F422984

General Info

Members Datasets Scaffolds Average Seq Length
363 203 726 150

Family's Representative Sequence

Representative Sequence 3300025918|Ga0207662_10240778|Ga0207662_102407782
Length 181
Sequence MVRTLKGVMAIALLLGYAAAAQAAGLGKLTVTSALGQPLNAEIDLAPPQELGDTPQGRRRIINITGGSFRGERLSGRVLAGGADWQVIRGDGVADLDARYTLETSDGALIYVRNHGYRHGPADVLEELSSGKEVDPSLYYMRTTPLFETGDARYAWLNRLICVATGARRKTSVHLAIFEIQ

Samples

Sample ID Description Type Environment
1 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
104 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
105 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
107 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
108 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
109 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
110 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
111 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
119 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
120 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
121 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
122 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
123 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
124 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
125 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
126 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
134 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
139 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
140 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
141 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
144 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.65
Nodule 0
Rhizoplane 0
Rhizosphere 98.07
Stem 0
Stem Tuber 0
Unclassified 0.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207662_10240778 3300025918 Bacteria 1184
2 JGI25406J46586_10033290 3300003203 Bacteria 1905
3 rootH1_10028441 3300003323 Bacteria 3265
4 Ga0055536_1001115 3300003781 Bacteria 16861
5 Ga0055530_10007749 3300003791 Bacteria 4452
6 Ga0070676_10598993 3300005328 Bacteria 794
7 Ga0068869_100124237 3300005334 Bacteria 1977
8 Ga0070680_100047133 3300005336 Bacteria 3509
9 Ga0070680_100547722 3300005336 Bacteria 991
10 Ga0070689_100395618 3300005340 Bacteria 1167
11 Ga0070691_10137126 3300005341 Bacteria 1244
12 Ga0070687_100882180 3300005343 Bacteria 640
13 Ga0070692_10069618 3300005345 Bacteria 1872
14 Ga0070669_100036595 3300005353 Bacteria 3557
15 Ga0070675_101398689 3300005354 Bacteria 645
16 Ga0070673_100055889 3300005364 Bacteria 3112
17 Ga0070688_100212556 3300005365 Bacteria 1359
18 Ga0070710_10219571 3300005437 Bacteria 1209
19 Ga0070705_100005927 3300005440 Bacteria 5975
20 Ga0070705_100006315 3300005440 Bacteria 5805
21 Ga0070705_101063953 3300005440 Bacteria 660
22 Ga0070705_101109481 3300005440 Bacteria 648
23 Ga0070700_100007947 3300005441 Bacteria 5757
24 Ga0070700_100160742 3300005441 Bacteria 1546
25 Ga0070700_100666984 3300005441 Bacteria 823
26 Ga0070694_100003602 3300005444 Bacteria 9255
27 Ga0070694_100027153 3300005444 Bacteria 3717
28 Ga0070694_100097420 3300005444 Bacteria 2075
29 Ga0070694_100420808 3300005444 Bacteria 1049
30 Ga0070694_100484781 3300005444 Bacteria 982
31 Ga0068867_100005189 3300005459 Bacteria 9191
32 Ga0070706_100894919 3300005467 Bacteria 820
33 Ga0070707_100739603 3300005468 Bacteria 947
34 Ga0070698_100407656 3300005471 Bacteria 1293
35 Ga0070698_101059015 3300005471 Bacteria 759
36 Ga0070699_100132018 3300005518 Bacteria 2201
37 Ga0070697_100051654 3300005536 Bacteria 3340
38 Ga0070697_100318670 3300005536 Bacteria 1339
39 Ga0070672_100639249 3300005543 Bacteria 929
