_10000017035	251
134	3300005618	Ga0068864_100000015	Ga0068864_100000015242	251
135	3300005718	Ga0068866_10000004	Ga0068866_10000004150	251
136	3300005834	Ga0068851_10007207	Ga0068851_100072072	251
137	3300005834	Ga0068851_10118103	Ga0068851_101181032	251
138	3300005843	Ga0068860_100014544	Ga0068860_1000145443	251
139	3300005843	Ga0068860_100142452	Ga0068860_1001424522	251
140	3300005937	Ga0081455_10007388	Ga0081455_100073886	251
141	3300005981	Ga0081538_10000002	Ga0081538_10000002186	251
142	3300005981	Ga0081538_10030066	Ga0081538_100300663	251
143	3300005983	Ga0081540_1000063	Ga0081540_100006333	251
144	3300006038	Ga0075365_10013956	Ga0075365_100139563	251
145	3300006038	Ga0075365_10154785	Ga0075365_101547852	251
146	3300006163	Ga0070715_10000014	Ga0070715_10000014109	251
147	3300006175	Ga0070712_100000353	Ga0070712_10000035314	251
148	3300006844	Ga0075428_100377988	Ga0075428_1003779882	251
149	3300009093	Ga0105240_10670202	Ga0105240_106702021	251
150	3300009098	Ga0105245_10000116	Ga0105245_1000011618	251
151	3300009098	Ga0105245_10000212	Ga0105245_100002124	251
152	3300009098	Ga0105245_10001002	Ga0105245_1000100220	251
153	3300009098	Ga0105245_10007310	Ga0105245_100073107	251
154	3300009101	Ga0105247_10000955	Ga0105247_100009554	251
155	3300009148	Ga0105243_10426943	Ga0105243_104269432	251
156	3300009176	Ga0105242_10000375	Ga0105242_1000037530	251
157	3300009176	Ga0105242_10002124	Ga0105242_1000212412	251
158	3300009176	Ga0105242_10032598	Ga0105242_100325982	251
159	3300009177	Ga0105248_10000008	Ga0105248_1000000833	251
160	3300009553	Ga0105249_10004349	Ga0105249_1000434910	251
161	3300009553	Ga0105249_10128973	Ga0105249_101289731	251
162	3300010375	Ga0105239_10965686	Ga0105239_109656862	251
163	3300013104	Ga0157370_10012132	Ga0157370_100121326	251
164	3300013104	Ga0157370_10101367	Ga0157370_101013672	251
165	3300013105	Ga0157369_10000078	Ga0157369_1000007880	251
166	3300013296	Ga0157374_10000686	Ga0157374_100006865	251
167	3300013296	Ga0157374_10369137	Ga0157374_103691372	251
168	3300013297	Ga0157378_10195622	Ga0157378_101956222	251
169	3300013297	Ga0157378_10199776	Ga0157378_101997762	251
170	3300013308	Ga0157375_10000130	Ga0157375_1000013013	251
171	3300013308	Ga0157375_10003947	Ga0157375_1000394712	251
172	3300013308	Ga0157375_10015272	Ga0157375_100152725	251
173	3300014326	Ga0157380_10000149	Ga0157380_1000014937	251
174	3300014326	Ga0157380_10000261	Ga0157380_1000026111	251
175	3300014326	Ga0157380_10118539	Ga0157380_101185392	251
176	3300014968	Ga0157379_10292202	Ga0157379_102922022	251
177	3300014969	Ga0157376_10128805	Ga0157376_101288052	251
178	3300017792	Ga0163161_10001978	Ga0163161_100019785	251
179	3300020082	Ga0206353_11255567	Ga0206353_112555672	251
180	3300025321	Ga0207656_10000284	Ga0207656_1000028415	251
181	3300025321	Ga0207656_10039927	Ga0207656_100399272	251
182	3300025899	Ga0207642_10000005	Ga0207642_1000000557	251
183	3300025900	Ga0207710_10000543	Ga0207710_100005437	251
184	3300025903	Ga0207680_10003525	Ga0207680_100035253	251
185	3300025905	Ga0207685_10000025	Ga0207685_1000002557	251
186	3300025907	Ga0207645_10093357	Ga0207645_100933572	251
187	3300025913	Ga0207695_10507139	Ga0207695_105071391	251
188	3300025915	Ga0207693_10006121	Ga0207693_100061215	251
189	3300025920	Ga0207649_10000028	Ga0207649_10000028102	251
190	3300025927	Ga0207687_10000020	Ga0207687_1000002065	251
191	3300025927	Ga0207687_10000031	Ga0207687_1000003197	251
192	3300025927	Ga0207687_10000079	Ga0207687_1000007951	251
193	3300025927	Ga0207687_10004101	Ga0207687_100041014	251
194	3300025928	Ga0207700_10000007	Ga0207700_10000007205	251
