F423074

General Info

Members Datasets Scaffolds Average Seq Length
363 241 726 322

Family's Representative Sequence

Representative Sequence 3300046517|Ga0495630_0109736|Ga0495630_0109736_539_1636
Length 365
Sequence MAELDHKAVMRPKPPSWPYQRHGDWNSFGAFQGRHAMKIPRRQFLRLTAGAAALPAFSRVVSAQTYPTRPITIVLSFAAGGSGDTIARILAERMRISLGQPIIIENVSGASGSVGVGRVAHAKPDGYTLSFGNWATHVLNGAVLSLQYDVLNDFEPISLLVTESMLIVGRRTLPASDLKGLIGWLQANPGKASAGTNGAGSVPHVVGVFFQKETGTHFQFIPYRGAGPAMQDLVAGQIDLMIDLSANSLPQARAGTIKTYAVTAKRRLAAAPDIPTVDEGGLPGFYASNWRGLWAPKGTPNTIIAKLNGAVVDALADPAVRERLAGLGQQIPLREQQTPEALSTLQTAEINKWWPIIKAANIKPE

Samples

Sample ID Description Type Environment
1 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
130 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
131 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
132 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
133 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
136 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
137 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
138 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
139 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
220 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
223 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
233 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
236 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
237 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
238 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
239 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.96
Nodule 0
Rhizoplane 4.96
Rhizosphere 88.71
Stem 0
Stem Tuber 0
Unclassified 1.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495630_0109736 3300046517 Bacteria 2090
2 JGI25406J46586_10021068 3300003203 Bacteria 2623
3 Ga0070676_10035087 3300005328 Bacteria 2883
4 Ga0070690_100032824 3300005330 Bacteria 3245
5 Ga0070670_100049741 3300005331 Bacteria 3604
6 Ga0068869_100093538 3300005334 Bacteria 2265
7 Ga0070682_100080581 3300005337 Bacteria 2106
8 Ga0068868_100186242 3300005338 Bacteria 1725
9 Ga0070660_100021023 3300005339 Bacteria 4805
10 Ga0070689_100009743 3300005340 Bacteria 6821
11 Ga0070689_100258042 3300005340 Bacteria 1440
12 Ga0070691_10085828 3300005341 Bacteria 1546
13 Ga0070687_100095248 3300005343 Bacteria 1655
14 Ga0070668_100432439 3300005347 Bacteria 1128
15 Ga0070671_100051541 3300005355 Bacteria 3423
16 Ga0070671_100059735 3300005355 Bacteria 3173
17 Ga0070673_100086877 3300005364 Bacteria 2548
18 Ga0070673_100391639 3300005364 Bacteria 1241
19 Ga0070688_100004948 3300005365 Bacteria 6971
20 Ga0070688_100044087 3300005365 Bacteria 2751
21 Ga0070667_100078970 3300005367 Bacteria 2812
22 Ga0070667_100267888 3300005367 Bacteria 1531
23 Ga0070714_100027661 3300005435 Bacteria 4698
24 Ga0070713_100082784 3300005436 Bacteria 2741
25 Ga0070713_100211290 3300005436 Bacteria 1757
26 Ga0070710_10076203 3300005437 Bacteria 1946
27 Ga0070701_10001332 3300005438 Bacteria 9095
28 Ga0070711_100026439 3300005439 Bacteria 3804
29 Ga0070711_100080845 3300005439 Bacteria 2315
30 Ga0070711_100084894 3300005439 Bacteria 2266
31 Ga0070711_100089004 3300005439 Bacteria 2220
32 Ga0070700_100182357 3300005441 Bacteria 1462
33 Ga0070694_100021932 3300005444 Bacteria 4087
34 Ga0070694_100092600 3300005444 Bacteria 2124
35 Ga0070694_100264117 3300005444 Bacteria 1307
36 Ga0070708_100527207 3300005445 Bacteria 1114
37 Ga0070663_100054401 3300005455 Plasmid 2861
38 Ga0070663_100066490 3300005455 Bacteria 2612
39 Ga0070678_100055123 3300005456 Bacteria 2901
40 Ga0070662_100017507 3300005457 Bacteria 4833