40 Ga0070695_100021073 3300005545 Bacteria 3985
41 Ga0070695_100088257 3300005545 Bacteria 2065
42 Ga0070695_100125324 3300005545 Bacteria 1763
43 Ga0070695_100240650 3300005545 Bacteria 1313
44 Ga0070695_100483339 3300005545 Bacteria 955
45 Ga0070696_100017358 3300005546 Bacteria 4857
46 Ga0070696_100114639 3300005546 Bacteria 1944
47 Ga0070696_100183678 3300005546 Bacteria 1553
48 Ga0070696_100394799 3300005546 Bacteria 1081
49 Ga0070696_100557025 3300005546 Bacteria 919
50 Ga0070696_100671933 3300005546 Bacteria 842
51 Ga0070696_100880641 3300005546 Bacteria 742
52 Ga0070693_100084794 3300005547 Bacteria 1897
53 Ga0070693_100097546 3300005547 Bacteria 1784
54 Ga0070704_100165753 3300005549 Bacteria 1752
55 Ga0070704_100527151 3300005549 Bacteria 1029
56 Ga0070704_101616809 3300005549 Bacteria 598
57 Ga0068857_101056467 3300005577 Bacteria 783
58 Ga0070702_100239862 3300005615 Bacteria 1223
59 Ga0068859_100973719 3300005617 Bacteria 931
60 Ga0068864_100607362 3300005618 Bacteria 1062
61 Ga0068866_10054498 3300005718 Bacteria 2049
62 Ga0068861_100007854 3300005719 Bacteria 7338
63 Ga0068870_10552399 3300005840 Bacteria 775
64 Ga0068860_101969024 3300005843 Bacteria 606
65 Ga0068862_100005942 3300005844 Bacteria 10167
66 Ga0068862_100674955 3300005844 Bacteria 999
67 Ga0081539_10000233 3300005985 Bacteria 130647
68 Ga0070715_10017730 3300006163 Bacteria 2700
69 Ga0070715_10582315 3300006163 Bacteria 653
70 Ga0070712_101291161 3300006175 Bacteria 636
71 Ga0075430_100002379 3300006846 Bacteria 15629
72 Ga0075430_100023970 3300006846 Bacteria 5196
73 Ga0075430_100121306 3300006846 Bacteria 2179
74 Ga0075430_100302299 3300006846 Bacteria 1323
75 Ga0075430_100492187 3300006846 Bacteria 1012
76 Ga0075431_100024526 3300006847 Bacteria 6181
77 Ga0075431_100160686 3300006847 Bacteria 2310
78 Ga0075431_100556626 3300006847 Bacteria 1134
79 Ga0075431_100577024 3300006847 Bacteria 1110
80 Ga0075433_10317334 3300006852 Bacteria 1379
81 Ga0075433_11516331 3300006852 Bacteria 579
82 Ga0075434_100000006 3300006871 Bacteria 96966
83 Ga0075434_100007265 3300006871 Bacteria 10248
84 Ga0075434_101051058 3300006871 Bacteria 828
85 Ga0075429_100074373 3300006880 Bacteria 2960
86 Ga0075429_100187705 3300006880 Bacteria 1811
87 Ga0075429_100222678 3300006880 Bacteria 1652
88 Ga0075429_100567944 3300006880 Bacteria 994
89 Ga0075436_100000174 3300006914 Bacteria 40099
90 Ga0075436_100015073 3300006914 Bacteria 5298
91 Ga0075436_100203244 3300006914 Bacteria 1403
92 Ga0075436_100239639 3300006914 Bacteria 1290
93 Ga0097620_100973617 3300006931 Bacteria 931
94 Ga0075435_100008433 3300007076 Bacteria 7396
95 Ga0075435_100134916 3300007076 Bacteria 2067
96 Ga0075435_100139644 3300007076 Bacteria 2032
97 Ga0111539_10031454 3300009094 Bacteria 6446
98 Ga0111539_10111209 3300009094 Bacteria 3214
99 Ga0111539_10766119 3300009094 Bacteria 1123
100 Ga0111539_12145935 3300009094 Bacteria 648
101 Ga0114129_10014850 3300009147 Bacteria 11097
102 Ga0114129_10291977 3300009147 Bacteria 2175
103 Ga0114129_10465766 3300009147 Bacteria 1656
104 Ga0114129_10475514 3300009147 Bacteria 1636
105 Ga0114129_10877862 3300009147 Bacteria 1138
106 Ga0105243_10052058 3300009148 Bacteria 3241
107 Ga0105243_10779246 3300009148 Bacteria 940
108 Ga0105249_10004544 3300009553 Bacteria 11989
109 Ga0163162_10974922 3300013306 Bacteria 958
110 Ga0157372_10364935 3300013307 Bacteria 1683
111 Ga0157375_10582061 3300013308 Bacteria 1279
112 Ga0157380_10056755 3300014326 Bacteria 3116
113 Ga0209758_1000237 3300025297 Bacteria 115867
114 Ga0209050_1016440 3300025298 Bacteria 3027
115 Ga0209051_1007804 3300025303 Bacteria 5781