195	3300025932	Ga0207690_10003023	Ga0207690_100030235	251
196	3300025933	Ga0207706_10000017	Ga0207706_10000017116	251
197	3300025934	Ga0207686_10000061	Ga0207686_1000006199	251
198	3300025934	Ga0207686_10000356	Ga0207686_100003564	251
199	3300025935	Ga0207709_10009853	Ga0207709_100098533	251
200	3300025937	Ga0207669_10000195	Ga0207669_1000019525	251
201	3300025941	Ga0207711_10000006	Ga0207711_10000006430	251
202	3300025944	Ga0207661_10002602	Ga0207661_100026024	251
203	3300025944	Ga0207661_10051056	Ga0207661_100510562	251
204	3300025945	Ga0207679_10007180	Ga0207679_100071803	251
205	3300025960	Ga0207651_10002519	Ga0207651_100025197	251
206	3300025972	Ga0207668_10006016	Ga0207668_100060167	251
207	3300025981	Ga0207640_10000248	Ga0207640_100002484	251
208	3300025986	Ga0207658_10003673	Ga0207658_100036736	251
209	3300026023	Ga0207677_10000588	Ga0207677_100005889	251
210	3300026041	Ga0207639_10001181	Ga0207639_1000118115	251
211	3300026041	Ga0207639_10122284	Ga0207639_101222842	251
212	3300026075	Ga0207708_10146611	Ga0207708_101466113	251
213	3300026088	Ga0207641_10000077	Ga0207641_1000007769	251
214	3300026088	Ga0207641_10013513	Ga0207641_100135134	251
215	3300026089	Ga0207648_10002595	Ga0207648_1000259517	251
216	3300026095	Ga0207676_10000018	Ga0207676_1000001858	251
217	3300026118	Ga0207675_100235077	Ga0207675_1002350772	251
218	3300026121	Ga0207683_10001994	Ga0207683_1000199412	251
219	3300026121	Ga0207683_10051273	Ga0207683_100512732	251
220	3300026142	Ga0207698_10000042	Ga0207698_1000004263	251
221	3300028379	Ga0268266_10001339	Ga0268266_1000133929	251
222	3300028380	Ga0268265_10009107	Ga0268265_100091074	251
223	3300028381	Ga0268264_10008972	Ga0268264_100089724	251
224	3300028381	Ga0268264_10227538	Ga0268264_102275382	251
225	3300028556	Ga0265337_1003867	Ga0265337_10038674	251
226	3300028558	Ga0265326_10000229	Ga0265326_1000022917	251
227	3300028654	Ga0265322_10000020	Ga0265322_1000002062	251
228	3300028666	Ga0265336_10003653	Ga0265336_100036532	251
229	3300028800	Ga0265338_10000578	Ga0265338_100005782	251
230	3300029957	Ga0265324_10000360	Ga0265324_1000036022	251
231	3300031239	Ga0265328_10002108	Ga0265328_100021082	251
232	3300031240	Ga0265320_10000035	Ga0265320_1000003562	251
233	3300031241	Ga0265325_10053312	Ga0265325_100533121	251
234	3300031242	Ga0265329_10006231	Ga0265329_100062312	251
235	3300031250	Ga0265331_10003031	Ga0265331_100030311	251
236	3300031251	Ga0265327_10000015	Ga0265327_10000015436	251
237	3300031711	Ga0265314_10000865	Ga0265314_100008653	251
238	3300031824	Ga0307413_10153469	Ga0307413_101534692	251
239	3300031852	Ga0307410_10027891	Ga0307410_100278912	251
240	3300031903	Ga0307407_10361116	Ga0307407_103611162	251
241	3300031995	Ga0307409_100019512	Ga0307409_1000195123	251
242	3300032002	Ga0307416_100008970	Ga0307416_1000089703	251
243	3300032002	Ga0307416_100137250	Ga0307416_1001372502	251
244	3300032126	Ga0307415_100000494	Ga0307415_1000004948	251
245	3300032126	Ga0307415_100069360	Ga0307415_1000693602	251
246	3300041459	Ga0451800_1415042	Ga0451800_1415042_634_1497	251
247	3300041486	Ga0451807_0885554	Ga0451807_0885554_161_916	251
248	3300041512	Ga0451853_1853007	Ga0451853_1853007_509_1372	251
249	3300044694	Ga0466963_0046497	Ga0466963_0046497_1743_2615	251
250	3300044842	Ga0466957_0105564	Ga0466957_0105564_83_955	251
251	3300045976	Ga0466967_0000017	Ga0466967_0000017_43126_43989	251
252	3300045976	Ga0466967_0252462	Ga0466967_0252462_57_920	251
253	3300046454	Ga0495592_0342294	Ga0495592_0342294_77_943	251
254	3300046455	Ga0495603_0000711	Ga0495603_0000711_5065_5928	251