41 Ga0070681_10007418 3300005458 Bacteria 10725
42 Ga0068867_100025316 3300005459 Bacteria 4257
43 Ga0070685_10234392 3300005466 Bacteria 1209
44 Ga0070679_100016518 3300005530 Bacteria 7124
45 Ga0070679_100132292 3300005530 Bacteria 2476
46 Ga0070684_100061626 3300005535 Bacteria 3283
47 Ga0068853_100030899 3300005539 Bacteria 4526
48 Ga0068853_100098733 3300005539 Bacteria 2579
49 Ga0070672_100092443 3300005543 Bacteria 2442
50 Ga0070686_100261163 3300005544 Bacteria 1269
51 Ga0070693_100090315 3300005547 Bacteria 1845
52 Ga0070665_100460201 3300005548 Bacteria 1282
53 Ga0070704_100088159 3300005549 Bacteria 2305
54 Ga0070704_100223288 3300005549 Bacteria 1533
55 Ga0070664_100029739 3300005564 Bacteria 4555
56 Ga0070664_100182098 3300005564 Bacteria 1868
57 Ga0068857_100125398 3300005577 Bacteria 2314
58 Ga0068856_100056539 3300005614 Bacteria 3871
59 Ga0068852_100058688 3300005616 Bacteria 3334
60 Ga0068859_100019646 3300005617 Bacteria 6786
61 Ga0068859_100283347 3300005617 Bacteria 1750
62 Ga0068866_10018193 3300005718 Bacteria 3173
63 Ga0068866_10163767 3300005718 Bacteria 1299
64 Ga0068861_100249669 3300005719 Bacteria 1513
65 Ga0068870_10016907 3300005840 Bacteria 3497
66 Ga0068863_100256851 3300005841 Bacteria 1689
67 Ga0068858_100119096 3300005842 Bacteria 2468
68 Ga0068860_100144358 3300005843 Bacteria 2289
69 Ga0081455_10006012 3300005937 Bacteria 13150
70 Ga0081455_10015949 3300005937 Bacteria 7273
71 Ga0081455_10056575 3300005937 Bacteria 3329
72 Ga0081538_10010075 3300005981 Bacteria 7790
73 Ga0081538_10010191 3300005981 Bacteria 7723
74 Ga0081540_1019107 3300005983 Bacteria 4180
75 Ga0081539_10001727 3300005985 Bacteria 34927
76 Ga0070717_10187915 3300006028 Bacteria 1804
77 Ga0075365_10006145 3300006038 Bacteria 6571
78 Ga0075368_10022682 3300006042 Bacteria 2391
79 Ga0070716_100015738 3300006173 Bacteria 3892
80 Ga0070712_100122319 3300006175 Bacteria 1960
81 Ga0070712_100193323 3300006175 Bacteria 1594
82 Ga0075367_10002815 3300006178 Bacteria 8075
83 Ga0097621_100044261 3300006237 Bacteria 3591
84 Ga0075428_100191522 3300006844 Bacteria 2212
85 Ga0075428_100280506 3300006844 Bacteria 1793
86 Ga0075428_100350582 3300006844 Bacteria 1584
87 Ga0075430_100001118 3300006846 Bacteria 21363
88 Ga0075430_100232231 3300006846 Bacteria 1529
89 Ga0075431_100083216 3300006847 Bacteria 3303
90 Ga0075431_100249080 3300006847 Bacteria 1805
91 Ga0075434_100111192 3300006871 Bacteria 2750
92 Ga0075434_100435651 3300006871 Bacteria 1332
93 Ga0075429_100042364 3300006880 Bacteria 3962
94 Ga0068865_100014271 3300006881 Bacteria 5045
95 Ga0097620_100019648 3300006931 Bacteria 6786
96 Ga0097620_100283330 3300006931 Bacteria 1750
97 Ga0075435_100001029 3300007076 Bacteria 17685
98 Ga0075435_100197751 3300007076 Bacteria 1703
99 Ga0099794_10006709 3300007265 Bacteria 4677
100 Ga0105245_10521655 3300009098 Bacteria 1207
101 Ga0105247_10011367 3300009101 Bacteria 5368
102 Ga0114129_10527990 3300009147 Bacteria 1538
103 Ga0105243_10079421 3300009148 Bacteria 2674
104 Ga0105242_10139763 3300009176 Bacteria 2100
105 Ga0105248_10227774 3300009177 Bacteria 2098
106 Ga0105237_10057758 3300009545 Bacteria 3883
107 Ga0105237_10068875 3300009545 Bacteria 3533
108 Ga0105238_10042782 3300009551 Bacteria 4585
109 Ga0105249_10114253 3300009553 Bacteria 2556
110 Ga0105249_10147260 3300009553 Bacteria 2263
111 Ga0099796_10001797 3300010159 Bacteria 4491
112 Ga0105239_10049457 3300010375 Bacteria 4610
113 Ga0157378_10358852 3300013297 Bacteria 1426
114 Ga0163162_10016312 3300013306 Bacteria 7262
115 Ga0163162_10043239 3300013306 Plasmid 4511