116 Ga0209257_1074576 3300025304 Bacteria 885
117 Ga0207692_10038640 3300025898 Bacteria 2342
118 Ga0207692_10571962 3300025898 Bacteria 724
119 Ga0207685_10315454 3300025905 Bacteria 778
120 Ga0207645_10048896 3300025907 Bacteria 2701
121 Ga0207643_10059694 3300025908 Bacteria 2176
122 Ga0207684_10920539 3300025910 Bacteria 734
123 Ga0207660_10024914 3300025917 Bacteria 4055
124 Ga0207660_10208981 3300025917 Bacteria 1527
125 Ga0207652_10792327 3300025921 Bacteria 842
126 Ga0207646_10126108 3300025922 Bacteria 2302
127 Ga0207646_10911149 3300025922 Bacteria 780
128 Ga0207681_11489288 3300025923 Bacteria 567
129 Ga0207659_10973435 3300025926 Bacteria 730
130 Ga0207686_11271179 3300025934 Bacteria 604
131 Ga0207709_10035534 3300025935 Bacteria 2947
132 Ga0207704_10974500 3300025938 Bacteria 716
133 Ga0207691_10077489 3300025940 Bacteria 2995
134 Ga0207689_10116099 3300025942 Bacteria 2200
135 Ga0207651_10021376 3300025960 Bacteria 3932
136 Ga0207712_10007146 3300025961 Bacteria 7043
137 Ga0207668_10037139 3300025972 Bacteria 3258
138 Ga0207708_10020652 3300026075 Bacteria 4967
139 Ga0207708_10186974 3300026075 Bacteria 1647
140 Ga0207708_10281280 3300026075 Bacteria 1348
141 Ga0207708_10342342 3300026075 Bacteria 1225
142 Ga0207708_10398759 3300026075 Bacteria 1137
143 Ga0207648_10006629 3300026089 Bacteria 11501
144 Ga0207648_11008002 3300026089 Bacteria 780
145 Ga0207648_11751582 3300026089 Bacteria 583
146 Ga0207676_11262951 3300026095 Bacteria 733
147 Ga0207675_100012507 3300026118 Bacteria 7928
148 Ga0207675_101390740 3300026118 Bacteria 722
149 Ga0209969_1015231 3300027360 Bacteria 1123
150 Ga0209996_1002430 3300027395 Bacteria 2308
151 Ga0209996_1003135 3300027395 Bacteria 2068
152 Ga0210000_1016402 3300027462 Bacteria 1119
153 Ga0209995_1026371 3300027471 Bacteria 969
154 Ga0209999_1014973 3300027543 Bacteria 1410
155 Ga0209971_1041101 3300027682 Bacteria 1113
156 Ga0209966_1001893 3300027695 Bacteria 3533
157 Ga0209998_10036851 3300027717 Bacteria 1100
158 Ga0207428_10142168 3300027907 Bacteria 1831
159 Ga0207428_10162887 3300027907 Bacteria 1693
160 Ga0207428_10468704 3300027907 Bacteria 917
161 Ga0268265_10037327 3300028380 Bacteria 3565
162 Ga0268265_10758558 3300028380 Bacteria 942
163 Ga0307408_100157761 3300031548 Bacteria 1799
164 Ga0307408_100159047 3300031548 Bacteria 1792
165 Ga0307408_102076540 3300031548 Bacteria 547
166 Ga0307405_10056816 3300031731 Bacteria 2456
167 Ga0307410_11593085 3300031852 Bacteria 577
168 Ga0307407_10095785 3300031903 Bacteria 1831
169 Ga0307412_10110343 3300031911 Bacteria 1963
170 Ga0307416_100065352 3300032002 Bacteria 2989
171 Ga0307416_100115301 3300032002 Bacteria 2379
172 Ga0307416_100166789 3300032002 Bacteria 2044
173 Ga0307411_10150653 3300032005 Bacteria 1728
174 Ga0307411_10510108 3300032005 Bacteria 1018
175 Ga0307411_10978834 3300032005 Bacteria 756
176 Ga0307411_11015259 3300032005 Bacteria 743
177 Ga0373934_0044658 3300035086 Bacteria 1752
178 Ga0373949_0191660 3300035090 Bacteria 610
179 Ga0373936_0053864 3300035113 Bacteria 1632
180 Ga0373936_0102406 3300035113 Bacteria 1209
181 Ga0373941_0150813 3300035115 Bacteria 853
182 Ga0373953_0022940 3300035117 Bacteria 2359
183 Ga0373953_0262512 3300035117 Bacteria 751
184 Ga0373954_0000020 3300035118 Bacteria 60211
185 Ga0373954_0213485 3300035118 Bacteria 949
186 Ga0373956_0176376 3300035119 Bacteria 1009
187 Ga0373957_0057916 3300035120 Bacteria 1495
188 Ga0373960_0285924 3300035121 Bacteria 609
189 Ga0373955_0067825 3300035172 Bacteria 1986
190 Ga0373935_1069540 3300035692 Bacteria 600
191 Ga0373935_1189433 3300035692 Bacteria 568