255	3300046459	Ga0495629_0003726	Ga0495629_0003726_83_946	251
256	3300046459	Ga0495629_0015448	Ga0495629_0015448_54_917	251
257	3300046461	Ga0495641_0017264	Ga0495641_0017264_59_922	251
258	3300046461	Ga0495641_0110592	Ga0495641_0110592_32_895	251
259	3300046462	Ga0495651_0244108	Ga0495651_0244108_293_1159	251
260	3300046463	Ga0495653_0009400	Ga0495653_0009400_1498_2367	251
261	3300046463	Ga0495653_0017744	Ga0495653_0017744_2243_3106	251
262	3300046463	Ga0495653_0076934	Ga0495653_0076934_1276_2139	251
263	3300046476	Ga0495662_0001700	Ga0495662_0001700_109_972	251
264	3300046507	Ga0495606_0000108	Ga0495606_0000108_91271_92134	251
265	3300046514	Ga0495618_0000144	Ga0495618_0000144_44068_44931	251
266	3300046515	Ga0495620_0000797	Ga0495620_0000797_117_980	251
267	3300046516	Ga0495628_0001544	Ga0495628_0001544_2887_3750	251
268	3300046516	Ga0495628_0118702	Ga0495628_0118702_318_1181	251
269	3300046516	Ga0495628_0158981	Ga0495628_0158981_389_1252	251
270	3300046517	Ga0495630_0000012	Ga0495630_0000012_176807_177670	251
271	3300046517	Ga0495630_0000175	Ga0495630_0000175_20483_21349	251
272	3300046517	Ga0495630_0000555	Ga0495630_0000555_18345_19208	251
273	3300046529	Ga0495652_0000023	Ga0495652_0000023_100246_101109	251
274	3300046529	Ga0495652_0074569	Ga0495652_0074569_1626_2492	251
275	3300046533	Ga0495640_0155263	Ga0495640_0155263_396_1259	251
276	3300046536	Ga0495587_0034326	Ga0495587_0034326_116_979	251
277	3300046537	Ga0495598_0015258	Ga0495598_0015258_540_1403	251
278	3300046543	Ga0495645_0045180	Ga0495645_0045180_297_1163	251
279	3300046559	Ga0495667_0000034	Ga0495667_0000034_74223_75086	251
280	3300046559	Ga0495667_0022185	Ga0495667_0022185_1002_1865	251
281	3300046642	Ga0495634_0002025	Ga0495634_0002025_15515_16381	251
282	3300046663	Ga0495635_0062787	Ga0495635_0062787_575_1441	251
283	3300046663	Ga0495635_0225255	Ga0495635_0225255_236_1099	251
284	3300046674	Ga0495588_0000149	Ga0495588_0000149_20923_21786	251
285	3300046681	Ga0495647_0000009	Ga0495647_0000009_27294_28157	251
286	3300046681	Ga0495647_0000047	Ga0495647_0000047_20926_21789	251
287	3300046681	Ga0495647_0011573	Ga0495647_0011573_596_1459	251
288	3300046683	Ga0495658_0001601	Ga0495658_0001601_9180_10043	251
289	3300046689	Ga0495613_0000481	Ga0495613_0000481_5687_6550	251
290	3300046690	Ga0495624_0000414	Ga0495624_0000414_25324_26187	251
291	3300046690	Ga0495624_0005038	Ga0495624_0005038_3757_4620	251
292	3300046809	Ga0495600_0000645	Ga0495600_0000645_2814_3677	251
293	3300046809	Ga0495600_0009781	Ga0495600_0009781_610_1473	251
294	3300046809	Ga0495600_0050092	Ga0495600_0050092_1436_2299	251
295	3300047317	Ga0495604_0000122	Ga0495604_0000122_61041_61904	251
296	3300047317	Ga0495604_0000317	Ga0495604_0000317_32320_33183	251
297	3300047319	Ga0495674_0000019	Ga0495674_0000019_147882_148745	251
298	3300047321	Ga0495676_0002025	Ga0495676_0002025_14999_15862	251
299	3300047322	Ga0495680_0000193	Ga0495680_0000193_58978_59859	251
300	3300047322	Ga0495680_0003849	Ga0495680_0003849_12634_13497	251
301	3300047322	Ga0495680_0321170	Ga0495680_0321170_183_1046	251
302	3300047471	Ga0495684_0098641	Ga0495684_0098641_1176_2057	251
303	3300047472	Ga0495686_0078013	Ga0495686_0078013_115_978	251
304	3300047673	Ga0495593_0012869	Ga0495593_0012869_71_934	251
305	3300048088	Ga0495602_0000166	Ga0495602_0000166_60247_61122	251
306	3300048088	Ga0495602_0308198	Ga0495602_0308198_54_917	251
307	3300048903	Ga0496100_0000005	Ga0496100_0000005_57993_58856	251
308	3300048904	Ga0496101_0000022	Ga0496101_0000022_182830_183693	251
309	3300048904	Ga0496101_0370079	Ga0496101_0370079_218_1081	251