116 Ga0163162_10101978 3300013306 Bacteria 2963
117 Ga0163162_10182057 3300013306 Bacteria 2227
118 Ga0157375_10030588 3300013308 Bacteria 5079
119 Ga0182008_10000055 3300014497 Bacteria 102214
120 Ga0163161_10058225 3300017792 Bacteria 2809
121 Ga0213876_10068696 3300021384 Bacteria 1872
122 Ga0207656_10048909 3300025321 Bacteria 1822
123 Ga0207688_10017760 3300025901 Bacteria 3870
124 Ga0207680_10006283 3300025903 Bacteria 5731
125 Ga0207685_10071921 3300025905 Bacteria 1404
126 Ga0207645_10107873 3300025907 Bacteria 1801
127 Ga0207643_10000387 3300025908 Bacteria 29359
128 Ga0207695_10065811 3300025913 Bacteria 3725
129 Ga0207693_10115803 3300025915 Bacteria 2104
130 Ga0207693_10152482 3300025915 Bacteria 1818
131 Ga0207663_10020470 3300025916 Bacteria 3746
132 Ga0207663_10066544 3300025916 Bacteria 2307
133 Ga0207663_10080322 3300025916 Bacteria 2132
134 Ga0207662_10108527 3300025918 Bacteria 1728
135 Ga0207657_10012115 3300025919 Bacteria 8522
136 Ga0207681_10212817 3300025923 Bacteria 1491
137 Ga0207659_10004213 3300025926 Bacteria 8686
138 Ga0207700_10361376 3300025928 Bacteria 1266
139 Ga0207706_10017238 3300025933 Bacteria 6511
140 Ga0207706_10026491 3300025933 Bacteria 5189
141 Ga0207709_10055504 3300025935 Bacteria 2447
142 Ga0207670_10014021 3300025936 Bacteria 4744
143 Ga0207670_10187807 3300025936 Unclassified 1562
144 Ga0207691_10019612 3300025940 Bacteria 6398
145 Ga0207691_10074959 3300025940 Bacteria 3051
146 Ga0207711_10065290 3300025941 Bacteria 3146
147 Ga0207689_10002173 3300025942 Bacteria 18432
148 Ga0207661_10149768 3300025944 Bacteria 2016
149 Ga0207661_10152319 3300025944 Bacteria 2000
150 Ga0207679_10013361 3300025945 Bacteria 5381
151 Ga0207651_10037794 3300025960 Bacteria 3165
152 Ga0207712_10090842 3300025961 Bacteria 2248
153 Ga0207677_10180820 3300026023 Bacteria 1659
154 Ga0207639_10077124 3300026041 Bacteria 2626
155 Ga0207678_10025396 3300026067 Bacteria 5172
156 Ga0207678_10064999 3300026067 Plasmid 3134
157 Ga0207708_10002800 3300026075 Bacteria 12820
158 Ga0207641_10064345 3300026088 Bacteria 3134
159 Ga0207641_10088019 3300026088 Bacteria 2711
160 Ga0207641_10510363 3300026088 Bacteria 1168
161 Ga0207648_10009493 3300026089 Bacteria 9309
162 Ga0207675_100011919 3300026118 Bacteria 8123
163 Ga0207675_100134525 3300026118 Bacteria 2345
164 Ga0207675_100324624 3300026118 Bacteria 1503
165 Ga0207683_10032008 3300026121 Bacteria 4567
166 Ga0207683_10112684 3300026121 Bacteria 2436
167 Ga0207698_10235746 3300026142 Bacteria 1664
168 Ga0209813_10020198 3300027866 Bacteria 1861
169 Ga0268265_10063143 3300028380 Bacteria 2848
170 Ga0268264_10046612 3300028381 Bacteria 3601
171 Ga0268264_10222362 3300028381 Bacteria 1739
172 Ga0265338_10024590 3300028800 Bacteria 6147
173 Ga0265338_10047131 3300028800 Bacteria 3940
174 Ga0265760_10018659 3300031090 Bacteria 1998
175 Ga0265760_10019495 3300031090 Bacteria 1954
176 Ga0265330_10034273 3300031235 Bacteria 2267
177 Ga0265325_10002243 3300031241 Bacteria 13104
178 Ga0265325_10005264 3300031241 Bacteria 8028
179 Ga0265325_10006660 3300031241 Bacteria 6988
180 Ga0265325_10037413 3300031241 Bacteria 2565
181 Ga0265339_10000067 3300031249 Bacteria 91730
182 Ga0265313_10000054 3300031595 Bacteria 110199
183 Ga0265313_10039834 3300031595 Bacteria 2328
184 Ga0265342_10015758 3300031712 Bacteria 4963
185 Ga0265342_10038094 3300031712 Bacteria 2930
186 Ga0373926_0039315 3300035083 Bacteria 1686
187 Ga0373934_0011141 3300035086 Bacteria 3384
188 Ga0373923_0015033 3300035111 Bacteria 2916
189 Ga0373936_0115990 3300035113 Unclassified 1140