192 Ga0373927_0034885 3300035695 Bacteria 3272
193 Ga0373927_0539210 3300035695 Bacteria 771
194 Ga0373927_0632031 3300035695 Bacteria 708
195 Ga0373933_0002721 3300035724 Bacteria 9891
196 Ga0373933_0003747 3300035724 Bacteria 8401
197 Ga0373933_0320282 3300035724 Bacteria 1005
198 Ga0373937_0000179 3300036401 Bacteria 62280
199 Ga0373937_0024543 3300036401 Bacteria 5439
200 Ga0373937_0077492 3300036401 Bacteria 3072
201 Ga0373937_1248348 3300036401 Bacteria 691
202 Ga0373937_1709450 3300036401 Bacteria 576
203 Ga0373925_0017712 3300037068 Bacteria 5168
204 Ga0439453_0012590 3300041408 Bacteria 1426
205 Ga0439441_000937 3300042001 Bacteria 3551
206 Ga0439441_000951 3300042001 Bacteria 3531
207 Ga0439441_001626 3300042001 Bacteria 2999
208 Ga0439443_011979 3300042003 Bacteria 1278
209 Ga0439451_081698 3300042009 Bacteria 649
210 Ga0450896_055667 3300042133 Bacteria 637
211 Ga0439435_0014099 3300042436 Bacteria 1969
212 Ga0439444_0002090 3300042437 Bacteria 2687
213 Ga0439460_0000061 3300042461 Bacteria 15979
214 Ga0450893_0026978 3300042532 Bacteria 1011
215 Ga0466964_0047337 3300044706 Bacteria 1755
216 Ga0466968_0138344 3300044735 Bacteria 1112
217 Ga0451576_0177321 3300045051 Bacteria 2225
218 Ga0451576_0322217 3300045051 Bacteria 1617
219 Ga0451576_0519146 3300045051 Bacteria 1251
220 Ga0451576_0949472 3300045051 Bacteria 902
221 Ga0495592_0004466 3300046454 Bacteria 10234
222 Ga0495592_0202220 3300046454 Bacteria 1340
223 Ga0495629_0309309 3300046459 Bacteria 1081
224 Ga0495580_0827425 3300046472 Unclassified 599
225 Ga0495639_0145301 3300046475 Bacteria 1142
226 Ga0495639_0145880 3300046475 Bacteria 1140
227 Ga0495662_0016479 3300046476 Bacteria 3579
228 Ga0495664_0233134 3300046477 Bacteria 1114
229 Ga0495628_0071435 3300046516 Bacteria 2705
230 Ga0495630_0022606 3300046517 Bacteria 4645
231 Ga0495630_0032463 3300046517 Bacteria 3891
232 Ga0495666_0030001 3300046526 Bacteria 2672
233 Ga0495642_0247066 3300046528 Bacteria 780
234 Ga0495640_0030993 3300046533 Bacteria 3822
235 Ga0495640_0042600 3300046533 Bacteria 3165
236 Ga0495586_0038367 3300046535 Bacteria 2572
237 Ga0495586_0165483 3300046535 Bacteria 1248
238 Ga0495587_0029938 3300046536 Bacteria 3303
239 Ga0495609_0213677 3300046538 Bacteria 803
240 Ga0495621_0212098 3300046539 Bacteria 782
241 Ga0495667_0025112 3300046559 Bacteria 4017
242 Ga0495667_0056276 3300046559 Bacteria 2586
243 Ga0495668_0689251 3300046616 Bacteria 565
244 Ga0495634_0018787 3300046642 Bacteria 4915
245 Ga0495635_0031473 3300046663 Bacteria 3683
246 Ga0495635_0151989 3300046663 Bacteria 1576
247 Ga0495659_0080641 3300046664 Bacteria 1235
248 Ga0495658_0075947 3300046683 Bacteria 1962
249 Ga0495669_0045461 3300046684 Bacteria 1958
250 Ga0495613_0068295 3300046689 Bacteria 2592
251 Ga0495624_0056717 3300046690 Bacteria 2464
252 Ga0495600_0579850 3300046809 Unclassified 683
253 Ga0495604_0083055 3300047317 Bacteria 2394
254 Ga0495604_0270973 3300047317 Bacteria 1150
255 Ga0495636_0010391 3300047318 Bacteria 3676
256 Ga0495680_0066377 3300047322 Bacteria 2761
257 Ga0495675_0202613 3300047444 Bacteria 1207
258 Ga0495593_0050479 3300047673 Bacteria 2204
259 Ga0501031_0052651 3300049568 Bacteria 2652
260 Ga0501034_1085111 3300049571 Bacteria 682
261 Ga0501036_0004740 3300049572 Bacteria 10974
262 Ga0501036_0081152 3300049572 Bacteria 2741
263 Ga0501036_1119729 3300049572 Unclassified 643
264 Ga0501037_0002212 3300049573 Bacteria 14046
265 Ga0501038_0002844 3300049574 Bacteria 16106
266 Ga0501039_0001721 3300049575 Bacteria 16125
267 Ga0501039_0042247 3300049575 Bacteria 3522
268 Ga0501040_0000759 3300049576 Bacteria 20016