310	3300048905	Ga0496102_0000081	Ga0496102_0000081_71968_72831	251
311	3300048906	Ga0496103_0000031	Ga0496103_0000031_65513_66376	251
312	3300048907	Ga0496104_0000077	Ga0496104_0000077_66435_67298	251
313	3300048907	Ga0496104_0005387	Ga0496104_0005387_2293_3162	251
314	3300048908	Ga0496105_0000004	Ga0496105_0000004_33551_34414	251
315	3300048908	Ga0496105_0000098	Ga0496105_0000098_4067_4936	251
316	3300048909	Ga0496106_0000087	Ga0496106_0000087_57345_58208	251
317	3300048910	Ga0496107_0000046	Ga0496107_0000046_51387_52250	251
318	3300048911	Ga0496108_0000005	Ga0496108_0000005_21151_22014	251
319	3300048911	Ga0496108_0000365	Ga0496108_0000365_8379_9242	251
320	3300048912	Ga0496109_0000095	Ga0496109_0000095_21097_21960	251
321	3300048912	Ga0496109_0000174	Ga0496109_0000174_23975_24838	251
322	3300048912	Ga0496109_0000628	Ga0496109_0000628_25883_26746	251
323	3300048913	Ga0496110_0000011	Ga0496110_0000011_65256_66119	251
324	3300048913	Ga0496110_0129696	Ga0496110_0129696_50_805	251
325	3300048914	Ga0496111_0000170	Ga0496111_0000170_28591_29454	251
326	3300048914	Ga0496111_0012939	Ga0496111_0012939_3714_4577	251
327	3300048915	Ga0496112_0000085	Ga0496112_0000085_60144_61007	251
328	3300048915	Ga0496112_0020305	Ga0496112_0020305_5322_6185	251
329	3300048916	Ga0496113_0000202	Ga0496113_0000202_26383_27246	251
330	3300048917	Ga0496114_0044413	Ga0496114_0044413_1040_1903	251
331	3300048918	Ga0496115_0000010	Ga0496115_0000010_168261_169124	251
332	3300048919	Ga0496116_0000519	Ga0496116_0000519_29999_30862	251
333	3300048920	Ga0496117_0070769	Ga0496117_0070769_81_944	251
334	3300048921	Ga0496118_0001908	Ga0496118_0001908_7481_8344	251
335	3300048922	Ga0496119_0002641	Ga0496119_0002641_15221_16084	251
336	3300048922	Ga0496119_0015243	Ga0496119_0015243_375_1238	251
337	3300048922	Ga0496119_0021220	Ga0496119_0021220_1294_2157	251
338	3300048923	Ga0496120_0003219	Ga0496120_0003219_5820_6683	251
339	3300048924	Ga0496121_0028280	Ga0496121_0028280_2422_3285	251
340	3300048924	Ga0496121_0036430	Ga0496121_0036430_1264_2127	251
341	3300048928	Ga0496125_0046197	Ga0496125_0046197_1113_1976	251
342	3300048928	Ga0496125_0097520	Ga0496125_0097520_885_1748	251
343	3300048929	Ga0496126_0014886	Ga0496126_0014886_2593_3456	251
344	3300049569	Ga0501032_0191604	Ga0501032_0191604_40_906	251
345	3300049586	Ga0501070_0035531	Ga0501070_0035531_906_1769	251
346	3300049587	Ga0501071_0012632	Ga0501071_0012632_4187_5053	251
347	3300050492	nmdc:mga0yw44_1730_c1	nmdc:mga0yw44_1730_c1_1966_2835	251
348	3300050515	nmdc:mga0a205_934_c1	nmdc:mga0a205_934_c1_3407_4297	251
349	3300053077	Ga0495601_0000034	Ga0495601_0000034_22999_23868	251
350	3300053077	Ga0495601_0004052	Ga0495601_0004052_66_935	251
351	3300053077	Ga0495601_0069438	Ga0495601_0069438_210_1076	251
352	3300053077	Ga0495601_0081702	Ga0495601_0081702_646_1509	251
353	3300053077	Ga0495601_0139051	Ga0495601_0139051_444_1310	251
354	3300053078	Ga0495612_0007489	Ga0495612_0007489_847_1710	251
355	3300053083	Ga0495655_0000006	Ga0495655_0000006_173365_174228	251
356	3300053085	Ga0495619_0000008	Ga0495619_0000008_235027_235890	251
357	3300053085	Ga0495619_0000037	Ga0495619_0000037_25956_26819	251
358	3300053085	Ga0495619_0000769	Ga0495619_0000769_15212_16078	251
359	3300053085	Ga0495619_0002670	Ga0495619_0002670_9224_10090	251
360	3300053094	Ga0500566_0000850	Ga0500566_0000850_5531_6394	251
361	3300053096	Ga0500641_0066969	Ga0500641_0066969_580_1446	251
362	3300053119	Ga0500595_024547	Ga0500595_024547_292_1155	251
363	3300053129	Ga0500628_000001	Ga0500628_000001_470073_470936	251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