190 Ga0373945_0051556 3300035116 Bacteria 1514
191 Ga0373953_0025531 3300035117 Bacteria 2258
192 Ga0373954_0000012 3300035118 Bacteria 73616
193 Ga0373954_0002020 3300035118 Bacteria 8429
194 Ga0373956_0005909 3300035119 Bacteria 4895
195 Ga0373957_0013779 3300035120 Bacteria 2751
196 Ga0373943_0165927 3300035170 Bacteria 1205
197 Ga0373946_0025376 3300035171 Bacteria 2330
198 Ga0373955_0000403 3300035172 Bacteria 18347
199 Ga0373955_0018676 3300035172 Bacteria 3453
200 Ga0373955_0225432 3300035172 Bacteria 1120
201 Ga0373924_0017222 3300035410 Bacteria 2768
202 Ga0373931_0088836 3300035691 Bacteria 1718
203 Ga0373931_0101781 3300035691 Bacteria 1617
204 Ga0373931_0242524 3300035691 Bacteria 1093
205 Ga0373935_0000352 3300035692 Bacteria 23400
206 Ga0373935_0116506 3300035692 Bacteria 1779
207 Ga0373935_0153444 3300035692 Bacteria 1565
208 Ga0373927_0026565 3300035695 Bacteria 3784
209 Ga0373927_0038170 3300035695 Bacteria 3119
210 Ga0373927_0264364 3300035695 Bacteria 1131
211 Ga0373933_0004315 3300035724 Bacteria 7806
212 Ga0373933_0004495 3300035724 Bacteria 7650
213 Ga0373933_0029206 3300035724 Bacteria 3186
214 Ga0373947_0002161 3300035725 Bacteria 11951
215 Ga0373947_0037575 3300035725 Bacteria 2874
216 Ga0373937_0000068 3300036401 Bacteria 94138
217 Ga0373937_0001834 3300036401 Bacteria 17852
218 Ga0373937_0010762 3300036401 Bacteria 8005
219 Ga0373937_0010797 3300036401 Bacteria 7994
220 Ga0373937_0047360 3300036401 Bacteria 3934
221 Ga0373937_0221125 3300036401 Bacteria 1783
222 Ga0373937_0221379 3300036401 Bacteria 1781
223 Ga0373937_0886578 3300036401 Bacteria 841
224 Ga0373925_0000295 3300037068 Bacteria 52150
225 Ga0373925_0019033 3300037068 Bacteria 4992
226 Ga0436365_1404983 3300039437 Bacteria 1135
227 Ga0436365_1756574 3300039437 Bacteria 5293
228 Ga0436365_1825469 3300039437 Bacteria 4852
229 Ga0436361_0639576 3300039447 Unclassified 1714
230 Ga0439453_0003681 3300041408 Bacteria 2224
231 Ga0466957_0107591 3300044842 Bacteria 1765
232 Ga0466960_0069673 3300044901 Bacteria 1748
233 Ga0466967_0555135 3300045976 Bacteria 1131
234 Ga0495592_0000793 3300046454 Bacteria 21835
235 Ga0495629_0009751 3300046459 Bacteria 7008
236 Ga0495629_0087928 3300046459 Bacteria 2168
237 Ga0495651_0001226 3300046462 Bacteria 19830
238 Ga0495653_0000947 3300046463 Bacteria 22293
239 Ga0495662_0004037 3300046476 Bacteria 7392
240 Ga0495662_0037824 3300046476 Bacteria 2331
241 Ga0495664_0000060 3300046477 Bacteria 52213
242 Ga0495608_0000308 3300046511 Bacteria 34379
243 Ga0495608_0017885 3300046511 Bacteria 4899
244 Ga0495618_0000792 3300046514 Bacteria 22077
245 Ga0495620_0072357 3300046515 Bacteria 1408
246 Ga0495628_0000005 3300046516 Bacteria 420969
247 Ga0495628_0000915 3300046516 Bacteria 27087
248 Ga0495628_0083254 3300046516 Bacteria 2484
249 Ga0495628_0381667 3300046516 Bacteria 1032
250 Ga0495630_0002182 3300046517 Bacteria 13641
251 Ga0495630_0009553 3300046517 Bacteria 6974
252 Ga0495632_0134009 3300046519 Bacteria 1152
253 Ga0495642_0062385 3300046528 Bacteria 1548
254 Ga0495652_0000897 3300046529 Bacteria 34143
255 Ga0495652_0181985 3300046529 Bacteria 1612
256 Ga0495640_0000027 3300046533 Bacteria 90638
257 Ga0495640_0004201 3300046533 Bacteria 11521
258 Ga0495640_0081577 3300046533 Bacteria 2149
259 Ga0495587_0000230 3300046536 Bacteria 41395
260 Ga0495587_0051827 3300046536 Bacteria 2424
261 Ga0495645_0000239 3300046543 Bacteria 40105
262 Ga0495667_0000660 3300046559 Bacteria 22055
263 Ga0495667_0017502 3300046559 Bacteria 4840
264 Ga0495634_0000696 3300046642 Bacteria 32694
265 Ga0495635_0000019 3300046663 Bacteria 193402