269 Ga0501040_0009670 3300049576 Bacteria 6295
270 Ga0501040_0880400 3300049576 Bacteria 648
271 Ga0501041_0000109 3300049577 Bacteria 34463
272 Ga0501041_0096304 3300049577 Bacteria 1829
273 Ga0501042_0001562 3300049578 Bacteria 13545
274 Ga0501042_0049313 3300049578 Bacteria 3003
275 Ga0501046_0001303 3300049580 Bacteria 24159
276 Ga0501046_0028243 3300049580 Bacteria 4571
277 Ga0501046_0928873 3300049580 Bacteria 606
278 Ga0501047_0078567 3300049581 Bacteria 3173
279 Ga0501048_0000190 3300049582 Bacteria 39467
280 Ga0501048_0006966 3300049582 Bacteria 8589
281 Ga0501048_0159177 3300049582 Bacteria 1598
282 Ga0501067_0267033 3300049583 Bacteria 953
283 Ga0501068_1022717 3300049584 Bacteria 545
284 Ga0501069_0664222 3300049585 Bacteria 628
285 Ga0501070_0665808 3300049586 Bacteria 825
286 Ga0501071_0006303 3300049587 Bacteria 7698
287 Ga0501071_0264854 3300049587 Bacteria 1298
288 Ga0501072_0000763 3300049588 Bacteria 23454
289 Ga0501072_0041941 3300049588 Bacteria 3594
290 Ga0501072_0140661 3300049588 Bacteria 1924
291 Ga0501073_0254112 3300049589 Bacteria 1213
292 Ga0501074_0141876 3300049590 Bacteria 1718
293 Ga0501075_0000840 3300049591 Bacteria 19361
294 Ga0501075_0000926 3300049591 Bacteria 18608
295 Ga0501075_0184595 3300049591 Bacteria 1591
296 Ga0501075_0340304 3300049591 Bacteria 1143
297 Ga0501076_0002467 3300049592 Bacteria 12709
298 Ga0501076_0008205 3300049592 Bacteria 7650
299 Ga0501077_0000262 3300049593 Bacteria 30957
300 Ga0501077_0031839 3300049593 Bacteria 3356
301 Ga0501257_083264 3300049686 Bacteria 827
302 Ga0501079_0000684 3300049741 Bacteria 22742
303 Ga0501079_0018263 3300049741 Bacteria 5358
304 Ga0501080_0085957 3300049742 Bacteria 2922
305 Ga0501080_0101302 3300049742 Bacteria 2672
306 Ga0501080_0188020 3300049742 Bacteria 1898
307 Ga0501080_1709166 3300049742 Bacteria 531
308 Ga0501081_0000356 3300049743 Bacteria 24749
309 Ga0501081_0008011 3300049743 Bacteria 6856
310 Ga0501083_0093533 3300049744 Bacteria 1985
311 Ga0501083_0271560 3300049744 Bacteria 1103
312 Ga0501035_0033821 3300049822 Bacteria 4647
313 Ga0501035_0338190 3300049822 Bacteria 1262
314 Ga0501035_0420662 3300049822 Bacteria 1109
315 Ga0501035_0491579 3300049822 Bacteria 1011
316 Ga0501044_0210071 3300049823 Bacteria 1901
317 Ga0501045_0000749 3300049824 Bacteria 20755
318 Ga0501045_0174658 3300049824 Bacteria 1600
319 Ga0501045_0427711 3300049824 Bacteria 985
320 Ga0501045_0558187 3300049824 Bacteria 849
321 nmdc:mga05p37_1637863_c1 3300050507 Bacteria 631
322 nmdc:mga05p37_1652254_c1 3300050507 Bacteria 628
323 nmdc:mga05p37_713833_c1 3300050507 Bacteria 1111
324 nmdc:mga05p37_858391_c1 3300050507 Bacteria 985
325 nmdc:mga09592_498414_c1 3300050508 Bacteria 1049
326 nmdc:mga09592_583065_c1 3300050508 Bacteria 959
327 nmdc:mga09592_676238_c1 3300050508 Bacteria 880
328 nmdc:mga09592_787859_c1 3300050508 Bacteria 805
329 nmdc:mga09592_85423_c1 3300050508 Bacteria 2692
330 nmdc:mga09592_94312_c1 3300050508 Bacteria 2560
331 nmdc:mga0qj67_215285_c1 3300050509 Bacteria 1560
332 nmdc:mga0qj67_708023_c1 3300050509 Bacteria 801
333 nmdc:mga0qj67_81_c1 3300050509 Bacteria 65783
334 nmdc:mga0qj67_8897_c1 3300050509 Bacteria 7450
335 nmdc:mga0qj67_95852_c1 3300050509 Bacteria 2389
336 nmdc:mga06r32_107818_c1 3300050510 Bacteria 2738
337 nmdc:mga06r32_131696_c1 3300050510 Bacteria 2473
338 nmdc:mga06r32_733550_c1 3300050510 Bacteria 952
339 nmdc:mga08y16_263478_c1 3300050511 Bacteria 1780
340 nmdc:mga08y16_30060_c1 3300050511 Bacteria 5720
341 nmdc:mga0n895_15989_c1 3300050512 Bacteria 6870
342 nmdc:mga0n895_255384_c1 3300050512 Bacteria 1779