21

284

0.93 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4hno-assembly1.cif.gz_A	high resolution crystal structure of dna apurinic/apyrimidinic (ap) endonuclease iv nfo from thermatoga maritima	0.9255	1	244
2nqj-assembly1.cif.gz_A	crystal structure of escherichia coli endonuclease iv (endo iv) e261q mutant bound to damaged dna	0.912	1	241
2nq9-assembly1.cif.gz_A	high resolution crystal structure of escherichia coli endonuclease iv (endo iv) y72a mutant bound to damaged dna	0.9091	1	241
1qum-assembly1.cif.gz_A	crystal structure of escherichia coli endonuclease iv in complex with damaged dna	0.9077	1	241
4k1g-assembly2.cif.gz_B	structure of e. coli nfo(endo iv)-h69a mutant bound to a cleaved dna duplex containing a alphada:t basepair	0.9049	1	241

ID	Description	Score	Start	End	Superfamily
af_A0A2R8Q599_47_340_3.20.20.150	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes	0.9343	1	241	3.20.20.150
af_Q10002_117_395_3.20.20.150	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes	0.9233	1	241	3.20.20.150
2x7wA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes	0.9231	1	244	3.20.20.150
af_Q966U0_262_539_3.20.20.150	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes	0.9231	1	241	3.20.20.150
af_P50525_6_280_3.20.20.150	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes	0.9172	1	241	3.20.20.150

ID	Description	Score	Start	End	GO Terms
AF-A0A537YPV9-F1-model_v4	Probable endonuclease 4 (EC 3.1.21.2) (Endodeoxyribonuclease IV) (Endonuclease IV)	0.9909	1	251	GO:0003677 GO:0003906 GO:0006284 GO:0008081 GO:0008270 GO:0008833
AF-A0A537YPV9-F1-model_v4	Probable endonuclease 4 (EC 3.1.21.2) (Endodeoxyribonuclease IV) (Endonuclease IV)	0.987	1	251	GO:0003677 GO:0003906 GO:0006284 GO:0008081 GO:0008270 GO:0008833
AF-A0A838CYH5-F1-model_v4	Probable endonuclease 4 (EC 3.1.21.2) (Endodeoxyribonuclease IV) (Endonuclease IV)	0.9835	1	250	GO:0003677 GO:0003906 GO:0006284 GO:0008081 GO:0008270 GO:0008833
AF-A0A538EXX9-F1-model_v4	Probable endonuclease 4 (EC 3.1.21.2) (Endodeoxyribonuclease IV) (Endonuclease IV)	0.9758	1	249	GO:0003677 GO:0003906 GO:0006284 GO:0008081 GO:0008270 GO:0008833
AF-A0A838CYH5-F1-model_v4	Probable endonuclease 4 (EC 3.1.21.2) (Endodeoxyribonuclease IV) (Endonuclease IV)	0.9757	1	250	GO:0003677 GO:0003906 GO:0006284 GO:0008081 GO:0008270 GO:0008833

Feature Viewer

pLDDT	pTM	Quality
94.18	0.91	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F423080

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

21

284

0.93

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map