266 Ga0495659_0013093 3300046664 Bacteria 2699
267 Ga0495657_0002171 3300046675 Bacteria 16643
268 Ga0495599_0000051 3300046678 Bacteria 81853
269 Ga0495599_0011231 3300046678 Bacteria 5499
270 Ga0495623_0003794 3300046679 Bacteria 9955
271 Ga0495646_0000711 3300046680 Bacteria 18442
272 Ga0495658_0024991 3300046683 Bacteria 3189
273 Ga0495669_0120535 3300046684 Bacteria 1229
274 Ga0495613_0010194 3300046689 Bacteria 6980
275 Ga0495613_0013580 3300046689 Bacteria 6046
276 Ga0495624_0013105 3300046690 Bacteria 5654
277 Ga0495624_0115152 3300046690 Bacteria 1653
278 Ga0495600_0001448 3300046809 Bacteria 13154
279 Ga0495600_0002457 3300046809 Bacteria 10633
280 Ga0495581_0039781 3300047315 Bacteria 2722
281 Ga0495604_0000507 3300047317 Bacteria 34224
282 Ga0495604_0003656 3300047317 Bacteria 12254
283 Ga0495674_0000580 3300047319 Bacteria 34223
284 Ga0495674_0250444 3300047319 Bacteria 1458
285 Ga0495680_0000216 3300047322 Bacteria 62986
286 Ga0495680_0001925 3300047322 Bacteria 21809
287 Ga0495680_0053230 3300047322 Bacteria 3151
288 Ga0495675_0003127 3300047444 Bacteria 9936
289 Ga0495684_0001079 3300047471 Bacteria 22061
290 Ga0495684_0050332 3300047471 Bacteria 3182
291 Ga0495593_0006137 3300047673 Bacteria 7069
292 Ga0495593_0123842 3300047673 Bacteria 1315
293 Ga0495602_0001686 3300048088 Bacteria 22004
294 Ga0495602_0162402 3300048088 Bacteria 1743
295 Ga0495602_0167167 3300048088 Unclassified 1711
296 Ga0495602_0254943 3300048088 Bacteria 1305
297 Ga0496101_0052758 3300048904 Bacteria 2932
298 Ga0496101_0354019 3300048904 Bacteria 1154
299 Ga0496102_0012612 3300048905 Bacteria 7321
300 Ga0496103_0015773 3300048906 Bacteria 4503
301 Ga0496104_0288795 3300048907 Bacteria 1552
302 Ga0496105_0034973 3300048908 Bacteria 4134
303 Ga0496105_0086799 3300048908 Bacteria 2586
304 Ga0496106_0195090 3300048909 Bacteria 1611
305 Ga0496107_0018756 3300048910 Bacteria 4874
306 Ga0496108_0009811 3300048911 Bacteria 7756
307 Ga0496108_0050311 3300048911 Bacteria 3488
308 Ga0496109_0082922 3300048912 Bacteria 2956
309 Ga0496111_0041830 3300048914 Bacteria 3289
310 Ga0496112_0028291 3300048915 Bacteria 5409
311 Ga0496112_0175198 3300048915 Bacteria 2110
312 Ga0496113_0019790 3300048916 Bacteria 4717
313 Ga0496114_0093337 3300048917 Bacteria 2558
314 Ga0496114_0214743 3300048917 Bacteria 1688
315 Ga0496121_0004986 3300048924 Bacteria 17384
316 Ga0501032_0077487 3300049569 Bacteria 2213
317 Ga0501033_0139844 3300049570 Bacteria 1750
318 Ga0501034_0078722 3300049571 Bacteria 3300
319 Ga0501034_0284603 3300049571 Bacteria 1592
320 Ga0501038_0164466 3300049574 Bacteria 1801
321 Ga0501039_0061809 3300049575 Bacteria 2901
322 Ga0501041_0179117 3300049577 Bacteria 1327
323 Ga0501047_0326086 3300049581 Bacteria 1374
324 Ga0501067_0093120 3300049583 Bacteria 1673
325 Ga0501067_0221065 3300049583 Bacteria 1055
326 Ga0501076_0112402 3300049592 Bacteria 2203
327 Ga0501035_0010333 3300049822 Bacteria 8657
328 Ga0501044_0006454 3300049823 Bacteria 12954
329 nmdc:mga00v17_235889_c1 3300050491 Bacteria 1186
330 nmdc:mga0yw44_24061_c1 3300050492 Bacteria 3441
331 nmdc:mga0yw44_8923_c1 3300050492 Bacteria 5030
332 nmdc:mga0k408_168826_c1 3300050493 Bacteria 1304
333 nmdc:mga0k408_86856_c1 3300050493 Bacteria 1836
334 nmdc:mga06z11_1216_c1 3300050494 Bacteria 9498
335 nmdc:mga04h51_40040_c1 3300050495 Bacteria 1525
336 nmdc:mga09592_256313_c1 3300050508 Bacteria 1516
337 nmdc:mga09592_35801_c1 3300050508 Bacteria 4157
338 nmdc:mga0qj67_22253_c1 3300050509 Bacteria 4869
339 nmdc:mga0qj67_223439_c1 3300050509 Bacteria 1529