343 nmdc:mga0n895_8503_c1 3300050512 Bacteria 8894
344 nmdc:mga0rr50_1707_c2 3300050513 Bacteria 9884
345 nmdc:mga0rr50_175110_c1 3300050513 Bacteria 1751
346 nmdc:mga0rr50_833441_c1 3300050513 Bacteria 787
347 nmdc:mga08x19_115169_c1 3300050514 Bacteria 1797
348 nmdc:mga08x19_222663_c1 3300050514 Bacteria 1297
349 nmdc:mga08x19_252481_c1 3300050514 Bacteria 1218
350 nmdc:mga08x19_5016_c1 3300050514 Bacteria 7828
351 nmdc:mga08x19_8620_c1 3300050514 Bacteria 6076
352 nmdc:mga0a205_675095_c1 3300050515 Bacteria 884
353 Ga0495601_0051090 3300053077 Bacteria 2609
354 Ga0495601_0350122 3300053077 Bacteria 960
355 Ga0501084_0000355 3300054114 Bacteria 34952
356 Ga0501084_0073976 3300054114 Bacteria 2853
357 Ga0501084_0537369 3300054114 Bacteria 988
358 Ga0501082_0004982 3300060353 Bacteria 11595
359 Ga0501082_0015467 3300060353 Bacteria 6567
360 Ga0530510_0000542 3300061734 Bacteria 24234
361 Ga0530510_0001016 3300061734 Bacteria 18589
362 Ga0530510_0364844 3300061734 Bacteria 1086
363 Ga0530510_0405452 3300061734 Bacteria 1028
364 Ga0207662_10240778
365 JGI25406J46586_10033290
366 rootH1_10028441
367 Ga0055536_1001115
368 Ga0055530_10007749
369 Ga0070676_10598993
370 Ga0068869_100124237
371 Ga0070680_100047133
372 Ga0070680_100547722
373 Ga0070689_100395618
374 Ga0070691_10137126
375 Ga0070687_100882180
376 Ga0070692_10069618
377 Ga0070669_100036595
378 Ga0070675_101398689
379 Ga0070673_100055889
380 Ga0070688_100212556
381 Ga0070710_10219571
382 Ga0070705_100005927
383 Ga0070705_100006315
384 Ga0070705_101063953
385 Ga0070705_101109481
386 Ga0070700_100007947
387 Ga0070700_100160742
388 Ga0070700_100666984
389 Ga0070694_100003602
390 Ga0070694_100027153
391 Ga0070694_100097420
392 Ga0070694_100420808
393 Ga0070694_100484781
394 Ga0068867_100005189
395 Ga0070706_100894919
396 Ga0070707_100739603
397 Ga0070698_100407656
398 Ga0070698_101059015
399 Ga0070699_100132018
400 Ga0070697_100051654
401 Ga0070697_100318670
402 Ga0070672_100639249
403 Ga0070695_100021073
404 Ga0070695_100088257
405 Ga0070695_100125324
406 Ga0070695_100240650
407 Ga0070695_100483339
408 Ga0070696_100017358
409 Ga0070696_100114639
410 Ga0070696_100183678
411 Ga0070696_100394799
412 Ga0070696_100557025
413 Ga0070696_100671933
414 Ga0070696_100880641
415 Ga0070693_100084794
416 Ga0070693_100097546
417 Ga0070704_100165753
418 Ga0070704_100527151
419 Ga0070704_101616809
420 Ga0068857_101056467
421 Ga0070702_100239862
422 Ga0068859_100973719
423 Ga0068864_100607362
424 Ga0068866_10054498
425 Ga0068861_100007854
426 Ga0068870_10552399
427 Ga0068860_101969024
428 Ga0068862_100005942
429 Ga0068862_100674955
430 Ga0081539_10000233
431 Ga0070715_10017730
432 Ga0070715_10582315
433 Ga0070712_101291161
434 Ga0075430_100002379
435 Ga0075430_100023970
436 Ga0075430_100121306
437 Ga0075430_100302299
438 Ga0075430_100492187
439 Ga0075431_100024526
440 Ga0075431_100160686
441 Ga0075431_100556626
442 Ga0075431_100577024
443 Ga0075433_10317334
444 Ga0075433_11516331
445 Ga0075434_100000006
446 Ga0075434_100007265
447 Ga0075434_101051058
448 Ga0075429_100074373
449 Ga0075429_100187705
450 Ga0075429_100222678
451 Ga0075429_100567944
452 Ga0075436_100000174
453 Ga0075436_100015073
454 Ga0075436_100203244
455 Ga0075436_100239639
456 Ga0097620_100973617
457 Ga0075435_100008433
458 Ga0075435_100134916
459 Ga0075435_100139644
460 Ga0111539_10031454
461 Ga0111539_10111209
462 Ga0111539_10766119
463 Ga0111539_12145935
464 Ga0114129_10014850
465 Ga0114129_10291977
466 Ga0114129_10465766
467 Ga0114129_10475514
468 Ga0114129_10877862
469 Ga0105243_10052058
470 Ga0105243_10779246
471 Ga0105249_10004544
472 Ga0163162_10974922