340 nmdc:mga0qj67_9392_c1 3300050509 Bacteria 7277
341 nmdc:mga06r32_32195_c1 3300050510 Bacteria 4931
342 nmdc:mga06r32_32432_c1 3300050510 Bacteria 4915
343 nmdc:mga0n895_143851_c1 3300050512 Bacteria 2414
344 nmdc:mga0rr50_7516_c1 3300050513 Bacteria 6727
345 nmdc:mga0a205_13487_c1 3300050515 Bacteria 7609
346 nmdc:mga0sz30_1811_c1 3300050516 Bacteria 7599
347 Ga0495601_0000146 3300053077 Bacteria 40193
348 Ga0495601_0066251 3300053077 Bacteria 2299
349 Ga0495601_0085535 3300053077 Bacteria 2026
350 Ga0495612_0000030 3300053078 Bacteria 81917
351 Ga0495595_0000098 3300053084 Bacteria 39925
352 Ga0495595_0071420 3300053084 Bacteria 1641
353 Ga0495619_0000238 3300053085 Bacteria 40071
354 Ga0495619_0034170 3300053085 Bacteria 3305
355 Ga0500641_0003246 3300053096 Bacteria 5749
356 Ga0500562_016950 3300053108 Bacteria 1875
357 Ga0500595_031742 3300053119 Bacteria 1769
358 Ga0500652_000010 3300053131 Bacteria 162810
359 Ga0500652_063926 3300053131 Bacteria 1519
360 Ga0500627_0129728 3300053158 Bacteria 1139
361 Ga0501082_0000007 3300060353 Bacteria 126506
362 Ga0530510_0084067 3300061734 Bacteria 2318
363 Ga0530510_0130151 3300061734 Bacteria 1851
364 Ga0495630_0109736
365 JGI25406J46586_10021068
366 Ga0070676_10035087
367 Ga0070690_100032824
368 Ga0070670_100049741
369 Ga0068869_100093538
370 Ga0070682_100080581
371 Ga0068868_100186242
372 Ga0070660_100021023
373 Ga0070689_100009743
374 Ga0070689_100258042
375 Ga0070691_10085828
376 Ga0070687_100095248
377 Ga0070668_100432439
378 Ga0070671_100051541
379 Ga0070671_100059735
380 Ga0070673_100086877
381 Ga0070673_100391639
382 Ga0070688_100004948
383 Ga0070688_100044087
384 Ga0070667_100078970
385 Ga0070667_100267888
386 Ga0070714_100027661
387 Ga0070713_100082784
388 Ga0070713_100211290
389 Ga0070710_10076203
390 Ga0070701_10001332
391 Ga0070711_100026439
392 Ga0070711_100080845
393 Ga0070711_100084894
394 Ga0070711_100089004
395 Ga0070700_100182357
396 Ga0070694_100021932
397 Ga0070694_100092600
398 Ga0070694_100264117
399 Ga0070708_100527207
400 Ga0070663_100054401
401 Ga0070663_100066490
402 Ga0070678_100055123
403 Ga0070662_100017507
404 Ga0070681_10007418
405 Ga0068867_100025316
406 Ga0070685_10234392
407 Ga0070679_100016518
408 Ga0070679_100132292
409 Ga0070684_100061626
410 Ga0068853_100030899
411 Ga0068853_100098733
412 Ga0070672_100092443
413 Ga0070686_100261163
414 Ga0070693_100090315
415 Ga0070665_100460201
416 Ga0070704_100088159
417 Ga0070704_100223288
418 Ga0070664_100029739
419 Ga0070664_100182098
420 Ga0068857_100125398
421 Ga0068856_100056539
422 Ga0068852_100058688
423 Ga0068859_100019646
424 Ga0068859_100283347
425 Ga0068866_10018193
426 Ga0068866_10163767
427 Ga0068861_100249669
428 Ga0068870_10016907
429 Ga0068863_100256851
430 Ga0068858_100119096
431 Ga0068860_100144358
432 Ga0081455_10006012
433 Ga0081455_10015949
434 Ga0081455_10056575
435 Ga0081538_10010075
436 Ga0081538_10010191
437 Ga0081540_1019107
438 Ga0081539_10001727
439 Ga0070717_10187915
440 Ga0075365_10006145
441 Ga0075368_10022682
442 Ga0070716_100015738
443 Ga0070712_100122319
444 Ga0070712_100193323
445 Ga0075367_10002815
446 Ga0097621_100044261
447 Ga0075428_100191522
448 Ga0075428_100280506
449 Ga0075428_100350582
450 Ga0075430_100001118
451 Ga0075430_100232231
452 Ga0075431_100083216
453 Ga0075431_100249080
454 Ga0075434_100111192
455 Ga0075434_100435651
456 Ga0075429_100042364
457 Ga0068865_100014271
458 Ga0097620_100019648
459 Ga0097620_100283330
460 Ga0075435_100001029
461 Ga0075435_100197751
462 Ga0099794_10006709
463 Ga0105245_10521655
464 Ga0105247_10011367
465 Ga0114129_10527990
466 Ga0105243_10079421
467 Ga0105242_10139763
468 Ga0105248_10227774
469 Ga0105237_10057758
470 Ga0105237_10068875
471 Ga0105238_10042782
472 Ga0105249_10114253
473 Ga0105249_10147260
474 Ga0099796_10001797
475 Ga0105239_10049457
476 Ga0157378_10358852
477 Ga0163162_10016312
478 Ga0163162_10043239
479 Ga0163162_10101978
480 Ga0163162_10182057
481 Ga0157375_10030588
482 Ga0182008_10000055
483 Ga0163161_10058225
484 Ga0213876_10068696
485 Ga0207656_10048909
486 Ga0207688_10017760
487 Ga0207680_10006283
488 Ga0207685_10071921
489 Ga0207645_10107873
490 Ga0207643_10000387
491 Ga0207695_10065811
492 Ga0207693_10115803
493 Ga0207693_10152482
494 Ga0207663_10020470
495 Ga0207663_10066544
496 Ga0207663_10080322
497 Ga0207662_10108527
498 Ga0207657_10012115
499 Ga0207681_10212817
500 Ga0207659_10004213
501 Ga0207700_10361376
502 Ga0207706_10017238
503 Ga0207706_10026491
504 Ga0207709_10055504
505 Ga0207670_10014021
506 Ga0207670_10187807
507 Ga0207691_10019612
508 Ga0207691_10074959
509 Ga0207711_10065290
510 Ga0207689_10002173
511 Ga0207661_10149768
512 Ga0207661_10152319
513 Ga0207679_10013361
514 Ga0207651_10037794
515 Ga0207712_10090842
516 Ga0207677_10180820
517 Ga0207639_10077124
518 Ga0207678_10025396
519 Ga0207678_10064999
520 Ga0207708_10002800
521 Ga0207641_10064345
522 Ga0207641_10088019
523 Ga0207641_10510363
524 Ga0207648_10009493
525 Ga0207675_100011919
526 Ga0207675_100134525
527 Ga0207675_100324624
528 Ga0207683_10032008
529 Ga0207683_10112684
530 Ga0207698_10235746
531 Ga0209813_10020198
532 Ga0268265_10063143
533 Ga0268264_10046612
534 Ga0268264_10222362
535 Ga0265338_10024590
536 Ga0265338_10047131
537 Ga0265760_10018659
538 Ga0265760_10019495
539 Ga0265330_10034273
540 Ga0265325_10002243
541 Ga0265325_10005264
542 Ga0265325_10006660
543 Ga0265325_10037413
544 Ga0265339_10000067
545 Ga0265313_10000054
546 Ga0265313_10039834
547 Ga0265342_10015758
548 Ga0265342_10038094
549 Ga0373926_0039315
550 Ga0373934_0011141
551 Ga0373923_0015033
552 Ga0373936_0115990
553 Ga0373945_0051556
554 Ga0373953_0025531
555 Ga0373954_0000012
556 Ga0373954_0002020
557 Ga0373956_0005909
558 Ga0373957_0013779
559 Ga0373943_0165927
560 Ga0373946_0025376
561 Ga0373955_0000403
562 Ga0373955_0018676
563 Ga0373955_0225432
564 Ga0373924_0017222
565 Ga0373931_0088836
566 Ga0373931_0101781
567 Ga0373931_0242524
568 Ga0373935_0000352
569 Ga0373935_0116506
570 Ga0373935_0153444
571 Ga0373927_0026565
572 Ga0373927_0038170
573 Ga0373927_0264364
574 Ga0373933_0004315
575 Ga0373933_0004495
576 Ga0373933_0029206
577 Ga0373947_0002161
578 Ga0373947_0037575
579 Ga0373937_0000068
580 Ga0373937_0001834
581 Ga0373937_0010762
582 Ga0373937_0010797
583 Ga0373937_0047360
584 Ga0373937_0221125
585 Ga0373937_0221379
586 Ga0373937_0886578
587 Ga0373925_0000295
588 Ga0373925_0019033
589 Ga0436365_1404983
590 Ga0436365_1756574
591 Ga0436365_1825469
592 Ga0436361_0639576
593 Ga0439453_0003681
594 Ga0466957_0107591
595 Ga0466960_0069673
596 Ga0466967_0555135
597 Ga0495592_0000793
598 Ga0495629_0009751
599 Ga0495629_0087928
600 Ga0495651_0001226
601 Ga0495653_0000947
602 Ga0495662_0004037
603 Ga0495662_0037824
604 Ga0495664_0000060
605 Ga0495608_0000308
606 Ga0495608_0017885
607 Ga0495618_0000792
608 Ga0495620_0072357
609 Ga0495628_0000005
610 Ga0495628_0000915
611 Ga0495628_0083254
612 Ga0495628_0381667
613 Ga0495630_0002182
614 Ga0495630_0009553
615 Ga0495632_0134009
616 Ga0495642_0062385
617 Ga0495652_0000897
618 Ga0495652_0181985
619 Ga0495640_0000027
620 Ga0495640_0004201
621 Ga0495640_0081577
622 Ga0495587_0000230
623 Ga0495587_0051827
624 Ga0495645_0000239
625 Ga0495667_0000660