473 Ga0157372_10364935
474 Ga0157375_10582061
475 Ga0157380_10056755
476 Ga0209758_1000237
477 Ga0209050_1016440
478 Ga0209051_1007804
479 Ga0209257_1074576
480 Ga0207692_10038640
481 Ga0207692_10571962
482 Ga0207685_10315454
483 Ga0207645_10048896
484 Ga0207643_10059694
485 Ga0207684_10920539
486 Ga0207660_10024914
487 Ga0207660_10208981
488 Ga0207652_10792327
489 Ga0207646_10126108
490 Ga0207646_10911149
491 Ga0207681_11489288
492 Ga0207659_10973435
493 Ga0207686_11271179
494 Ga0207709_10035534
495 Ga0207704_10974500
496 Ga0207691_10077489
497 Ga0207689_10116099
498 Ga0207651_10021376
499 Ga0207712_10007146
500 Ga0207668_10037139
501 Ga0207708_10020652
502 Ga0207708_10186974
503 Ga0207708_10281280
504 Ga0207708_10342342
505 Ga0207708_10398759
506 Ga0207648_10006629
507 Ga0207648_11008002
508 Ga0207648_11751582
509 Ga0207676_11262951
510 Ga0207675_100012507
511 Ga0207675_101390740
512 Ga0209969_1015231
513 Ga0209996_1002430
514 Ga0209996_1003135
515 Ga0210000_1016402
516 Ga0209995_1026371
517 Ga0209999_1014973
518 Ga0209971_1041101
519 Ga0209966_1001893
520 Ga0209998_10036851
521 Ga0207428_10142168
522 Ga0207428_10162887
523 Ga0207428_10468704
524 Ga0268265_10037327
525 Ga0268265_10758558
526 Ga0307408_100157761
527 Ga0307408_100159047
528 Ga0307408_102076540
529 Ga0307405_10056816
530 Ga0307410_11593085
531 Ga0307407_10095785
532 Ga0307412_10110343
533 Ga0307416_100065352
534 Ga0307416_100115301
535 Ga0307416_100166789
536 Ga0307411_10150653
537 Ga0307411_10510108
538 Ga0307411_10978834
539 Ga0307411_11015259
540 Ga0373934_0044658
541 Ga0373949_0191660
542 Ga0373936_0053864
543 Ga0373936_0102406
544 Ga0373941_0150813
545 Ga0373953_0022940
546 Ga0373953_0262512
547 Ga0373954_0000020
548 Ga0373954_0213485
549 Ga0373956_0176376
550 Ga0373957_0057916
551 Ga0373960_0285924
552 Ga0373955_0067825
553 Ga0373935_1069540
554 Ga0373935_1189433
555 Ga0373927_0034885
556 Ga0373927_0539210
557 Ga0373927_0632031
558 Ga0373933_0002721
559 Ga0373933_0003747
560 Ga0373933_0320282
561 Ga0373937_0000179
562 Ga0373937_0024543
563 Ga0373937_0077492
564 Ga0373937_1248348
565 Ga0373937_1709450
566 Ga0373925_0017712
567 Ga0439453_0012590
568 Ga0439441_000937
569 Ga0439441_000951
570 Ga0439441_001626
571 Ga0439443_011979
572 Ga0439451_081698
573 Ga0450896_055667
574 Ga0439435_0014099
575 Ga0439444_0002090
576 Ga0439460_0000061
577 Ga0450893_0026978
578 Ga0466964_0047337
579 Ga0466968_0138344
580 Ga0451576_0177321
581 Ga0451576_0322217
582 Ga0451576_0519146
583 Ga0451576_0949472
584 Ga0495592_0004466
585 Ga0495592_0202220
586 Ga0495629_0309309
587 Ga0495580_0827425
588 Ga0495639_0145301
589 Ga0495639_0145880
590 Ga0495662_0016479
591 Ga0495664_0233134
592 Ga0495628_0071435
593 Ga0495630_0022606
594 Ga0495630_0032463
595 Ga0495666_0030001
596 Ga0495642_0247066
597 Ga0495640_0030993
598 Ga0495640_0042600
599 Ga0495586_0038367
600 Ga0495586_0165483
601 Ga0495587_0029938
602 Ga0495609_0213677
603 Ga0495621_0212098
604 Ga0495667_0025112
605 Ga0495667_0056276
606 Ga0495668_0689251
607 Ga0495634_0018787
608 Ga0495635_0031473
609 Ga0495635_0151989
610 Ga0495659_0080641
611 Ga0495658_0075947
612 Ga0495669_0045461
613 Ga0495613_0068295
614 Ga0495624_0056717
615 Ga0495600_0579850
616 Ga0495604_0083055
617 Ga0495604_0270973
618 Ga0495636_0010391
619 Ga0495680_0066377
620 Ga0495675_0202613
621 Ga0495593_0050479
622 Ga0501031_0052651
623 Ga0501034_1085111
624 Ga0501036_0004740
625 Ga0501036_0081152
626 Ga0501036_1119729
627 Ga0501037_0002212
628 Ga0501038_0002844
629 Ga0501039_0001721
630 Ga0501039_0042247
631 Ga0501040_0000759
632 Ga0501040_0009670
633 Ga0501040_0880400
634 Ga0501041_0000109