626 Ga0495667_0017502
627 Ga0495634_0000696
628 Ga0495635_0000019
629 Ga0495659_0013093
630 Ga0495657_0002171
631 Ga0495599_0000051
632 Ga0495599_0011231
633 Ga0495623_0003794
634 Ga0495646_0000711
635 Ga0495658_0024991
636 Ga0495669_0120535
637 Ga0495613_0010194
638 Ga0495613_0013580
639 Ga0495624_0013105
640 Ga0495624_0115152
641 Ga0495600_0001448
642 Ga0495600_0002457
643 Ga0495581_0039781
644 Ga0495604_0000507
645 Ga0495604_0003656
646 Ga0495674_0000580
647 Ga0495674_0250444
648 Ga0495680_0000216
649 Ga0495680_0001925
650 Ga0495680_0053230
651 Ga0495675_0003127
652 Ga0495684_0001079
653 Ga0495684_0050332
654 Ga0495593_0006137
655 Ga0495593_0123842
656 Ga0495602_0001686
657 Ga0495602_0162402
658 Ga0495602_0167167
659 Ga0495602_0254943
660 Ga0496101_0052758
661 Ga0496101_0354019
662 Ga0496102_0012612
663 Ga0496103_0015773
664 Ga0496104_0288795
665 Ga0496105_0034973
666 Ga0496105_0086799
667 Ga0496106_0195090
668 Ga0496107_0018756
669 Ga0496108_0009811
670 Ga0496108_0050311
671 Ga0496109_0082922
672 Ga0496111_0041830
673 Ga0496112_0028291
674 Ga0496112_0175198
675 Ga0496113_0019790
676 Ga0496114_0093337
677 Ga0496114_0214743
678 Ga0496121_0004986
679 Ga0501032_0077487
680 Ga0501033_0139844
681 Ga0501034_0078722
682 Ga0501034_0284603
683 Ga0501038_0164466
684 Ga0501039_0061809
685 Ga0501041_0179117
686 Ga0501047_0326086
687 Ga0501067_0093120
688 Ga0501067_0221065
689 Ga0501076_0112402
690 Ga0501035_0010333
691 Ga0501044_0006454
692 nmdc:mga00v17_235889_c1
693 nmdc:mga0yw44_24061_c1
694 nmdc:mga0yw44_8923_c1
695 nmdc:mga0k408_168826_c1
696 nmdc:mga0k408_86856_c1
697 nmdc:mga06z11_1216_c1
698 nmdc:mga04h51_40040_c1
699 nmdc:mga09592_256313_c1
700 nmdc:mga09592_35801_c1
701 nmdc:mga0qj67_22253_c1
702 nmdc:mga0qj67_223439_c1
703 nmdc:mga0qj67_9392_c1
704 nmdc:mga06r32_32195_c1
705 nmdc:mga06r32_32432_c1
706 nmdc:mga0n895_143851_c1
707 nmdc:mga0rr50_7516_c1
708 nmdc:mga0a205_13487_c1
709 nmdc:mga0sz30_1811_c1
710 Ga0495601_0000146
711 Ga0495601_0066251
712 Ga0495601_0085535
713 Ga0495612_0000030
714 Ga0495595_0000098
715 Ga0495595_0071420
716 Ga0495619_0000238
717 Ga0495619_0034170
718 Ga0500641_0003246
719 Ga0500562_016950
720 Ga0500595_031742
721 Ga0500652_000010
722 Ga0500652_063926
723 Ga0500627_0129728
724 Ga0501082_0000007
725 Ga0530510_0084067
726 Ga0530510_0130151

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

86

362

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.957 26 323
6hke-assembly1.cif.gz_A matc (rpa3494) from rhodopseudomonas palustris with bound malate 0.9523 26 317
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9514 25 325
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9506 29 325
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9483 25 325
ID Description Score Start End Superfamily
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9518 124 247 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9445 124 247 3.40.190.10
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9267 126 247 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9182 124 242 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9179 25 325 3.40.190.150
ID Description Score Start End GO Terms
AF-I3UD01-F1-model_v4 Extra-cytoplasmic solute receptor protein 0.9692 19 283
AF-A0A537FSS8-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9691 19 306
AF-A0A315FRH4-F1-model_v4 ABC transporter substrate-binding protein 0.9675 25 325
AF-A0A7X1P7V3-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.966 19 325
AF-A0A7V9LKZ4-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9659 19 311

Map