635 Ga0501041_0096304
636 Ga0501042_0001562
637 Ga0501042_0049313
638 Ga0501046_0001303
639 Ga0501046_0028243
640 Ga0501046_0928873
641 Ga0501047_0078567
642 Ga0501048_0000190
643 Ga0501048_0006966
644 Ga0501048_0159177
645 Ga0501067_0267033
646 Ga0501068_1022717
647 Ga0501069_0664222
648 Ga0501070_0665808
649 Ga0501071_0006303
650 Ga0501071_0264854
651 Ga0501072_0000763
652 Ga0501072_0041941
653 Ga0501072_0140661
654 Ga0501073_0254112
655 Ga0501074_0141876
656 Ga0501075_0000840
657 Ga0501075_0000926
658 Ga0501075_0184595
659 Ga0501075_0340304
660 Ga0501076_0002467
661 Ga0501076_0008205
662 Ga0501077_0000262
663 Ga0501077_0031839
664 Ga0501257_083264
665 Ga0501079_0000684
666 Ga0501079_0018263
667 Ga0501080_0085957
668 Ga0501080_0101302
669 Ga0501080_0188020
670 Ga0501080_1709166
671 Ga0501081_0000356
672 Ga0501081_0008011
673 Ga0501083_0093533
674 Ga0501083_0271560
675 Ga0501035_0033821
676 Ga0501035_0338190
677 Ga0501035_0420662
678 Ga0501035_0491579
679 Ga0501044_0210071
680 Ga0501045_0000749
681 Ga0501045_0174658
682 Ga0501045_0427711
683 Ga0501045_0558187
684 nmdc:mga05p37_1637863_c1
685 nmdc:mga05p37_1652254_c1
686 nmdc:mga05p37_713833_c1
687 nmdc:mga05p37_858391_c1
688 nmdc:mga09592_498414_c1
689 nmdc:mga09592_583065_c1
690 nmdc:mga09592_676238_c1
691 nmdc:mga09592_787859_c1
692 nmdc:mga09592_85423_c1
693 nmdc:mga09592_94312_c1
694 nmdc:mga0qj67_215285_c1
695 nmdc:mga0qj67_708023_c1
696 nmdc:mga0qj67_81_c1
697 nmdc:mga0qj67_8897_c1
698 nmdc:mga0qj67_95852_c1
699 nmdc:mga06r32_107818_c1
700 nmdc:mga06r32_131696_c1
701 nmdc:mga06r32_733550_c1
702 nmdc:mga08y16_263478_c1
703 nmdc:mga08y16_30060_c1
704 nmdc:mga0n895_15989_c1
705 nmdc:mga0n895_255384_c1
706 nmdc:mga0n895_8503_c1
707 nmdc:mga0rr50_1707_c2
708 nmdc:mga0rr50_175110_c1
709 nmdc:mga0rr50_833441_c1
710 nmdc:mga08x19_115169_c1
711 nmdc:mga08x19_222663_c1
712 nmdc:mga08x19_252481_c1
713 nmdc:mga08x19_5016_c1
714 nmdc:mga08x19_8620_c1
715 nmdc:mga0a205_675095_c1
716 Ga0495601_0051090
717 Ga0495601_0350122
718 Ga0501084_0000355
719 Ga0501084_0073976
720 Ga0501084_0537369
721 Ga0501082_0004982
722 Ga0501082_0015467
723 Ga0530510_0000542
724 Ga0530510_0001016
725 Ga0530510_0364844
726 Ga0530510_0405452

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11578

DUF3237

Protein of unknown function (DUF3237)

35

180

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c5o-assembly1.cif.gz_D crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris 0.9585 1 149
3c5o-assembly1.cif.gz_D crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris 0.9523 1 149
3c5o-assembly1.cif.gz_A crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris 0.9512 1 149
3g7g-assembly1.cif.gz_E crystal structure of the protein with unknown function from clostridium acetobutylicum atcc 824 0.949 2 149
3c5o-assembly1.cif.gz_C crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris 0.9443 1 149
ID Description Score Start End Superfamily
3c5oC00 Mainly Beta;Beta Barrel;Porin; 0.9415 1 149 2.40.160.20
3c5oC00 Mainly Beta;Beta Barrel;Porin; 0.9291 1 149 2.40.160.20
3g7gG00 Mainly Beta;Beta Barrel;Porin; 0.9188 1 149 2.40.160.20
3g7gG00 Mainly Beta;Beta Barrel;Porin; 0.9128 1 149 2.40.160.20
4puxA00 Mainly Beta;Beta Barrel;Porin; 0.8736 2 149 2.40.160.20
ID Description Score Start End GO Terms
AF-A0A401YLT4-F1-model_v4 UPF0311 protein EHYA_03247 0.9981 2 147
AF-A0A6N7IE59-F1-model_v4 UPF0311 protein GEV03_14840 0.9958 2 149
AF-A0A3A5JAM3-F1-model_v4 UPF0311 protein D3260_16600 0.9954 2 149
AF-A0A3N1D4C2-F1-model_v4 UPF0311 protein EDD29_6015 0.9952 2 149 GO:0004497
GO:0071949
AF-A0A7Y8VKP6-F1-model_v4 deleted 0.9949 2 149

Map